Jayatirtha: Nyayasudha,
a subcommentary on Madhva's Anuvyakhyana, a commentary on Badarayana's Brahmasutra.
Integrated version including Anuvyakhyana and Brahmasutra.

Adhyaya 2



Input by members of the Sansknet project
(http://sansknet.ac.in/)




Inconsistencies in the segmentation of words and phrases are
due to the custom Devanagari encoding of the original Sansknet file.
THE TEXT IS NOT PROOF-READ.


NOTES:
As an additional feature, this GRETIL version incorporates
Bādarāyaṇa's Brahmasūtras and Madhva's Anuvyākhyāna
into the Sansknet e-text of Jayatīrtha's Nyāyasudhā.


References to K.T. Pandurangi's edition of the Nyāyasudhā
have been added for easier orientation, although the
Sansknet e-text is probably based on a different edition.



STRUCTURE OF REFERENCES (added):
BBs_n,n.n = Bādarāyaṇa-Brahmasūtra_adhyāya,pāda.sūtra
MAnuv_n,n.n = Madhva's Anuvyākhyāna_adhyāya,pāda.verse

JNys_n,n.n = Jayatīrtha's Nyāyasudhā_adhyāya,pāda.adhikaraṇa (Roman numbering)
(NOTE: The adhikaraṇa-numbering of the Brahmasūtras is retained,
although Madhva's commentary and Jayatīrtha's subcommentary
do not cover all adhikaraṇas of the mūla text.)


*n,nnn* = *volume,page* of K.T. Pandurangi's edition (Bangalore, c. 2002-2006)


BOLD for Brahmasūtra
ITALICS for Madhva's Anuvyākhyāna




THIS GRETIL TEXT FILE IS FOR REFERENCE PURPOSES ONLY!
COPYRIGHT AND TERMS OF USAGE AS FOR SOURCE FILE.

Text converted to Unicode (UTF-8).
(This file is to be used with a UTF-8 font and your browser's VIEW configuration
set to UTF-8.)

description:multibyte sequence:
long a ā
long A Ā
long i ī
long I Ī
long u ū
long U Ū
vocalic r
vocalic R
long vocalic r
vocalic l
vocalic L
long vocalic l
velar n
velar N
palatal n ñ
palatal N Ñ
retroflex t
retroflex T
retroflex d
retroflex D
retroflex n
retroflex N
palatal s ś
palatal S Ś
retroflex s
retroflex S
anusvara
visarga
long e ē
long o ō
l underbar
r underbar
n underbar
k underbar
t underbar

Unless indicated otherwise, accents have been dropped in order
to facilitate word search.

For a comprehensive list of GRETIL encodings and formats see:
http://gretil.sub.uni-goettingen.de/gretil/gretdiac.pdf
and
http://gretil.sub.uni-goettingen.de/gretil/gretdias.pdf

For further information see:
http://gretil.sub.uni-goettingen.de/gretil.htm










Adhyaya 2, Pada 1


// atha śrīmannyāyasudhāyāṃ smṛtyadhikaraṇam //


*5,1*


yatpadaṃ vedasaṃvedyaṃ kaṭākṣeṇāpi vīkṣitum /
na kṣamante vimatayastamupāse śriyaḥ patim // 1 //


ekavākyatā(di)siddhaye prathamādhyāyārthasaṅgatatvena dvitīyādhyāyārthaṃ vivakṣurabuddhisthena saṅgaterdarśayitumaśakyatvāt prathamādhyāyārthaṃ tāvadanuvadati- ukta iti //

uktaḥ samanvayaḥ sākṣād ... // MAnuv_2,1.1a //

NYĀYASUDHĀ:
(sakala)jagajjanmādinimittakāraṇe sārvajjñasarvaiśvaryādyanantaguṇaparipūrṇe 'vidyādyavadyagandhavidhure pare brahmaṇi nārāyaṇe svaravarṇapadavākyamahāvākyarūpasya samastasya śāstrasya, sākṣātparamamukhyayā vṛttyā natu lakṣaṇayā, tathā mahātātparyeṇa natu pārārthyena samanvayaḥ prathame 'dhyāye samarthita ityarthaḥ /

yadyapi samanvayaśabdenaiva sākṣādityartho labhyate /
tathāpi parakīyasaṃśabdavyākhyānanirasane 'vahitairbhavitavyamiti sūcanāya tadvayākhyānamidaṃ kṛtamityadoṣaḥ /
athavā samanvayaśabdena mukhyayā vṛttyānvayaḥ pratīyate /
paramamukhyayā tu vṛttyā anvayaṃ darśayituṃ sākṣādityuktam /
yadvā na pradhānaparamāṇvādinirāsanena upādānatvādipratipādanena ca paramparayā kintu sākṣādevetyanenācaṣṭe /


*5,8*

evaṃ prathamādhyāyārthamabhidhāya tatsaṅgatatvena dvitīyādhyāyārthamāha- avirodha iti //

... avirodho 'tra sādhyate // MAnuv_2,1.1b //


NYĀYASUDHĀ:
atrokte 'rthe 'virodho virodhābhāvo 'tra vyācikhyāsitatayā buddhisannihite dvitīye('dhyāye) sādhyate /
anenāsyādhyāsyātītādhyāyena kāryakāraṇabhāvalakṣaṇa(ṇā)saṅgatiḥ sūcitā bhavati /
sakalaśāstrasya samanvayena jagajjanmādikāraṇatve samastagurapūrṇatve 'śeṣadoṣavidhuratve ca parasya brahmaṇo 'bhihita eva(hi) tatra virodhaḥ sphurati /
nānyathā nirāśrayatvāt /
virodhasphūrtāveva tadabhāvasādhanasyāvasaro netarathā /
aprāptapratiṣedhāyogāt /
ato 'tītādhyāyārthasya kāraṇatvametadadhyāyārthasya kāryatvaṃ niścīyate /
athavā śrutisamanvayenopapādito 'pyartho na tāvacchrotṝṇāṃ dṛḍhanirūḍho bhavati, yāvadatra pratīte virodhābhāvo na sādhyate /
virodhena śrutīnāmevāprāmāṇyaśaṅkanāt /
tathā cānupapāditakalpa evāpadyate /
virodhābhāvasādhane tu bhavatyeva dṛḍhanirūḍhaḥ /
yathoktam /
"vimṛśya pakṣapratipakṣābhyāmarthāvadhāraṇaṃ nirṇayaḥ'; iti /
ato viparītakāryakāraṇabhāvalakṣaṇā anayossaṅgatiḥ /

nanūktārthe virodhastatra tatraiva parihṛtaḥ /
kimatra pari(tatkimaparamava)śiṣyate yadarthamadhyāyāntarārambhaḥ /
satyam /
prativakṣyatyatrācāryaḥ /


*5,16*

nanvevamadhyāyasyāvirodhalakṣaṇaikārthatvenaikavākyatve sati pādabhedaḥ kinnibandhanaḥ /
tatrāpyasya pādasya prāthamyaṃ kinnibandhanamityapekṣāyāmāha-caturvidhasyeti //

caturvidhasya tasyādau yauktas ... // MAnuv_2,1.1c //

NYĀYASUDHĀ:
tasyāvirodhasya /
nirdhāraṇe ṣaṣṭhī /
ādau prathamapāde /
avirodhaḥ sādhyata ityanuvartate /
caturvidhasya tasyetyanuvādātsa caturvidha iti labhyate /


*5,17*

tadayamarthaḥ /
yadyapyukte 'rthe virodhābhāva ityeko 'rthaḥ /
tathāpi yuktisamayaśrutinyāyopetaśrutivirodhābhāvarūpāvāntarabhedena sa caturvidho bhavati /
tatpratipādanena caturṇāṃ pādānāṃ bhedo yujyate /
tasya caturvidhasyāpi virodhābhāvasya madhye yuktivirodhābhāvaḥ prathamapāde sādhyate /
sarveṣāmapi virodhānāṃ yuktyupajīvitavena tadvirodhasya prabalatayā tadabhāvasādhanasya prāthamyopapatteḥ /
yuktipuraskāreṇa yuktyupajīvitvena tadvirodhasya prabalatayā tadabhāvasādhanasya prāthamyopapatteḥ /
yuktipuraskāreṇa pravartanā(mānatvā)cca vicāraśāstrasyeti /

nanu kathamabhāvasya cāturvidhyam /
ucyate /
caturvidhā hi virodhino(nyo)yuktyādayaḥ /
tadupadhānādvirodho 'pi caturvidho 'bhidhīyate /
tatastatpratiyogiko 'bhāvo 'pi tathocyate /
ata eva yaukta ityupapannam /
abhāvasyāpi paramparayā yuktisambandhitvāt /
athavāvirodhapadasannidhāpito virodhastasyeti parāmṛśate /
tathāca virodhasya yuktyādyupadhānena caturvidhatvāttadabhāvasādhanena pādabhedo yujyate /
caturvidhasya tasya virodhasya madhye yaukto virodha ādāvuktaprakāreṇa prabalo yatastasmāttadabhāvo 'trādau sādhyata iti yojanīyam /
yadvā tasyeti virodhiparāmarśo 'yam /
tasyāpyavirodhapadena buddhisannihitatvāt /
avirodho hi virodha(nirūpaṇa)dhīnanirūpaṇaḥ /
virodhaśca virodhinā vinā nopapadyate /
tataśca virodhino yuktyādibhedena caturvidhatvā(tta)dvirodhābhāvasādhanena pādabhedopapattiḥ /
caturvidhasyāpi tasya virodhino madhye yukteḥ prabalatvādādau yaukto yuktisambandhī virodhābhāvaḥ sādhyata iti yojyam /


*5,20*

prathamādhikaraṇe viśeṣamāha- tatrāpīti //

... tatrāpi ca smṛteḥ // MAnuv_2,1.1d //


*5,20f.*

NYĀYASUDHĀ:
apipadamādāvityasyānukaṣarṇārtham /
tatra yuktivirodhābhāvapratipādake 'pi pāda ityanaucityaśaṅkāsūcanārthaṃ vā /
caśabdenāvirodhaḥ sādhyata ityetadanukṛṣṭate /
smṛteḥ pāśupatādikāyāḥ /
yadyapi smṛterityasya na nañarthena sambandho ghaṭate virodhaśca samāse guṇabhūtaḥ /
tathāpi buddhayā viviktena tena sambandhaḥ sambhavati /


*5,22*

yuktivirodhaparihāralakṣaṇe 'tra pāde smṛtivirodhaparihāro na kartavyo 'saṅgatatvāt /
kartavyatāyāṃ vā prāthamyaṃ kuta ityata āha- tasyā iti //

tasyāścatuḥsvarūpatvāt ... // MAnuv_2,1.2a //

NYĀYASUDHĀ:
tasyāḥ pāśupatādismṛteryuktisamayādivirodhicatussvarūpatvāt /
etaduktaṃ bhavati /
pāśupatādismṛtayo hi svayamāptābhimatavākyatayā samayarūpā api svābhimatārthe yuktīḥ śrutīśca saṃvādayantyo yuktisamayādivirodhicatuṣyayarūpāḥ /
tataścokte 'rthe tadvirodhaparihāro 'dhyāye 'ntarbhavatyeva /
kintu pādacatuṣyayārthasaṅgato '(pya)yaṃ na niṣkṛṣṭaikatraiva pāde 'ntarbhavati /
tato 'dhyāyādau tadante vā vaktavyaḥ /
prathamātikrame ca kāraṇaṃ na kiñcidastītyādyādhikaraṇe nirūpyata iti /
evañca tatrāpi ca smṛterityayamuktasyāpavādo bhavannapi na sarvathetyuktaṃ bhavati /

samayādivirodhasyāpi parihāreṇa niṣkṛṣṭapādārthābhāvādyuktivirodhaparihārasyāpi bhāvenāntarbhāvasambhavācca /


*5,23*

ekasyaivādhikaraṇasya pādacatuṣyayārthasambandhena catussvarūpatvakathana(nena)prasaṅgacchiṣyāṇāṃ śāstre bahumānotpādanāyānyadapi cāturvidhyaṃ vakti- pratyekamiti //

... pratyekaṃ caturātmakāḥ /
pādāḥ sarve tadaṃśāśca ... // MAnuv_2,1.2bc //


NYĀYASUDHĀ:
catvāro 'pi pādāḥ pratyekaṃ caturātmakāḥ pādacatuṣyayārthavanto draṣṭavyāḥ /
tadyathā /
yuktivirodhaparihāralakṣaṇo 'pyayaṃ pādaḥ samayāditrayavirodhaparihārātmako 'pi bhavati /
tathā samayavirodhaparihāralakṣaṇo 'pi dvitīyo yuktyāditrayavirodhaparihārātmako 'pi bhavatītyādi /
pādā ityevokte sannihitatvādetadadhyāyagatā eveti jñāyate /
tadarthaṃ sarve ityuktam /
sarvādhyāyasambandhino 'pītyarthaḥ /
yo yadadhyāyagataḥ pādaḥ sa tadadhyāya(gata)pādacatuṣyayārthavānavadhe(se)yaḥ /
na kevalamevaṃ pādāḥ, kintu tadaṃśāśca te pādā aṃśā yeṣāṃ te tadaṃśā adhyāyā ityarthaḥ /
prathamādhyāyaḥ samanvayasyevāvirodhāditrayasyāpi pratipādako bhavatītyādi /
pādānāṃ caturātmakatve 'dhikaraṇānāṃ tathātvaṃ siddhameva /
na caivamadhyāyādibhedānupapattiḥ paunaruktyadoṣaśceti vācyam /
vivakṣābhedena sāmañjasyāt /
yadā prathamaḥ samanvayasyārtho vivakṣyate na tadā tadarthatetareṣāmityādi /


*5,24*

anyadādi cāturvidhyaṃ śāstrasya darśayati- mūrtīnāmiti //
Vyāsa-(8)

... mūrtīnāṃ varṇamā'gamāt // MAnuv_2,1.2d //

NYĀYASUDHĀ:
catasṛṇāṃ vāsudevādimūrtīnāṃ pratipādakatvenāpi caturātmakatvaṃ jñātavyamiti yojanā /
nanvetaduktameva, punaḥ kasmāducyata ityata āha- varṇamiti //

atrāgamādityāṅgadvayasyopaśleṣo draṣṭavyaḥ /
tatrādyasyārabhyetyarthaḥ /
dvitīyo 'bhividhau /
āgama iti caturadhyāyiśāstramucyate /
tataścāyamarthaḥ /
na kevalaṃ pratyakṣaraṃ pratipadaṃ pratisūtraṃ pratyadhikaraṇaṃ kintvetacchāstragatamekaṃ varṇamārabhya ā sarvaśāstrāt, pratyadhikaraṇaṃ pratipādaṃ pratyādhyāyaṃ samastena śāstreṇa ca catasro mūrtayaḥ pratipādyanta ityarthaḥ /

kuta etadavagantavyamityata āha- āgamāditi //
bṛhattantrāderityarthaḥ /


*5,26f.*

etatpādādhikaraṇapūrvapakṣasiddhāntayuktīḥ saṅkṣepeṇāha- āptatetyādinā //

āptatā samatādṛṣṭiśrutisāmyabalādbhavāḥ /
sarvānusāro laghutā viśeṣādarśanāphale // MAnuv_2,1.3 //
iṣyasiddhiśca niyamaḥ pūrvapakṣeṣu yuktayaḥ /
etā eva tvatibalā siddhāntasya niyāmakāḥ // MAnuv_2,1.4 //



NYĀYASUDHĀ:
uktārthaṃ smṛtivirodhenākṣipya samādadhatsūtram oṃ smṛtyanavakāśadoṣaprasaṅga iti cennānyasmṛtyanavakāśadoṣaprasaṅgāt oṃ //
iti /
asyārthaḥ /
yaduktaṃ parasya brahmaṇo viṣṇoḥ sakalajagajjanmādikāraṇatvaṃ sārvajñyādisakalaguṇapūrṇatvaṃ samastadoṣadūratvaṃ ca tadayuktam /
pāśupatasāṅkhayabauddhārhatādismṛtiviruddhatvāt /
tā hi śivaprabhṛtīnāmeva jagajjanmādikāraṇatvādikaṃ pratipādayanti /
naca tāsāmanyo 'vakāśo 'sti yena pratīte 'pyarthe tātparyābhāvaṃ pratīmaḥ /
anyathā tāsāṃ smṛtīnāmanavakāśenāprāmāṇyalakṣaṇadoṣaprasaṅga iti /
tanna /
puruṣottamasyaiva pañcarātrādismṛtibhirakhilajagatkāraṇatvāderuktatvāt /
apara(nya)thā tāsāṃ pāśupatādi(smṛti)bhyo 'nyāsāṃ pañcarātrādismṛtīnāmavakāśāntarābhāvenāprāmāṇyadoṣaprasaṅgāditi /

tatrākṣepastāvadayamayuktaḥ /
śrutisamanvayenāsyārthasya sādhitatvāt /
śrutiviruddhānāṃ(ca) smṛtīnāmaprāmāṇyasyeṣṭatvāt /
śrutisamanvayanyāyena pāśupatādismṛtīnāmapi parabrahmaṇi samanvayena śivārcanādiparatvena vā sāvakāśatvācca /
samādhānamapīdamayuktam /
sakalaśāstrapramāṇakatvamuktārthasyābhidhāyedānīṃ smṛtimātropādāne kāraṇābhāvāt /
parābhidhitsitaṃ doṣamavabuddhaya śrutiparityāgastvayuktaḥ /
kintu sa parihartavyaḥ /
anyathā prāgapi śrutiranādeyā syāt /
kiñca pañcarātrādismṛtīnāmaprāmāṇyaṃ parasyeṣyameva /
vāsudevārcanādiparatayā sāvakāśatāpi tena sambhāvyeta /
sāmyāpādanamātre 'pi parasyaiva jayo niścayapratibandhakatvādityato nirdalaṃ pūrvapakṣa tāvadujjīvayati- āptairiti //


*5,27*

smṛtyanavakāśadoṣaprasaṅga iti cen nānyasmṛtyanavakāśadoṣaprasaṅgāt | BBs_2,1.1 |

āptaiḥ pratyakṣato dṛṣṭvā proktamarthaṃ kathaṃ śratiḥ /
pipīlikālipinibhā vārayeta sarvagā hi te // MAnuv_2,1.5 //


NYĀYASUDHĀ:
ayamihābhisandhiḥ pūrvapakṣiṇaḥ /
śrutivirodhena smṛtīnāmaprāmāṇyamabhilaṣatā prabaladurbalatve sarvathā samarthanīye /
anyathātiprasaṅgāt /
na tāvatprāmāṇyakāraṇabhāvābhāvābhyāṃ prābalyadaurbalye /
prāmāṇyasya svatastvenāṅgīkṛtatvāt /
vaiparītyācca /
vākyaprāmāṇye hi kāraṇaṃ vakturāptatvam /
vaktāraśca smṛtīnāmāptāḥ /
na śruteḥ /
apauruṣeyatvenāṅgīkṛtatvāt /
ata eva samūlatvanirmūlatvābhyām /
smṛtīnāmāptimūlatvāt /
śrutestadabhāvāt /
nāpi kṛttimatvākṛtrimatvābhyām /
svarūpato 'prayojakatvāt /
uktarītyā vaiparītyācca /
tadidamuktamāptai rudrakapilakamalāsanādibhiḥ uktamarthaṃ śivādīnāṃ jagatkāraṇatvādikaṃ, pipīlikālipinibhā buddhipūrvapraṇayahīnā, śrutiḥ, kathaṃ vārayet na kathamapīti /


*5,30f.*

nanvaudumbarīṃ spṛṣṭvodgāyedityādiśrutiviruddhānāmaudumbarī sarvā veṣyayitavyetyādismṛtīnāmaprāmāṇyamupalabdhaṃ tathātra syāt /
na syāt /
vaiṣamyāt /
śrutimūlatayābhimatā hi tāḥ smṛtayo 'tastāsāṃ mūlaśrutyanumāpakatvena prāmāṇyamiṣyam /
naca śrutiviruddhāyāḥ smṛtermūlaśrutyanumāpakatvaṃ sambhavatītyaprāmāṇyameva yuktam /
yathā'ha jaiminiḥ"virodhe tvanapekṣaṃ syādasati hyanumānam'; iti /
nacaivaṃ prakṛte /
pāśupatādismṛtīnāṃ śivādipratyakṣamūlatvena śrutimūlatvābhāvāt /
tadidamāha- pratyakṣato dṛṣṭveti //
nanu tarhi smṛtīnāmuktarītyā sāvakāśatvānniravakāśaśrutivirodhenāprāmāṇyamastu /
maivam /
vaiparītyāt /
smṛtayo hi vispaṣṭavādinyo na vivakṣitārthātpracyāvanamarhanti /
śrutayastvasphuṭa(spaṣṭa)vikṣiptavādinyo 'vyavasthitālaukikaśābdalakṣaṇaviṣayā aśakyādhyayanānantāparipūrṇavākyarūpā nārthaviśeṣaniṣṭhā lakṣyante /
ata eva bhavatāṃ mīmāṃsāyāsaḥ /
etadapyuktaṃ prakarṣeṇoktamiti /
vispaṣṭamuktamityarthaḥ /
pipīlikālipinibheti ca /
asphuṭe(spaṣṭe)tyarthaḥ /


*5,33*

kiñca śrutayastāvadavispaṣṭārthāḥ /
praṇetṛvyākhyānasampradāyavikalā na svatantrāḥ kamapyarthaṃ pratipādayitumīśate /
kintu sahajasiddhena yogardhilabdhena vā pratyakṣeṇāśeṣārthadarśināmāptānāṃ vacanamanusṛtya netavyāḥ /
yathoktam /
itihāsapurāṇābhyāṃ vedaṃ samupabṛṃhayediti /
itihāsapurāṇagrahaṇamupalakṣaṇam /
tathāca kathaṃ pāśupatādismṛtyuktārthanivāraṇāya samarthāssyuḥ /
tadidamuktaṃ pipīlikālipinibhā saṃvādena vinā kamapyarthaṃ pratipādayitumasamarthā śrutiryadvacanasaṃvādāpekṣiṇī tairevāptaiḥ pratyakṣato dṛṣṭvā proktamarthaṃ kathaṃ vārayet /
svatantra(svātantrya)daśāyāmapratipādakatvāt /
pāratantrye tu virodhābhāvādeva /
kintu tadanusāreṇaiva netavyeti /


*5,34*

bhavedetadyadi pāśupatādismṛtipraṇetṝṇāmāptatvaṃ syāt /
tadeva kuta ityata āha- sarvagā hīti //
sarvaṃ gacchantyavagacchantīti sarvagāḥ /
āptatvopalakṣaṇametat /
te rudrādayaḥ /
hīti tatra pramāṇaprasiddhiṃ dyotayati /

athavā sarvajñatvamevātra pramāṇaprasiddhayā sādhyate /


*5,35*

tata evānyasya siddheḥ /

tathāhi /
hariharahiraṇyagarbhāstāvatsarvajñatayā śrutītihāsapurāṇeṣu prasiddhāḥ /
tatra harerevāvatārā buddharṣabhakapilāḥ saugatādismṛtipraṇetāraḥ /
tathāca teṣāṃ mohābhāvena rāgadveṣayorapyabhāvāt vipralipsā ca nivartate /
kiñca jñānecchāprayatnasthānakaraṇapāṭavāni tāvadupadeśamātreṇa teṣāṃ niścīyante /
kiñca jñānecchāprayatnasthānakaraṇapāṭavāni tāvadupadeśamātreṇa teṣāṃ niścīyante /
jñānaṃ tu yathārthamayathārthaṃ vā syāt /
icchāpi pratipipādayiṣā vā vipralipsā veti sandeho 'vaśiṣyate /
tatrābhyāsadaśāpanno 'yamartho 'syeti sāmānyato niścaye bhavatyeva tasya jñānasya yathārthatvaniścayaḥ yathābhyāsadaśāpannamidamaraṇyamamīṣāṃ mleñchānāmato 'sminnete mārgābhijñā iti pānthānāmeva niścayaḥ /
vipralipsā ca hetudarśanena vyāptā hetau sati syāt /
sa ca dvirūpaḥ /
svopakāraḥ parāpakāro vā /
na tāvatpāntheṣu vimārgeṇa pratiṣṭhamāneṣu mleñchānāṃ kaścitsvopakāraḥ /
svasya gṛhītatvāt /
śarīrasya ca karaṇīyāntarabhāvāt /
bhāve vā parityāgāyogāt /
nāpi dvitīyaḥ /
na hyanunmattā anapakāriṇamapakurvate /
nāpi parāpakāramātraṃ puruṣārthaḥ /
tathā sati sarvaḥ sarvamapakuryāditi /
evaṃ vipralipsāpi nivāryate /
anabhyāsadaśāpanne tu viṣaye pramāṇāntarasaṃvādātpravṛttisāmarthyādvā mohavipralipsayornivṛttirityato mleñchā apyāptā bhavanti /
kimuta mahānubhāvā rudrādaya iti /


*5,38*

evaṃ pūrvapakṣasūtrābhiprāyamabhidhāya siddhāntasūtratātparyamāha- iti cediti //

iti ced yadyaśeṣajñā rudrādyā haripūrvakāḥ /
kiṃ nāśeṣavido ... // MAnuv_2,1.6a-c //


NYĀYASUDHĀ:
tanneti śeṣaḥ /
kutaḥ /
niścite hi pāśupatādismṛtiprāmāṇye tadviruddhaṃ viṣṇossarvajagatkāraṇatvādikamasatsyāt /
na caivam /
satpratipakṣatvāt /
āstāṃ tāvacchatiḥ /
pañcarātrādismṛtayo hi viṣṇoreva sakalajagatkāraṇatvādikamabhidadhānā dṛśyante /


*5,38f.*

nanu viruddhayoḥ pramāṇayoḥ sāmye sati satpratipakṣatā syāt /
na caivaṃ prakṛte /
pāśupatādismṛtīnāmāptapraṇītatvāt vispaṣṭavāditvena niravakāśatvācca /
pañcarātrādismṛtīnāṃ tadabhāvādityata āha- yadīti //
aśeṣajñā aśeṣavida ityāptatvopalakṣaṇam /
haripūrvakā harimanuprabhṛtayaḥ pañcarātrādīnāmapi tadupeyam /
naca viśeṣaheturastīti bhāvaḥ /
upalakṣaṇaṃ caitat /
vispaṣṭavāditvena nira(rāna)vakāśatvaṃ ca draṣṭavyam /


*5,40*

kimato yadyevamityata āha- mānamiti //

... mānaṃ hy ubhayatra samaṃ bhavet // MAnuv_2,1.6cd //

NYĀYASUDHĀ:
hiśabdo hetau /
yasmādevaṃ tasmādubhayatra pūrvapakṣasiddhāntayormānaṃ smṛtidvayaṃ samaṃ bhavet /
tathā ca pāśupatādismṛtīnāṃ satpratipakṣatvaṃ sthitamiti śeṣaḥ /

nanu ye viruddhe pramāṇe na tayoḥ sāmyam /
śuktirajatajñānayostadabhāvadarśanāt /
ye ca same na tayorvirodhaḥ /
paṭaśuklo dīrghaścetyatra tadabhāvāt /
tatkathaṃ pāśupatādismṛteḥ satpratipakṣatvasambhavaḥ /
sambhave 'pi jitaṃ pareṇa /
siddhāntanirṇayasyāyogādityata āha- mānamiti //
ubhayatra dvayossmaraṇayormadhye yatsamaṃ saha mayā mūlapramāṇena vartate, tadeva mānamanyadapramāṇam /
etaduktaṃ bhavati /
viśeṣānirdhāraṇāyāmeva satpratipakṣatvam /
vastutastu samūlaṃ mānamanyadamānamiti /
nanu samūlatvena prāmāṇyāvadhāraṇe prāmāṇyasya paratastvāpattiḥ /
maivam /
parasparavirodhenāprāmāṇyaśaṅkāprāptau samūlatvena tadapanayanāt /
tathobhayatra smaraṇe yatpañcarātrādismaraṇaṃ samaṃ samūlapramāṇaṃ saṃvādipamāṇāntaropetaṃ ca, tadeva mānaṃ bhavenna tu pāśupatādikam, mūlādyabhāvāt /
ato noktadoṣa iti yojyam /
vakṣyete hi śrutimūlatvatatsaṃvāditve ca pañcarātrādīnām /


*5,42*

nanu kathaṃ pāśupatādismṛtīnāṃ nirmūlatvāt /
yāvatā paśupatiprabhṛtīnāmāptistatra mūlamuditetyata āha- na ceti //

nacāptiniścayastatra śakyate vyabhicārataḥ // MAnuv_2,1.7ab //

NYĀYASUDHĀ:
tatra śivādiṣu niścayopāyābhāvāditi śeṣaḥ /
nanūktamatra"sarvagā hi te'; iti /
maivam /
"nityaṃ vṛddhikṣayopetam'; ityādinā paramapuruṣāditareṣāṃ sārvajñyābhāvasyoktatvāt /
śrutyādīnāṃ copacaritatvāt /

nanvasti tāvadviṣṇoranupacaritasārvajñyam /
śivādīnāmapyupāyopeyaviṣayam /
kiṃ gaṅgāvālukākīṭasaṅkhayāparijñānena /
satyam /
na tāvattattvajñānamevāptiḥ /
vipralambhake 'tivyāptirityāha- vyabhicarata iti //


*5,43f.*

athocyeta sarvajñānāṃ mohābhāvāttanmūlayo rāgadveṣayorabhāve vipralipsāpi nivartata ityāptiniścaya iti /
kiṃ tatra sarve 'pi tīrthakarā āptā ityaṅgīkṛtyaivamanumīyate /
uta svasvābhimatamekameva /
ādyaṃ dūṣayati- vyabhicārata iti //
pañcarātrādismṛtipraṇetari nārāyaṇe asyāṅgīkārasya bhagnatvādityarthaḥ /
abhaṅge vā siddhaṃ

naḥ samīhitam /
yadvā vyabhicāro 'nyonyavirodhaḥ /
nahi parasparaviruddhavādinaḥ sarve 'pyāptā ityaṅgīkartumucitam /
vastuvikalpaprasaṅgāt /
dvitīyaṃ parācaṣṭe- vyabhicārata iti //
yasya tīrthakarasyāptatvaṃ nāṅgīkriyate /
tatraiva sārvajñyasya vyabhicārādityarthaḥ /
naca tatra sāvarjñyaṃ nāṅgīkriyata iti yuktam /
samānanyāyatvāt /
atha hetuṃ viśiṃṣyāttadā sandigdhāsiddhayādikam /


*5,45f.*

yadapyuktaṃ jñānecchāprayatnasthānakaraṇapāṭavāni tāvadupadeśamātreṇa niścīyanta iti /
tanna /
apaṭukaraṇānāmapyupadeśadarśanena vyabhicārādityāha- vyabhicarata iti //
upadeśaviśeṣaṇe cokto doṣaḥ /
niścīyatāṃ jñānam, tasya yāthārthyaṃ tu kutaḥ /
abhyāsadaśāpanno 'yam artho 'syeti sāmānyaniścaye sati tatsiddhiriti netyāha- vyabhicārata iti //
vyabhicāraḥ viprakarṣaḥ teṣāmeva sannidhānaṃ durlabhamasmadādīnāṃ, dūre tadīyābhyāsāvadhāraṇamiti bhāvaḥ /
vineyavacanaparamparayā tadavadhāraṇamiti cet(na) /
tīrthakarāntare vyabhicārādityāha- vyabhicārata iti //
tāsu tāsu smṛtiṣvabhiniviṣyāḥ sarve 'pi hi taṃ tamācāryaṃ tatra tatrārthe 'bhyāsavantamevācakṣate /
naca tadīyaṃ jñānaṃ yathārthamevāṅgīkartuṃ śakyaṃ, tvatsiddhāntavirodhitvāt /
anyathā tvadīyasiddhāntasyāvāstavatvāpātādityāha- vyabhicārata iti //
vyabhicāraḥ virodhaḥ /
icchāpi vipralipsā kuto neti vācyam /
svopakāraparāpakārarūpahetudarśanābhāvāditi cet tatkiṃ smṛtipraṇetārassarve 'pi na vipralambhakāḥ /
addheti cet /
asya niyamasya buddhādiṣu bhagnatvādityāha- vyabhicarata iti //
niyame ca svavyāghātaḥ /
yasya kasyāpi vipralambhakatve, hetudarśanābhāvasya tatraiva vyabhicāraḥ /
nahi tattatpuruṣaviśeṣānusaṃhitāste te prayojanaviśeṣāḥ piśitanayanairasmadādibhiravadhārayituṃ śakyanta ityāśayenāha- vyabhicārata iti //
kenāpi pramāṇena hetūpalambhābhāvo 'vipralambhaheturiti cenna /
sandigdhatvāt /
prayojanābhāvo 'vipralambhahetuḥ /
prayojanābhāvaśca paravañcanasyāpuruṣārthatvādatatsādhanatvācca niścīyata iti cenna /
sampratipannavipralambhakeṣu vyabhicārādityāha- vyabhicārata iti //
apuruṣārthamapi puruṣārthatayā vibhramya vañcayatyasāviti cet /
kiṃ tāvatā /
prakṛtastu vivekitayā naivamiti cenna /
tīrthakarāntare avidyamānasya vivekasyāsminnavadhāraṇānupapatteḥ /

atha viśvahitopadeśārthaṃ pravṛttyā vipralambhābhāvo 'numīyata iti cenna /
buddhādiṣu tatsāmyena vyabhicārādityāha- vyabhicārata iti //


atha te na tathā, kintvayogyajanavyāmohanārthamiti cet /
prakṛto 'pi na tatheti kuto niścitam /
niścayopāyasyetaratrāpi tulyatvāt /


*5,49f.*

yadapyuktaṃ pramāṇāntarasaṃvādānmohavipralipsayornivṛttiriti tadasat /
pramāṇāntaraṃ hi na tāvatpratyakṣam /
atīndriyatvādvipratipannārthasya /
anumānaṃ cedvayabhicāro buddhādiṣu /
ābhāsameva tat madīyaṃ tvanumānameveti cenna /
yato nivārayiṣyāmastava(vacana)camatkāraṃ mā tvariṣṭhā ityāśayenāha- vyabhicārata iti //

athāgamaḥ sa kiṃ vedādiruta tadviruddhaṃ smṛtyantaramathavā svayūthyaracitaṃ granthāntaram /
na prathamadvitīyau /
virodhitvena saṃvādāsambhavādityāha- vyabhicārata iti //
nāpi tṛtīyaḥ /
buddhādipraṇītasmṛtīnāmapi svayūthyapuruṣāntaravacanasaṃvāditvena vyabhicārādityāha- vyabhicārata iti //
te 'pi sandigdhāptabhāvā iti cenna /
prakṛteṣvapi tanniścayopāyābhāvāt /


*5,52*

yaccoktaṃ pravṛttisāmarthyādvayāmohavipralipsayornirāsa iti /
tadayuktam /
pravṛttisāmarthyaṃ hi tato 'rthamavabuddhaya pravṛttasya phalopalambhaḥ /
naca vipratipannasmṛtiphalaṃ svargāpavargalakṣaṇaṃ pratyakṣeṇekṣyate /
indriyāṇāṃ tādṛgārthāviṣayatvādityāha- vyabhicārata iti //
ābhimukhyena cāro 'bhicārastadabhāvo vyabhicāraḥ /
nāpyanumānena /
smṛtitvādervyabhicāritvāt /
anyasya cābhāvādityāha- vyabhicārata iti //
athāgamena /
so 'pi na tāvatsampratipanno 'sti /
naca vipratipannena /
tasya bauddhādiviṣaye 'pi vidyamānatvena vyabhicārādityāha- vyabhicārata iti //


*5,53*

syādetat /
dvividhā khalu śivādipraṇītā smṛtiḥ /
ekā tāvadadṛṣṭaṃ phalamuddiśya pravṛttā /
parā tu sampadādikaṃ dṛṣṭam /
tatra dṛṣṭārthāyāḥ pravṛttisāmarthyaṃ pratyakṣeṇopalabhyate /
tatastatpraṇeturāptatvamiti /
tanna /
tathāpi vipratipannasmṛterāptimūlatve pramāṇābhāvāt /
tata evāsyā api tatsiddhiriti cenna /
vyabhicārāt /
na hyekatrāptena sarvatrāpi tathā bhāvyamiti niyamo 'sti /
tathā ca sati sarvāsāmapi smṛtīnāmāptimūlatāpātāt /
tatrāpi dṛṣṭārthānāṃ pravṛttisāmarthyopalambhādityāha- vyabhicārata iti //
aṅgīkṛtya cedamuditam /
dṛṣṭārthānāmapi tāsāṃ bahulaṃ (phala)vyabhicāro dṛśyate /
tathāca kathaṃ taddṛṣṭāntenetarāsāmāptimūlatānumānamityāha- vyabhicārata iti //

kiñca phalavyabhicāratastadaṃśasyānāptimūlatvasthitau paśupatipraṇītatvādestatra vyabhicārataḥ kathamanumānaṃ syādityāha- vyabhicārata iti //


tadevaṃ pāśupatādismṛtīnāmāptimūlatvāniścayena nirmūlānāṃ pañcarātrādismṛtivirodhenāprāmāṇyameva yuktam /


*5,54*

tadanena"itareṣāṃ cānupalabdheḥ, etena yogaḥ pratyuktaḥ'; iti sūtradvayaṃ vyākhyātaṃ bhavati /

yaccetareṣāṃ mahadahaṅkārāditattvānāmanupalabdheśca sāṅkhayasmṛteraprāmāṇyamiti vyākhyānam /
tatpratyakṣānupalabdhervedānteṣvapi vyabhicārataḥ sarvathānupalabdherasiddheruktatvādayuktamiti /


*5,55*

nanu pañcarātrādismṛtayo 'pi phalaṃ vyabhicaranti /
kvacittaduktānuṣṭhāne 'pi dṛṣṭaphalānupalambhāt /
atastāsāmaprāmāṇyānna tadvirodhena pāśupatādismṛtīnāmaprāmāṇyam /
anyathā phalavyabhicārasyānaikāntikatvamityata āha- na ceti //

nacāsyā vyabhicāre 'pi hīyate mānatā kvacit // MAnuv_2,1.7cd //

NYĀYASUDHĀ:
asyāḥ pañcarātrādismṛteḥ kvacidvayabhicāre 'pīti sambandhaḥ /
kuto na hīyata iti cet /
kimadṛṣṭārthāyāḥ prāmāṇyābhāvo 'bhidhīyate, uta dṛṣṭārthāyā eva /
nādyaḥ /
yataḥ phalavyabhicāre hetau kvacid dṛṣṭārthāyāṃ vartamāne asyā adṛṣṭārthāyāṃ phalavyabhicāre, tata evāprāmāṇye satyapyasyā adṛṣṭārthāyāstāvavanmānatā na hīyate /
kāraṇābhāvāt /
tadvirodhādeva ca pāśupatādīnāmaprāmāṇyamuktam /
dṛṣṭārthāyā aprāmāṇyavacanaṃ tu prakṛtānupayuktamityabhisandhiḥ /


*5,57*

atha dṛṣṭārthāyāḥ phalavyabhicāreṇāprāmāṇye sati tata evādṛṣṭārthā apyapramāṇaṃ bhaviṣyatīti cenna /
tata iti kiṃ tena hetunota tena dṛṣṭāntena /
nādyaḥ /
kvacidvayabhicāre(ṇā)'prāmāṇye 'pyasyā mānatā hīyata iti na yuktam, vyāptyabhāvāt /
na dvitīyaḥ /
kvacidvayabhicāre 'prāmāṇye('pi) asyā mānatā hīyata ityetanna yuktam /
hetvabhāvāt /
nārāyaṇavākyatvādervyabhicārāt /
mā hi bhūtsakalamapi nārāyaṇavākyamapramāṇam /
dṛṣṭārthāyāṃ phalavyabhicāre aprāmāṇye ca satyasyā api mānatā śaṅkāspadatvena hīyata iti ca na vācyam /
atra hetumāha- nirdoṣeti //

nirdoṣavākyamūlatvān na ca tadyuktimūlatā // MAnuv_2,1.7* //


*5,58*

NYĀYASUDHĀ:
nirdoṣavākyaṃ vedaḥ tadyuktiḥ samarthapravṛttijanakatvaṃ prāmāṇyāvadhāraṇasya yata iti śeṣaḥ /
ayamabhisandhiḥ /
kimidaṃ dṛṣṭārthāyāḥ pañcarātrādismṛteḥ phalavyabhicāreṇāprāmāṇyānumānam /
tata evetarasyā apyaprāmāṇyaśaṅkanaṃ ca svātantryeṇa kriyate kiṃvā pratibandīgrahaṇam /
ādyaṃ tūttarādhikaraṇe nirākariṣyāmaḥ /
na dvitīyaḥ /
pratibandīgrahaṇaṃ hi prameyasādhye bhavati /
na caivaṃ prakṛte /
pareṇa khalu phalasaṃvādādinā pāśupatādismṛterāptimūlatvaprāmāṇyayoranumitayorasmābhistannyāyena phalavisaṃvādaṃ pradarśya doṣo 'bhihitaḥ /
yadi nāma pañcarātrādismṛtiprāmāṇyāvadhāraṇaṃ phalasaṃvādayuktyā'śāsyeta /
syādidaṃ tadā pratibandīgrahaṇam /
na cāsmābhiḥ pañcarātrādiprāmāṇyāvadhāraṇasya tadyuktimūlatopeyate /
na caivaṃ tatprāmāṇyāvadhāraṇaṃ nirmūlaṃ syāditi vācyam /
bodhakatvena svataḥsiddhatvāt /
aprāmāṇyaśaṅkānivṛttiḥ kuta iti cedāptimūlatvenetyuktam /
tadavadhāraṇaṃ nirmūlamiti cenna /
śrutisaṃvādanibandhanatvāditi /

nanu śrutereva vaktṛguṇahīnāyā na prāmāṇyamityato nirdoṣavākyetyuktam /
bodhakatvenaiva hi prāmāṇyaṃ vyavasthāpitaṃ tacca vākyatvācchaterubhayasammatam /
doṣastu tadapavādakaḥ /
na cāpauruṣeye sa sambhavatīti niṣkampameva śrutiprāmāṇyamiti vakṣyāma ityarthaḥ /
asyāṃ daśāyāṃ śrutivirodhenāpi pāśupatādismṛtīnāmaprāmāṇyaṃ śakyasādhanam /
yadapyuktam"itihāsapurāṇābhyāṃ vedaṃ samupabṛṃhayet'; iti tattathā kintvaviruddhānāmevopāyatvaṃ na tu viruddhānām /
nacaivamitaretarāśrayatvam /
śrutyarthaniścayasya smṛtisaṃvādaikanibandhanatvābhāvāditi /


*5,62*

nanu ca pañcarātrādismṛtīnāṃ prāmāṇyamaṅgīkurvāṇaiḥ sarvathā pravṛttisāmarthyamaṅgīkaraṇīyam /
vyabhicārasya ca kartṛkaraṇādivaiguṇyanibandhanatvamabhyupeyam /
anyathā phalavyabhicāri ca pramāṇaṃ ceti vyāghātāpātāt /
tathāca phalasaṃvādenāpi prāmāṇyādisādhanaṃ suśakameveti kimucyate, naca tadyuktimūlateti suhṛdbhāvena pṛcchantaṃ pratyāha- vedoktasyeti //

vedoktasyādhikārasya durnirūpatvataḥ sadā /
niyamo vyabhicāro vā naiva jñātuṃ hi śakyate // MAnuv_2,1.8 //


NYĀYASUDHĀ:
vaidikagranthopadiṣyānuṣṭhāne vedoktā niṣekādisaṃskārā evādhikāratāmāpadyanta iti vedoktasyetyuktam /
yadvā vedaśabdena pañcarātrādayo 'pi gṛhyante /
adhikārasyetyupalakṣaṇam /
sādhanānuṣṭhānasyetyapi draṣṭavyam /
durnirūpatvamasmadādyapratyakṣatvam /
sadeti svabhāvata eva na tu deśādivyavadhānenetyarthaḥ /
niyamo vyabhicāro vā phalasyeti śeṣaḥ /
hiśabdo yasmādityarthe /

tasmātphalasaṃvādena prāmāṇyādi nānumīyata iti śeṣaḥ /

etaduktaṃ bhavati /
pramitaṃ khalu liṅgamanumiteḥ karaṇam /
na sattāmātreṇa /
atiprasaṅgāt /
atra (ca) evaṃ prayoktavyam /
pañcarātrādikaṃ pramāṇam /
samarthapravṛttijanakatvātsampratipannavaditi /
tasya cāyamarthaḥ /
etadvihitasādhanānuṣṭhānavadbhistatphalasya niyamena prāpteriti /
nacaitalliṅgaṃ śakyāvadhāraṇam /
vyabhicārasya bahulamupalambhena niyamasya pratyetumaśakyatvāt /
tadavadhāraṇe ca kākatālīyatāyāḥ śaṅkanāt /
tatraitāvadvaktavyam /
kāryaṃ kāraṇasāmagrīsampādyaṃ natu tadekadeśena /
tathātve 'tiprasakteḥ /
prakṛte cobhayakulaśuddhivaidikaniṣekādisaṃskārādyadhikārapūrvakaṃ viśuddhābhisandhyādimatā samyaganuṣṭhita karma asati pratibandhake, sati ceśvarecchādau hi sahakāriṇi, sampadādiphalajananāyālam /
tathā ca yatra phalaṃ nopalabdhaṃ tatrādhikārādivaiguṇyamitaratra tu tatsādguṇyamityato niyamaniścaya iti /
na caitadyuktam /
paragatayoradhikārādibhāvābhāvayorasmadādibhiravagantumaśakyatvāt /
nahi khalu parakīyapitṛpitāmahādīnāṃ mānasādiviśuddhirdhā, niṣekādisamīcīnatā vā, mantrāṇāmayātayāmatvādikaṃ vā dravyādīnāṃ śucitvādikaṃ vā, arvācīnairavagantuṃ śakyate /
tathācāsya phalaniyama eva vyabhicārastu vaiguṇyanimitta iti vāstu /
vyabhicāra evāsya /
kvacitphalopalambhastu kākatālīyo 'nyanimitta eveti vā bhavatviti sandeho na nivartate /
naca sandigdhena prāmāṇyānumānaṃ yujyate /
prāmāṇyasiddhayuttarakālaṃ tu vyabhicārasya vaiguṇyanimittatākalpanāyāmitaretarāśrayatvaṃ syāt /
vedasaṃvādena tu prāmāṇye 'vadhārite śakyate phalavyabhicārasyānyā gatiḥ kalpayitum /
ato vedasaṃvādenaiva prāmāṇyaṃ pañcarātrādīnāmavadhāryate na pravṛttisāmarthyeneti /


*5,67*

evaṃ nyāyasāmyābhāvena pratibandī mocitā /
yadapi pratibandīmādadānasya vivakṣitam /
yathā ca pañcarātrādiprāmāṇyamabhilaṣatā phalavyabhicārasyādhikārādivaikalyanibandhanatā kalpyā tathāhamapi pāśupatādismṛtiṣu kalpayiṣyāmīti, tadayuktaṃ vaiṣamyādityāha- adhikāro hīti //
adhikāro hi sulabhaḥ kathito 'nyāgameṣvalam /
vedokto hy adhikārastu durlabhaḥ sarvamānuṣaiḥ // MAnuv_2,1.9 //


NYĀYASUDHĀ:
adhikāragrahaṇaṃ sādhanasyāpyupalakṣaṇam /
anyāgameṣu pāśupatādiṣu kathito 'dhikāro 'laṃ sulabho 'nāyāsasādhyaḥ /
kutaḥ /
yasmādanyāgameṣu tathā kathitaḥ /
tathāca tadvaikalyakalpanamasambhāvanāpratihatam /
vedoktastvadhikāro viśuddhasantānajatvādiḥ sarvamānuṣairdurlabha iti prasiddhameva /
atastadvaikalyakalpanaṃ sambhāvitameveti /


*5,68*

nanu kathamanyāgameṣvadhikāraḥ sādhanaṃ ca sulabhamuktamityato leśena daśaryati- anyāgameṣviti //

anyāgameṣu vipratvamapi caṇḍālajanmanām /
maṇḍalāntaḥpraveśena kramaśaḥ pratipādyate // MAnuv_2,1.10 //


NYĀYASUDHĀ:
yadbhāvāḥ tareṇa mahatā tapasā vinā vā(na)'labhyaṃ tadapītyarthaḥ /
yatitvādikamapīti vā /
caṇḍālajanmanāmapi kimu kṣatriyādīnāmiti vā /
viprā eva ye kamarṇā caṇḍālāsteṣāṃ kathañcitpratyāpattirvaidikairapyaṅgīkriyata ityataścaṇḍālajanmanāmityuktam /
caṇḍāleṣu janma yeṣāmiti vā /
caṇḍālasambandhitvāccaṇḍālaṃ janma yeṣāmiti vā tathoktāḥ /
kramaśo maṇḍalāntaḥpraveśenetyanenedamucyate /
yo yāvajjātivyavahitastasya tāvanti maṇḍalāni pūjyāni (kalpyāni) /
tatra yadyanmaṇḍalaṃ praviśati tattajjātīyo bhavati /
caramamaṇḍalapraveśe tu vipraḥ sampadyata ityanyāgameṣu pratipādyata iti sambandhaḥ /
tathā coktam
"dīkṣāpraveśamātreṇa brāhmaṇo bhavati kṣaṇāt /
kāpālaṃ vratamāsthāya yatirbhavati mānavaḥ'; //
iti /
etadadhikārasaulabhyamudāharaṇam /
evaṃ sādhanasaulabhyamapi draṣṭavyam /
yathā'huḥ kāpālikāḥ /
"mudrikāṣaṭkatattvajñaḥ paramudrāviśāradaḥ /
bhagāsanasthamātmānaṃ dhyātvā nirvāṇamṛcchati /
karṇikā rucakaṃ caiva kuṇḍalaṃ ca śikhāmaṇiḥ /
bhasma yajñopavītaṃ ca mudrāṣaṭkaṃ pracakṣate /
ābhirmudritadehastu na bhūya iha jāyate (kāyabhāk)'; ityādi /
tathā kālāmukhā api /
rudrākṣakaṅkaṇaṃ haste jaṭā caikā ca mastake /

kapālaṃ bhasmanā snānaṃ lakuṭaṃ (ca kalā) kalaśārcanam'; ityādi /


*5,69*

nanu yathādhikārasādhanayoḥ saulabhyamuktamevaṃ taddaurlabhyamapi tatraivoktamiti cettarhi na kevalaṃ phalasaṃvādena pāśupatādīnāmaprāmāṇyam /
kinnāma parasparavisaṃvādenāpītyāha- adhikāramiti //


*5,70*

adhikāraṃ durāpādyamuktavātisulabhaṃ punaḥ /
aśakyaṃ sādhanaṃ coktavā suśakaṃ tatphalāptaye /
ucyate 'tastaduktaṃ hi vyabhicāri phale 'pi tu // MAnuv_2,1.11 //
kathaṃ pramāṇatāṃ gacchen ... // MAnuv_2,1.12a //


NYĀYASUDHĀ:
yasmātkvacidadhikāraṃ durāpādyamuktvā punarapi sulabhaṃ bravīti, yasmācca tatphalāptaye sampadādiphalāptaye, sādhanamaśakyamuktvā suśakaṃ cocyate /
yasmācca taduktaṃ sādhanaṃ phale 'pi viṣaye vyabhicāri atastaduktaṃ sā pāśupatādyuktiḥ kathaṃ pramāṇatāṃ gacchenna kathamapītyarthaḥ /
durlabhatvoktyanurodhena saulabhyavacanaṃ prarocanārthaṃ vyākhyāyatām /
tathāca phalavisaṃvādo 'pyadhikārādivaiguṇyanimitto bhaviṣyati yathā pañcarātrādāviti cenna /
vaiṣamyāt /
yuktaṃ hi pañcarātrādiṣu tathā kalpanam /
śrutimūlatvena prāmāṇyasya niścitatayā kalpakasya vidyamānatvāt /
pāśupatādau tu tadabhāvena visaṃvādasyāprāmāṇyanibandhanatopapattau kalpakābhāvāt /
kvacitsaṃvādastu kākatālīyo vā guḍajihvikānimitto vā bhaviṣyati /
tadidamuktaṃ tuśabdena /
taduktaṃ tviti sambandhaḥ /
tadevaṃ pāśupatādīnāmapasmṛtitvānna tadvirodhenoktārthāsambhavaḥ śaṅkanīya iti sthitam /

// iti śrīmannyāyasudhāyāṃ smṛtyadhikaraṇam //



___________________________________________________________________________



[======= JNys_2,1.II: navilakṣaṇatvādhikaraṇam =======]


*5,71*

// atha śrīmannyāyasudhāyāṃ navilakṣaṇatvādhikaraṇam //


// oṃ na vilakṣaṇatvādasya tathātvaṃ ca śabdāt oṃ //
parihṛtaḥ smṛtivirodhaḥ /
samprati yuktivirodhaḥ parihriyate /
tathāhi /
śrutyādisamanvayena khalu jagajjanmādikāraṇatvaṃ brahmaṇo nirūpitam /
tatra śrutereva prāmāṇyaṃ tāvaddurlabham /
yaddhi phalavyabhicāri tadapramāṇaṃ dṛṣṭam /
yathā vipralambhakavākyam /
phalavyabhicāriṇī ca śrutiḥ /
putrakāmeṣyayādyanuṣṭhāne 'pi kadācitputrajanmādyanupalabdheḥ /
anyathā phalānupalabdhyoktaṃ pāśupatādyaprāmāṇyamapi na syāt /
ekadeśe cāprāmāṇye tannyāyenaikadeśāntarasyāpyaprāmāṇyānumānaṃ sulabhameva /
kiñca yadabuddhipūrvakaṃ tadapramāṇaṃ yathā pipīlikālipiḥ /
abuddhipūrvakaśca vedo 'pauruṣeyatvāṅgīkārāt /
pauruṣeyatve ca mūlapramāṇaśūnyatvādapramāṇameva, vipralambhakavākyavat /
api cāptāpraṇītavākyatvādunmattavākyavadaprāmāṇyaṃ vedasyānumeyam /
yadā vedasya ī(etā)dṛśī daśā tadā kā vātasmṛtītihāsapurāṇānāṃ phalavyabhicārādi(doṣa)kharkharāṇāṃ prāmāṇyasya /
tathāca vedādisamanvayena na jagajjanmādikāraṇatvaṃ brahmaṇaḥ siddhayatītyevaṃ prāpte tatpratividhānātharsya na vilakṣaṇatvāditi sūtrasya tātparyamāha- nityatvāditi //

na vilakṣaṇatvād asya tathātvaṃ ca śabdāt | BBs_2,1.4 |

... nityatvāt puruṣodbhavaiḥ /
ujkhitaṃ sarvadoṣaiśca kathaṃ no mānatāṃ vrajet // MAnuv_2,1.12c-d //


NYĀYASUDHĀ:
vedavākyamiti śeṣaḥ /
ayamarthaḥ /
bodhakatvena khalu karaṇānāṃ prāmāṇyaṃ doṣāttu, kadācidapanīyate /
vedavākyaṃ ca bodhakatvena vādiprativādisammatam /
anyathā phalavyabhicāro 'pi tatra(sya) na syāt /
vākye ca prāmāṇyasyāpavādakā doṣā abodhakatvaviparītabodhakatvādayaḥsarve 'pi vaktṛdoṣanibandhanā eva /
anvayavyatirekābhyāṃ tadavagamāt /
vedavākyaṃ ca nityatvādapauruṣeyatvātpuruṣadoṣanibandhanaiḥ sarvadoṣairvarjitaṃ svata eva prāmāṇyamāpnoti /
prāmāṇye ca niścite sati phalavyabhicārasya sāmagrīvaikalyaṃ vā pratibandhakasadbhāvo vā kāraṇaṃ kalpayiṣyate /
anyathā siddhānanyathāsiddhayorananyathāsiddhasya balavattvāditi /

atraite prayogā bhavanti /
vedaḥ pramāṇaṃ bodhakatve sati viparītabodhakatvātsampratipannavat /
vimato viparītabodhako na bhavati anāptāpraṇītavākyatvātsampratipannavākyavat /
vimato anāptapraṇīto na bhavati apauruṣeyatvādvayomavat /
vimataḥ phalavyabhicāro vaikalyādinibandhano bhava(vitumarha)ti pramāṇasiddhaphalavyabhicāratvāt carakādyuktaphalavyabhicāravaditi /


*5,77*

syādetat /
nityatvameva vedasya kutaḥ /
prāguktasāmānyasiddhipariśeṣābhyāmiti brūmaḥ /

ye tu svayūthyā vedaprāmāṇyamaṅgīkṛtyāpi tannityatāṃ nānumanyante tānprati sūtrasūcitābhiḥ śrutibhistāmupapādayati- virūpeti //

virūpa nityayā vācā ... // MAnuv_2,1.13a //

NYĀYASUDHĀ:
anena"tasmai nūnamabhidyave vācā virūpa nityayā /
vṛṣṇe codasva suṣyutim'; iti śrutimupādatte /

atra vāco nityatvamucyate /
na vedasya /
tadapi bahukālīnatvaṃ bhaviṣyatītyato"nityayānityayā staumi brahma tatparamaṃ padam'; iti"śrutirvāva nityānityā vāva smṛtayo yāścanyā vācaḥ'; iti śrutimupādatte- nityayeti //

... nityayānityayā sadā /
ityādiśrutibhirvedo nitya ityavagamyate // MAnuv_2,1.13b-d //


NYĀYASUDHĀ:
Vyāsa-(9)


*5,78*

vyākhyānāntaranirāsāya nityayetyetatsadā vidyamānayeti vyākhyātam /
vākyaśeṣe hi bahukālīnā api smṛtīranityapakṣe nikṣipya śrutimeva nityāmāha /
pauruṣeyatāmapi śrutayo 'bhidadhatīti cenna /
āptoktatvasya duravadhāraṇatāyāḥ prāguktatvena pauruṣeyatve prāmāṇyāvadhāraṇānupapattiprasaṅgena durbalatvāt /
prāmāṇyasya svatastvenāpauruṣeyatve 'pi kāraṇābhāvātprāmāṇyaṃ na syāditi prasaṅgasyābhāsatvāt /
prabalaśrutyanusāreṇa tattatpuruṣapravartitatvameva tāsāmartho 'vagantavyaḥ /
tathāca"ṛcaḥ sāmāni jajñire'"ṛgveda evāgnerajayata'; ityādyupapannaṃ bhavati /
na hyekaṃ vākyamanekakartṛkamapi sambhavati /
sambhavati tvanekapravartitamiti /


*5,81*

yadapi pipīlikālipivadabuddhipūrvakatvādaprāmāṇyaṃ śruteriti, tannirākaroti- pipīliketi //

pipīlikālipiścāpi pramāṇamavirodhataḥ // MAnuv_2,1.14ab //

NYĀYASUDHĀ:
co yasmādityarthe /
bodhakatvasamuccaye vā /
tasmāt dṛṣṭāntasya sādhyavikalatvādasadanumānamiti śeṣaḥ /
na kevalaṃ śrutiḥ kintu pipīlikālipirapītyaperarthaḥ /

aprāmāṇyaṃ khalu pipīlikāliperabodhakatvena vā syādviparītabodhakatvena vā /
nādyaḥ /
anubhavaviruddhatvāt /
anyathā puruṣaliperapyabodhakatvaṃ syāt /
tathāca tadvaiyarthyamāpadyeta /
api caivaṃ satyākāśādikamevodāhriyeta tatkiṃ pipīlikālipigaveṣaṇayā /
na dvitīyaḥ /
taddhi balavatpramāṇavirodhataḥ kalpanīyamanyathātiprasaṅgāt /
naca pipīlikālipibodhite 'rthe pramāṇavirodho 'sti /
ataḥ kathamasāvapramāṇaṃ syāt /

syādetat /
lipistāvanna pramāṇaṃ pṛthak /
anupramāṇatritvābhyupagamāt /
naca pratyakṣāgamayorantarbhavati /
atallakṣaṇatvāt /

ato 'numānameveti vācyam /
tacca lekhakabuddhisthaśabdaviṣayaṃ vā tadavabuddhārthaviṣayaṃ vā syāt /
na caitatpipīlikālipau sambhavati /
pramāṇabādhitatvāttatkathamasau pramāṇamiti /
maivam /
tathā satyeḍamūkaliperapyaprāmāṇyaprasaṅgāt /
bhavatu sāpramāṇamitarā tvanumānamiti cenna /
eḍamūkaliperapi sāṃvyāvahārikatvadarśanāt /
kiñcetaratrāpyanumāne kimeḍamūkavyāvṛttyarthaṃ kimapi viśeṣaṇamupādeyamuta neti vācyam /
nādyaḥ /
sandigdhāsiddhiprasaṅgāt /
nirṇītalekhakaiva lipiranumānamiti cenna /
anirṇītalekhakāyā api sāṃvyāvahārikatvāt /
na dvitīyaḥ /
eḍamūkalipāvanaikāntyāt /
atha mūlalekhakabuddhisthaśabdārthānumāne na ko 'pi doṣa iti matam /
tadapi na /
pipīlikālipāvanaikāntyāt /
tadvayāvartane ca sandigdhāsiddheḥ /
nahi pipīlikālipeḥ puruṣaliperasti kaścidviśeṣo yena neyaṃ pipīlikālipiriti niścinuyāt /
tasmātpuruṣalipirapi padamiva padārthasya varṇānāṃ smaraṇahetureṣyavyā /
tatsamaṃ pipīlikālipāvapi /
smṛteśca pramitatvaṃ vakṣyāmaḥ /


*5,85*

nanu pramātve 'pi smṛterna taddhetumātrasya prāmāṇyam /
pramātrādīnāmapi tatprasaṅgāt /
kintu sādhakatamasyaiva /
tacca mana eveti siddhāntaḥ /
lipidarśanādikaṃ tu saṃskāro dvedhābhidhasahakārisampādanenaiva caritārthamiti kathaṃ tasya prāmāṇyam /
maivam /
arthasannikarṣalakṣaṇāvāntaravyāpārasahitaṃ hīndriyaṃ pratyakṣaṃ nendriyamātram /
manasaśca smaraṇodaye saṃskārodbodha evārthasannikarṣaḥ /
tathāca cakṣuṣa ivārthopasarpaṇatatsaṃyogasahitasya prāmāṇyamevaṃ lipidarśanatadudbuddhasaṃskārasahitasyaiva manasa iti kathaṃ na lipeḥ prāmāṇyam /
kevalāyāstu nāstīti cet /
śruterapi tannāṅgīkriyata eveti /

nanvatra pramāṇaśabdo bhāvasādhano vā syātkāraṇasādhano vā /
ādye pipīlikālipiḥ pramāṇamiti sāmānādhikaraṇyaṃ na syāt /
dvitīye tu pramāṇīti bhavitavyam /
kathaṃ vedāḥ pramāṇaṃ smṛtiḥ pramāṇamiti /
pramāṇamiti sāmānyenoddiśya vedāditvavidhānāt /
anyathā tatrāpi daurghaṭyameveti /
maivam /
bhāvasādhanatvābhyupagamāt /
sāmānādhikaraṇyaṃ tu bhāktamiti /


*5,89*

nanu ca śruteḥ samyaganubhavasādhanatvena prāmāṇyamiṣyaṃ natu smārakatvena /
tathāca na śrutiḥ samyaganubhavasādhanabuddhipūrvakatvātpipīlikālipivadityanumāsyata ityata āha- yatheti //

yathā drauṇerulūkena kṛtamapyāsa bodhakam // MAnuv_2,1.14cd //
aviruddhaṃ ... // MAnuv_2,1.15a //


NYĀYASUDHĀ:
yathābuddhipūrvakamapyekenolūkena kṛtamanekakākanāśanamaśvatthāmno 'hameka evānekānvadhiṣyāmītyasyārthasya bodhakaṃ samyaganubhavaṃ prati sādhanaṃ jātam /
tathā śrutirabuddhipūrvāpi samyaganubhavasādhanam /
etaduktaṃ bhavati /

abuddhipūrvakatvaṃ kimanāditvaṃ vivakṣitam, sāditve 'pi buddhijanyatvābhāvo vā pratipādyātharbuddhipūrvakatvābhāvo vānenaitadevaṃ pratipādayiṣyāmītyabhisandhipūrvakatāvaidhuryaṃ vā /
nādyaḥ /
pipīlikālipāvabhāvāt /
gaganameva dṛṣṭānto bhaviṣyatīti cet /
tathāpi śruteranāditvasya pareṇānaṅgīkṛtatvenāsiddheḥ /
na dvitīyaḥ /
utpadyamānaṃ buddhijanyameveti mayāṅgīkṛtatvāt /
na tṛtīyacaturthau /
ulūkakṛtavyāpāre vyabhicārāditi /
yadyapi pratyakṣe vyabhicāro 'tra vaktuṃ śakyate /
tathāpi jñātakāraṇasajatīyatvena śakyaparihāro 'sāviti noditaḥ /
anumānamātre suvaco 'pi cetanavyāpāraviṣayasya tathābhūta eva śākune pradarśayitumucita iti na pradarśitaḥ /
nanu śākunamarthavisaṃvādyapi dṛśyate /
satyam /
yattu pramāṇāviruddhaṃ tadvayabhicārasthalaṃ bhaviṣyatīti bhāvenoktam- aviruddhamiti //
śākunamātre vyabhicārasya darśayituṃ śakyatve 'pyāgamikatvena visaṃvādānarhatayedamudāhṛtam /

nanvāseti katham /
asterbhūrityasya nityatvāt /
vibhaktipratirūpakaṃ cāvyayaṃ bhavatīti vacanādavyayametaditi na doṣaḥ /
vibhaktipratirūpakamityucyate /
nacaivaṃ vibhaktirasti /
na nāsti /
āmantānuprayogasya vidyamānatvāt /


*5,96*

nanvevaṃ tarhi prayujyate /
śrutirna samyaganubhavasādhanaṃ śabdatve satyabuddhipūrvakatvāditi /
yadvā śrutirnāgamo 'buddhipūrvakatvāditi /
abuddhipūrvakatvaṃ ca vivakṣitārthatattvajñānapūrvakatvābhāvaḥ /
ādya(syāpi)sya pipīlikālipāvapraveśe 'pyunmattavākyaṃ dṛṣṭānto bhaviṣyati /
na conmattavākyamapi pramāṇaṃ pramāṇaviruddhatvādityata āha- viruddhaṃ tviti //

... viruddhaṃ tu virodhādeva bādhitam // MAnuv_2,1.15ab //

NYĀYASUDHĀ:
pramāṇaviruddhaṃ yadunmattavākyaṃ tat pramāṇavirodhādeva bādhitamayathārthamiti yāvat /
na tūktahetubhyāmiti /
sopādhikatāmanenācaṣṭe /
ata evāptāpraṇītavākyatvaheturapyapāstaḥ /
ayamabhisandhiḥ /
na tāvatsamyaganubhavasādhanatvābhāvo jñānasādhanatvābhāvena /
jñānasādhanatvasyobhayasiddhatvāt /
nāpi smṛtisādhanatvena /
ananubhūtaviṣayatvasammateḥ /
tato viparītabodhakatvenaiveti vācyam /
evaṃ dvitīyaprayoge 'pi na tāvadanāgamatvamaśabdatvena /
śabdatvasyobhayasammatatvāt /
tasmādayathāthartveneti vaktavyam /
evaṃ tṛtīyaprayoge 'pi sādhyaniṣkaṣarḥ kartavyaḥ /
tathāca tatra pramāṇabādhitatvamupādhiḥ /
yadvānubhavasādhanatvāvacchinne prathamasādhye, vākyatvāvacchinne dvitīyasādhye bodhakatvāvacchinne tṛtīye cāyamupādhiriti /

nanvasyopādheryadayathārthaṃ tatpramāṇaviruddhamiti sādhyavyāpakatve 'pi sādhanāvyāpakatvaṃ kathamityata āha- virodheti //

virodhādarśanāt ... // MAnuv_2,1.15c //

NYĀYASUDHĀ:
pakṣīkṛtāyāṃ śrutāvuktasādhanasadbhāve 'pi pramāṇavirodhasyādaśarnāt /
sādhanāvyāpakatvamiti śeṣaḥ /
atra virodhābhāvāditi vaktavye 'darśanādityuktaṃ virodhābhāvasādhanārthamiti draṣṭavyam /


*5,100*
kimato yadyevaṃ pramāṇaviruddhatvamupādhiriti cet /
upādheḥ pratipakṣonnāyakatvasya vakṣyamāṇatvenānumānānāṃ satpratipakṣatvamityāśayenāha- tasmāditi //

... tasmād vedaprāmāṇyamiṣyate // MAnuv_2,1.15cd //

NYĀYASUDHĀ:
yasmātpramāṇaviruddhatvamayathārthatvasya vyāpakaṃ vyāvṛtaṃ ca pakṣīkṛtādvedāt /
vyāpakanivṛttau vyāpyanivṛttiravaśyambhāvinī /
tasmādvedaprāmāṇyameṣyavyam /
ayamatra prayogaḥ /
vedo nāyathārthaḥ pramāṇāviruddhatvātpratyakṣavat /
yadvā vedo yathārtho bodhakatve sati pramāṇāviruddhatvātpratyakṣavat /
evaṃ vedaḥ samyaganubhavasādhanamanubhavasādhanatve sati pramāṇaviruddhatvātpratyakṣavat /
veda āgamo vākyatve sati pramāṇāviruddhatvātsampratipannavaditi /
evaṃ vākyatvāvacchinne sādhye 'nāptapraṇītatvamupādhistadviparyayeṇa ca pratipakṣo 'bhidheya iti /


*5,103*

astvevaṃ vedaprāmāṇyam /
pañcarātrādismṛtīnāṃ tu katham /
nahi tā apyapauruṣeyāḥ /
yena prāmāṇyamavadhārya phalavyabhicāramanyathā neṣyāma ityata āha- tanmūlatvāditi //

tanmūlatvāt smṛtīnāṃ ca ... // MAnuv_2,1.16a //

NYĀYASUDHĀ:
prāmāṇyamiṣyata iti sambandhaḥ /
yadyapi bhagavadracitānāṃ vedā(dar)thamupalabhya racitatvaṃ vedamūlatvaṃ nāsti /
tasya svataḥ sarvajñatvam /
tathāpi tamanusṛtya racitatvaṃ tanmūlatvamiha vivakṣitamiti noktadoṣaḥ /
ayamatra prayogaḥ /
pañcarātrādismṛtiḥ pramāṇaṃ pramāṇamūlatvātpramāṇasaṃvāditvātsampratipannavaditi /
yadvā vimataṃ pramāṇaṃ vedasaṃvāditvātparābhyupagatārhiṃsādivākyavat /
āptavākyatvamupādhiriti cet (na) /
pratyakṣādau sādhyāvyāpanāt /
vākyatvāvacchinnasādhyavyāpakatvādadoṣa iti cenna /
tathāpi vedetaravākyatvāvacchinnasādhanenopādheḥ pakṣe sādhanasaulabhyāt /
sati caivaṃ smṛtīnāṃ prāmāṇye tadbalena phalavyabhicāro 'pyanyathayitavya iti /

nanu coktārthaviruddhavādīnyapi smṛtītihāsapurāṇānyupalabhyante /
teṣāṃ prāmāṇyasādhane ca bahuviplavaḥ syādityata āha- virodha iti //

... virodho yatra na kvacit // MAnuv_2,1.16b //

NYĀYASUDHĀ:
pūrveṇaivānvayaḥ /
yāsāṃ smṛtīnāṃ sarvathā pramāṇavirodho nāsti tāsāmeva pakṣīkaraṇānna kaściddoṣa ityāśayaḥ /
nanvevaṃ sati vedamūlatvopanyāso vyarthaḥ /
jñānajanakānāmavaśyāṅgīkaraṇīyena virodhābhāvenaiva prāmāṇyasiddheriti cenna /
phalavyabhicāralakṣaṇavirodhadarśanenāsiddhiprasaṅgāt /
prāmāṇyena tadapanayane cetaretarāśrayatvāpātāt /
vedamūlatvena tu prāmāṇye siddhe na ko 'pi doṣa iti /


*5,107*

aprāmāṇyaprayojakasya pramāṇavirodhasyābhāvānna śrutismṛtyoraprāmāṇyamityuktam /
tadayuktam /
śrutyādyukta(sya) īśvarasārvajñāderīśvaro na sarvajñaḥ puruṣatvāt /
yajñadattavat /
ityādyanumānaviruddhatvādityata āha- virodho 'pīti //

virodho 'pi sa evoktaḥ pratyakṣeṇāgamena vā // MAnuv_2,1.16cd //


*5,108f.*

NYĀYASUDHĀ:
prakṛtasambandhārtho 'piśabdaḥ /
yacchabdo 'dhyāhāryaḥ /
virodhādeva bādhitamityaprāmāṇyaprayojakatayokto virodho 'pi sa eva yaḥ pratyakṣeṇāgamena vā syāt /
na punaranumānena /
ayamabhisandhiḥ /
aprāmāṇyaprayojakatayā yadasmābhirabhihitaṃ tatpakṣe 'pyupapādayituṃ khalu parasyāyaṃ prayatnaḥ /
asmābhiśca pratyakṣāgamavirodha eva tathābhipreto nānumānavirodhaḥ /
tathāca pakṣe tadvyutpādanaṃ prakṛtāsaṅgatameva /
svatantrānumānavirodhaṃ tūttaratra nirākariṣyati sūtrakṛditi /

nanu pramāṇavirodha evāprāmāṇye prayojako 'stu kiṃ pratyakṣeṇāgamena veti viśeṣaṇena /
tathā coktanumānavirīdhādvedāderaprāmāṇyamiti /
maivam /
vakṣyāmo hyatra brahmādivastuṣu pramāṇaṃ veda evaika iti vaidike 'rthe 'numānasyānavakāśam /
yatra ca yasyāpraveśo na tasya tadbādhakam /
nahi nayanaṃ sparśāpabādhanasyeṣye /
tathāca kathamanumānaṃ vedā(dyar)thabādhakena tadaprāmāṇye prayojakaṃ syāt /
prakṛtaṃ ca vedādikameveti /


*5,109*

nanvevaṃ (sati) tarhi vedārthamīmāṃsā nārambhaṇīyā syāt mīmāṃsāyā yuktyanusandhānātmakatavādityata āha- āgameneti //

āgamenāgamasyaiva virodhe yuktiriṣyate // MAnuv_2,1.17ab //

NYĀYASUDHĀ:
evaśabdo virodha ityataḥ paro draṣṭavyaḥ /
nirṇayārthamiti śeṣaḥ /
etaduktaṃ bhavati /
anumānaṃ hi dharmyādipramitimapekṣate /
naca dharmyādirūpaṃ brahmādikaṃ vedādṛte siddhayatīti tadanapekṣāyāmāśrayāsiddhayādikam, apekṣāyāṃ tu virodhino dharmyādigrāhakavirodha ityevaṃ vaidike 'rthe 'numānasyānavakāśo 'bhidhistitaḥ /
mīmāṃsāyāṃ tu kvacidāgamasyāgamāntareṇa virodha evārthanirṇayārthaṃ yuktirupādīyate /
sā khalvanyatarāgama(prāmāṇya)mupodbalayantya(ntyā)nyatarāgamabādhayā 'rthanirṇayāya prabhavati /
anyatarāgamasiddhadharmyādyāśrayaṇenā(yeṇa)śrayāsiddhayādyanavakāśāt /
anyatarāgamasya dharmyādigrāhakatvābhāvenāprabalasya, āgamasūcitayopapattestato durbalasya, akiñcitkaratvāt /
tadevamevaṃvidhopapatterāgamike 'pyarthe sāvakāśatvādupapannā mīmāṃseti /


*5,110*

api ca pratyakṣāgamavirodho 'pi na svarūpeṇāprāmāṇyaṃ prayojayati /
kintu tayorupajīvyatvādinā prābalye satyeva durbalayoḥ svayaṃ bādhitatvena samabalayoḥ pratibandhamātrahetutvenāprāmāṇyaniścayānupapatteḥ /
upajīvyādivirodhena cāprāmāṇyaṃ bhavadvedasya na sarvathāyathārthatvalakṣaṇam /
kinnāma pratītārthapracyāvanamātram /
apauruṣeyatayā nirdoṣasya sarvathāprāmāṇyānupapatteḥ /
tathācānyārthakalpanāvaśyaṃ kāryetyāśayavānāha- upajīvyeti /

upajīvyavirodhe tu vedasyānyārthakalpanā // MAnuv_2,1.17cd //

NYĀYASUDHĀ:
upalakṣaṇametat /
niravakāśatvādikamapi grāhyam /
bhavatvevaṃ tataḥ kim /
vedopajīvyatvādikaṃ ca pratyakṣāgamayoreva prāyeṇa sambhavati /
yuktestu kvacideva /
puruṣatvādiyuktestu nāstyeva /
ataśca na tadvirodhena vedasyāprāmāṇyaṃ mantavyamityāśayenāha- pratyakṣamiti //

*5,111*

pratyakṣamupajīvyaṃ syāt prāyo yuktirapi kvacit /
āgamaikapramāṇeṣu tasyaiva hyupajīvyatā // MAnuv_2,1.18 //


NYĀYASUDHĀ:
vedasyetyanuvartate /
syādityataḥ paramitiśabdo 'dhyāhāryaḥ tattvamasītyādivedasya pratyakṣamupajīvyam /
yuktirapi kvacidvedasyopajīvyeti sambandhaḥ /
yathā"prāṇā vā aṇavaḥ'; ityādeḥ /
āgamaikapramāṇakeṣu viṣṇvādiviṣayeṣu pravartamānaṃ"janito 'ta viṣṇoḥ'; ityādivedaṃ prati niraniṣyo niravadya ityādestasya vedo(dasyo)pajīvyatetyarthaḥ /
evaṃ niravakāśatvādikamapi pratyakṣāgamayoreva prāyeṇa sambhavati yuktestu kvacideva /
tacca na prakṛtayukterityapi draṣṭavyam /


*5,115*

āgamayoḥ parasparavirodhe satyanyatarāgamāśrayeṇa yukteranupraveśopapatteryuktā mīmāṃsetyuktam /
tadanupapannam /
asārvatrikatvāt /
nahi sarvatrāgamayoḥ parasparavirodha eva mīmāṃsāvatāryata ityata āha- yukta iti //

yukto 'yuktaśca yadyartha āgamasya pratīyate /
syāt tatra yukta evārtho ... // MAnuv_2,1.19a-c //


NYĀYASUDHĀ:
tatra tarhyayamabhisandhiḥ /
satyametatkvacidevāyaṃ nyāya iti /
tathāpi yatra naivaṃ tatraikasyaivāgamasyānekārthapratītau yuktyanusāriṇamarthamupādāya tadanuguṇatadviruddhārthaparityāgaḥ kriyata iti noktaniyamabhaṅgaḥ /
kevalayuktervaidike 'rthe 'nupraveśasyānaṅgīkṛtatvāt /
nāpi mīmāṃsānupapattiḥ /
anyataravaidikārthānusāriṇyā yukteraṅgīkṛtatvāditi /


*5,116*

prāk puruṣatvādiyuktivirodhenāgamasyāprāmāṇyaṃ na vācyamityuktam /
idānīṃ tu yuktirevāsau pratyakṣāgamavirodhenāpramāṇam /
tasyāstadujīvitvena tato durbalatvādityāśayavānāha- yuktiśceti //

... yuktiśca trividhā matā // MAnuv_2,1.19d //

NYĀYASUDHĀ:
yadvā yatsiddhavatkṛtya tatra mīmāṃsārambhānupapattiḥ parihṛtā tadidānīṃ darśayitumāha- yuktiśceti //

caśabdaḥ prakṛtānusandhānārthaḥ /
kathaṃ traividhyamityata āha- vyāptiriti //

vyāptiḥ pratyakṣatā yasyā yuktigā'gamagā tathā // MAnuv_2,1.20ab //

NYĀYASUDHĀ:
yasyā yukteḥ sādhyena vyāptiḥ pratyakṣagā pratyakṣāvagatā saikā /
yuktigā yuktyavagatā yasyā vyāptiḥ sā dvitīyā /
tathā'gamagā āgamāvagatā yasyā vyāptiḥ sā tṛtīyeti /
evaṃ trividheti yojyam /

upalakṣaṇaṃ caitat /
dhar(mār)myādigrāhakabhedenāpi traividhyaṃ draṣṭavyam /
etacca spaṣṭayiṣyāmaḥ /


*5,117*

evaṃ tarhi yā yuktimūlā yuktiḥ sā nāgamādyupajīvinīti tasya bādhikā /
tadabādhyā ca bhavatvityata āha- pratyakṣeti //


*5,118*

pratyakṣāgamamūlā tu yuktistatra balīyasī // MAnuv_2,1.20cd //

NYĀYASUDHĀ:
tatra tāsu trividhāsu yuktiṣu /
pratyakṣāgamūleti /
pratyakṣamūlā'gamamūlā cetyarthaḥ /
yuktimūlāpi hi yuktirantataḥ pratyakṣāgamamūlaiva(dra)eṣyavyā /
anyathā tanmūlayuktenirrmūlatvamanavasthā vā'padyeta /
tathāca pratyakṣādyapekṣatvena sāmye 'pi bahusaṃvidhānānapekṣayoḥ pratyakṣāgamamūlayoryuktyoḥ prabalatvaṃ tadapekṣāyāstu yuktimūlāyā durbalatvaṃ yuktameva /
tathāca prabalayor(yuktyor)yadedṛśī daśā tadā kā (vārtā) durbalāyā yukterāgamabādhanādāviti /


*5,119*

tadevamaprāmāṇye pramāṇavirodhasyaiva prayojakatvācchatyādeśca pratyakṣāgamavirodhābhāvāt /
anumānavirodhasyāprayojakatvānnāprāmāṇyam /
kinnāma bodhakatvena svata eva prāmāṇyamityupapāditam /
tadetatpramāṇāpramāṇavivekamaviduṣāṃ duravadhāraṇamityuddeśalakṣaṇavibhāgaparīkṣābhistannirūpaṇārthamuttaro granthasandarbhaḥ /
naca sāṃvyāvahārikatvātpramāṇādeḥ kiṃ tannirūpaṇeneti vācyam /
tathāpi svarūpasaṅkhayāviṣayaphalagocarāṇāṃ vādivivādānāṃ vidyamānatvena nirūpaṇārhatvāt /
yadyapyeṣo 'rthastarkaśāstrasya viṣayo na mīmāṃsāśāstrasya /
tathāpi śiṣyahitaiṣiṇā bhāṣyakṛtā prasaṅgāgato nirūpyate /
yathā pūvarmīmāṃsābhāṣyakāreṇetyadoṣaḥ /
ata eva pramāṇalakṣaṇādau nirūpitasyārthasya punaratra nirūpaṇaṃ na doṣāya /
ekīkṛtya nirūpaṇasyāpi śiṣyahitārthatvāt /


*5,121*

tatra nirdhārita(nirjñāta)svarūpasyaiva saṅkhayādijijñāsā /
lakṣaṇaṃ ca tannirdhāraṇopāyaḥ /
naca sāmānyalakṣaṇena vinā viśeṣalakṣaṇā(syā)vasara ityataḥ pramāṇasāmānyalakṣaṇaṃ prathamaṃ tāvadāha- yāthārthyameveti //

yāthārthyameva mānatvaṃ ... // MAnuv_2,1.21a //


*5,122*

NYĀYASUDHĀ:
atra kaścidāha /
kimarthaṃ lakṣaṇamucyate /
kiṃ sajātīyavijātīyavyavacchinnalakṣyapratītyartham /
uta pramāṇatvādipratītaye taccihnopadarśanamidam /
uta pramāṇādiśabdapravṛttinimittāvadhāraṇārtham /
anyasmai kasmaicitprayojanāya vā /


*5,124*

nādyaḥ /
tasyā eva duravadhāraṇatvāt /

tathā hi /
kiṃ sajātīyeti pramāṇatvena (sajātīyatvaṃ) vivakṣitaṃ rūpāntareṇa vā /
nādyaḥ /
svavyavacchedāvadheḥ sajātīyādavyāvṛttatvena vyavacchedakatvānupapattyā vyāvṛttisvīkāreṇā(ca)vyāpakatvāt /
nāpi dvitīyaḥ /
vijātīyapadopadānavaiyarthyāt /
asti hi prameya(tvādinā)sarvasājātyam /
atha jñānatvena viśeṣeṇa sājātyaṃ vivakṣitvedamucyate /
tarhi lakṣyasyāpi jñānatvādinā sājātyādvayavacchedyakoṭipraviṣyatayā saṅgrāhyābhāvaprasaṅgaḥ /
lakṣyasya yajjñānatvādibhiḥ sajātīyaṃ tadvayavacchedyam /
naca lakṣyasya lakṣyaṃ sajātīyam /
ṣaṣṭhayarthasya sambandhasya bhede vyavasthitatvāditi cet /
evaṃ tarhi lakṣyāpekṣayā bhinnādvayavaccheda ityevocyatāṃ kṛtaṃ jñānatvādinā sājātyena prakṛtānupayoginā varṇitena /
yadā ca lakṣyādanyatva pareṣāmavagataṃ tadā parebhyo 'nyatvamapi lakṣyasyārthādavagamyata iti siddhamagrato lakṣaṇaprayojanamiti vaiyarthyameva syāllakṣaṇākhyānasya /


*5,125*
api ca na tāvadanena lakṣaṇenānavagatenaiva vyavacchinnapratītisambhavaḥ /
atiprasaṅgāt /
nāpi jñātena /
duravadhāraṇatvāt /
na tāvallakṣaṇaṃ pratyakṣam /
nirdoṣākṣodbhavatvāderapratyakṣaviśeṣaṇatvam /
nāpi kāryeṇa liṅgena tadanupapattyā vā tadavagamaḥ /
tābhyāṃ sāmānyataḥ kāraṇamātrākṣepeṇa kāraṇagatānugatarūpāsiddhāvekarūpalakṣaṇāsiddheḥ /
kāryasyaikajātyādekajātīyakāraṇasiddhiriti cet /
tarhi kāryagataikajātyasya pūrvamavaśyaṃ pratyetavyatvāṅgīkāre(ṇa) tata eva sajātīyavijātīyavyavacchedaprati(doṣa)pattirastu /
kṛtamanayā pāramparyakusṛṣṭayā /

nanvetāvatāpi na prakṛtalakṣaṇakhaṇḍanaṃ (saṃ)bhavati /
avyāpterativyāptervānudbhāvanāditi cet /
maivam /
prathamabhāvitayāvaśyābhyupeyatayā laghorupāyātsādhyasiddhau sambhavatyāṃ caramabhāvitayā avaśyānuṣṭheyatvābhāvena gurāvupāye pravartamānasya tavaivedaṃ (dūṣaro)doṣodbhāvanam /
pradīpe pradīpaṃ prajvālya tamonirāsāya yatamānasyaiva puṃsaḥ /
nahi tatra kaściddīpadoṣaḥ /
kintu tathākārī puruṣa eva paryanuyojyaḥ /
sarvasādhanasādhāraṇo vāyaṃ doṣaḥ /
yatsambhavadevaṃvidhalaghūpāyatvaṃ nāma svarūpāsiddhiriva sarvapramāṇānām /
tasmānmā nāma bhūdativyāptyādidoṣaḥ /
sāmānyadoṣādeva duṣyaṃ lakṣaṇamiti /


*5,132*

etena dvitīyo 'pi nirastaḥ /
pramāṇatvādyavagamamantareṇa tadavagamānupapattestadavagamāyāsya pratītāvanyonyāśrayaprasaṅgaḥ /
astu vānyadapi lakṣaṇe kiñcilliṅgam /
tathāpi tadeva lakṣyāvinābhūtatayā lakṣaṇamupanyasyatāṃ sannihitapratipattikatvāt /
na tadavaśyaṃ vyāpakaṃ vaktavyam /
liṅgatvasya vyāpyatvenaivopapatteriti cenna, yatra liṅgamavyāpakatvānnāsti tatra lakṣaṇasya pramāṇābhāvātpratyetumaśakyatvena kathaṃ tataḥ prāmāṇyādyavagamaḥ /
yadā ca kvacillakṣyajātīya eva pramāṇābhāvāllakṣaṇama(syā)navadhāraṇīyatayā lakṣyavyāpakatānavagame 'pi lakṣaṇam /
tadā kimaparāddhaṃ liṅgāntareṇāvyāpakena /
atha yatra tallakṣaṇe liṅgaṃ nāsti tatra liṅgāntarātpratyetavyam /
tathāpi (tāvevā)te evāstāṃ lakṣye liṅgam /
kiṃ lakṣaṇānumānapūrvakaṃ tadanumānakalpanayā /
atha tathā(vidhaṃ)liṅgadvayaṃ yattatpratyekamavyāpakatayā na lakṣaṇam /
tadanumitaṃ tu tathātvāllakṣaṇamiti cenna /
lakṣyānumānasya lakṣaṇaprayojanasyobhābhyāmeva siddheḥ kṛtaṃ vyāpakena tena /


*5,135*

nāpi tṛtīyaḥ /
sa hyevaṃrūpaḥ yadyathārthaṃ tatpramāṇamiti vyavahartavyamiti /
ayamanupapannaḥ /
sarvatra lakṣaṇasya jñātumaśakyatvāt /
pramāṇatvādinā tadavagame tadevāstu vyavahāraniyamanidānam /
avyavahitapratipattikatvādityāveditam /


*5,136*

ata eva na caturthaḥ /
kalpanāgauravadoṣaścādhikaḥ /


*5,137*

(nāpi) na pañcamaḥ /
tādṛśasya darśayitumaśakyatvāditi /

atrocyate /
astu tāvatsajātīyavijātīyavyavacchinnalakṣyapratītyarthaṃ lakṣaṇamiti pakṣaḥ /
sāsnādimāngauriti viditalakṣaṇasambandho hi yaṃ piṇḍaṃ sāsnādimantaṃ paśyati taṃ nāyamaśvādirnāpi ghaṭādiriti pratipādyate /

nanu vyavacchedo 'nyonyābhāvo bheda ityanarthāntaram /
bhedaśca vastusvarūpameva /
tathāca lakṣyasvarūpapratipattireva tatpratipattiriti kṛtaṃ lakṣaṇena /
atha lakṣyapratītinirapekṣameva lakṣaṇena vyavacchedo bodhyata iti matam /
tanna /
nirāśrayasya tasya bodha(darśa)yitumaśakyatvāditi /

satyaṃ svarūpa(vastu)pratītireva bhedapratītiriti /
tathāpi pratiyogiviśeṣaghaṭitatadavagamāya lakṣaṇasyopayogaḥ /
asaṅkīrṇatayā gopiṇḍaṃ paśyannapi hi na tāvadayaṃ nāśvo na ghaṭa iti pratyeti yāvallakṣaṇaṃ nāvagacchati /
sāsnādimatvaṃ tadā pratītamiti cenna /
sāsnādimān gaurityevamavagamasya vivakṣitatvāt /
ata eva sajātīyetyādiviśeṣaṇopādānam /


*5,139*

yadatroktaṃ kiṃ sajātīyetyādi /
tadasat /
pauruṣeyavacasāṃ puruṣavivakṣādhīnatvena niyantumaśakyatvāt /
lakṣyātiriktaṃ hi

sajātīyavijātīyatayā dvairāśyena vivakṣyate /
yathā yathārthajñānatatsādhanasya pramāṇasya jñānaṃ tatsādhanaṃ ca sajātīyam /
yanna jñānaṃ nāpi tatsādhanaṃ tadvijātīyam /
yathā ca pratyakṣasyānumānādikaṃ sajātīyaṃ, vijātīyaṃ tu ghaṭādikam /
evamanyatrāpi vivektavyamiti /

evaṃ tarhi lakṣyāpekṣayā bhinnādvayavaccheda ityuktaṃ syāditi cet /
ko netyāha /
nahi ko 'pi svasthātmā svasmādeva vyavacchedaṃ lakṣaṇaprayojanamācakṣati(ṣye) /


*5,140*

yadatroktaṃ yadā cetyādi /
tasadaṅgatam /
vastuto yallakṣyādbhinnaṃ tato vyavacchedāvagamārthatvāllakṣaṇasya pratipādakasya yadyapi lakṣyānyatvajñānamalakṣye(vaśyā)pekṣitam tathāpi pratipādyasyātada(tadana)pekṣitam tathāpi pratipādyastada(tadana)pekṣatvānna doṣaḥ /

tasyāpi padārthajñānapūrvakatvādvākyārthajñānasya sajātīyavijātīyapadopāttalakṣyānya(tva)jñānaṃ vinā lakṣyasya alakṣyānyatvajñānaṃ lakṣaṇaprayojanaṃ na siddhayatīti kaścit /
tadanupapannam /
nahi lakṣyānyavyāvṛttirlakṣaṇavākyapratipādyā /
kinnāma tajjñānaṃ lakṣaṇaprayojanatvenocyate /
lakṣaṇavākyārtha eva pratipādyena boddhavyaḥ /


*5,141*

yadapyapi cetyādinā pṛṣṭam /
tatrāvagatameva lakṣaṇaṃ vyāvṛttalakṣyajñānamupajanayatīti vadāmaḥ /
naca tasya duravadhāraṇatā /
yathāyathaṃ pratyakṣādinā tadavadhāraṇāt /
yatra liṅgāttadavagamastatra tata eva lakṣaṇaprayojanasiddhervyarthā parasparākusṛṣṭiriti cenna /
prayojanasadbhāve gauravasyāpyanādaraṇa(pyādaraṇa)sambhavāt /
yathendriyavyāpārānvayavyatirekānuvidhāyitvenākṣodbhavatvamanumāya tena pratyakṣaṃ lakṣyate /
tatrānvarthasaṃjñājñāpanaṃ prayojanam /
evamanyatrāpi draṣṭavyam /
gauravamanuruddhaya prayojanamavadhīryatāmiti cenna /
puruṣābhiprāyāṇāṃ niyantumaśakyatvāt /
garīyāṃśca pratipattau gauravātprameyādhikyalābhaḥ /
prayojanābhāve tu paramparākusṛṣṭiriti cenna /
prayojanasadbhāve gauravasyāpyanādaraṇa(pyādaraṇa)sambhavāt /
yathendriyavyāpārānvayavyatirekānuvidhāyitvenākṣodbhavatvamanumāyatena pratyakṣaṃ lakṣyate /
tatrānvarthasaṃjñājñāpanaṃ prayojanam /
evamanyatrāpi draṣṭavyam /
gauravamanuruddhaya prayojanamavadhīryatāmiti cenna /
puruṣābhiprāyāṇāṃ niyantumaśakyatvāt /
garīyāṃśca pratipattau gauravātprameyādhikyalābhaḥ /
prayojanābhāve tu paramparākusṛṣṭiranādaraṇīyaiveti tadīyadoṣatāvyutpādanaṃ nāsmākamaniṣyam /
etena dvitīyatṛtīyacaturthā api samāhitā veditavyāḥ /
lakṣaṇāvadhāraṇopāyasyoktatvāt /
gauravasya ca samāhitatvāt /


*5,144*

nanu tathāpi kiṃ tattvam /
yathāyathaṃ catuṣyayamapi /
tathāhi /
kvacillakṣyātiriktaṃ lakṣaṇaṃ bhavati /
yathā gandhavatī pṛthivīti /
kvacillakṣyānatiriktam /
yathā pṛthivītvavatī pṛthivī, yathārthaṃ pramāṇamityādi /
tatrādyaṃ lakṣyasvarūpapratipattikāraṇaṃ bhavat tasyānvayo vyavacchedatacchabdavyavahartavyate ca pratipādayati /
dvitīyantu pravṛttinimittaṃ bhavadvayavahāramātrakāraṇaṃ bhavati /
tatra siddhāṃśena pakṣīkaraṇamasiddhāṃśena sādhyatvaṃ svayamūhanīyam /


*5,147*

nanu lakṣaṇaṃ vyāvṛttaṃ vyāvartayatyutāvyāvṛttam /
ādye svavyāvṛttirlakṣaṇāntarādhīnā na vā /
na prathamaḥ /
tatrāpi lakṣaṇāpekṣāyāmanavasthāpātāt /
na dvitīyaḥ /
lakṣye'pi tatprasaṅgāt /
ninirmittakāryābhyupagame kādācitkatānupapatteśca /
nāntyaḥ /
atiprasaṅgādeveti /
ucyate /
lakṣaṇamapi vyāvṛttameva vyāvartayati /
tadapi lakṣaṇenaiva /
na caivamanavasthā /
prāṅnirjñāteṣvarthrṣu vyavasthānāt /
yastu kāṣṭhaloṣṭhayitaḥ kañcitpadārthaṃ vā kasyacitkiñcicchabdavācyatvaṃ vā na vetti nāsau lakṣaṇaśāstre'dhikriyate /
kinnāmopadeśādinā viditapadatadarthasaṅgatyādiḥ svatantravyavahārādyarthaṃ lakṣaṇamapekṣata iti /


*5,149*

athāpi syāt /
kimavagataṃ lakṣaṇaṃ phalahetuḥ, kiṃvānavagatam /
na tāvaccaramaḥ /
tadabhidhānavaiyarthyaprasaṅgāt /
abhidhānasya jñānotpādano(payogi)pāyatvāt /
tasya cānavagatasyaiva phalasādhanatvābhyupagamāt /
ādye kimanyasmāttadavagama uta tvadīyāllakṣaṇavākyāt /
yadyanyasmāt /
kṛtamamunā lakṣaṇābhidhānaprayāsena /
abhidhānasya jñānotpādātiriktaprayojanābhāvāt /
tasyānyata eva siddheḥ /
antye kimidaṃ tvadabhidhānamāptopadeśatayā lakṣaṇaṃ bodhayatyuta liṅgādibhāvena /
na tāvaccaramaḥ /
tvadvacanalakṣaṇāvinābhāvāderdarśayitumaśakyatvāt /
nāpi prathamaḥ /
paraṃ prati bhavatyāptatvasiddheḥ /
siddhau hi pratijñāmātrādeva sādhyasiddherhetva(tvādya)bhidhānamanarthakaṃ syāt /

nanu prativādinaṃ prati lakṣaṇābhidhānaṃ nārthavat /
tena vādyāptabhāvānaṅgīkārāt /
kintu śiṣyārthaṃ lakṣaṇamucyate śāstre /
sa hi sarvasya śāstrasya kartāramāptameva manyate /
tasmācchiṣyaṃ pratyāptavacanatayaiva lakṣaṇavākyamartaṃ pratipādayiṣyatīti /
maivam /
yadi na prativādinaṃ prati śāstraṃ kintu śiṣyaṃ prati tadā pratijñāmātrādevāptavacanācchiṣyasyārthaniścayopapatterhetvādyabhidhānamanarthakatāmāpannaṃ śāstre /
atha bhavatu prativādinamapi prati (tacchā)śāstravākyaṃ yatra hetvādyupāttam, lakṣaṇavākyaṃ tu śiṣyameva prati prayojakaṃ pratipannaśāstrakārāptabhāvamiti manyase /
tadapyanupapannam /
śāstrāntarasādhyatvādasyārthasya /
asti hi samayagrāhakaṃ śāstraṃ munibhiḥ praṇītaṃ nāmaliṅgānuśāsanavyākaraṇādīti /

*5,149f.*

atra brūmaḥ /
uktaṃ hyetadavagatameva lakṣaṇaṃ phalaheturiti /
tadavagamaśca yathāyathaṃ pratyakṣādipramāṇādityapi /
naca yathārthaṃ pramāṇamiti sāsnādimāngauriti vākyasya lakṣaṇaṃ pratipādyamabhyupagacchāmaḥ /
yenānyataḥ siddhatvāttasyedamanarthakaṃ syāt /
kintu yo lakṣaṇamanyato jānāti, na jānāti ca vyavahāranidānatvādinā, taṃ prati tadavabodhāyedaṃ vākyam /
tathāhi /
ayaṃ gaurityādyupadeśādinaikasyāṃ vyaktau gośabdārthatayāvagatāyāṃ kimiyameva vyaktiḥ (evam) utānyāpīti jijñāsamānaṃ pratyanyatrāpi gośabdārthatāṃ vijijñāpayipuruṣadeśāderānantyādinā kartumaśakyatavādidaṃ vyāptiviṣayaṃ vākyamāha"yaḥ sāsnādimānsa gośabdārthaḥ'; iti /
idaṃ ca nāptopadeśatayaiva vyāptibodhakam /
api tu prayogāntaravatpratītāyā vyāpteḥ smārakatvena /
apratītāyāstu tadeva jijñāsājananadvāreṇa pramotpādakatvenopayujyate /
smṛtavyāptiśca yāṃ yāṃ vyaktiṃ sāsnādimatīmavalokayati /
tāṃ tāṃ gośabdārthatayānuminotīti ko doṣaḥ /


*5,150*

yadvā yaḥ pṛthivīti padaṃ vā vyaktiviśeṣasya tadathartāṃ vāvagacchaṃstatpravṛttinimittaṃ jijñāsate taṃ prati pṛthivītvavatī prathivīti pṛthivītvaṃ pṛthivīśabdapravṛttinimittamucyate /
tatra yasya vaktaryāptatābuddhiḥ sa tāvatā santuṣyati /
aparaṃ prati tvavyāptyādiśūnyatvāditi vākyaśeṣaḥ pravartate /

athavāsti gaurnāmārtha iti viditavato yatra tatra gavi ghaṭādāvaśvādau ca gobuddhau prasaktāyāṃ goḥ svarūpāvadhāraṇamukhenetaravyavacchedaṃ kurvatsāsnādimāneva gaurna tu tadvirahī ghaṭādiraśvādirveti vākyaṃ prayujyate /
idamapi pūvarvadāptatvāvadhāraṇānavadhāraṇābhyāṃ dvayāṃ gatimavalambata iti kimatrānupapannam /
Vyāsa-(10)


*5,155*

nanvatra tāvadevaṃ prayoktavyam /
ayaṃ gotvena vyavahartavyaḥ sāsnādimattvāditi /
tatra kiṃ gaurvyavahārasya viśeṣaṇaṃ gośabdo vā /
ādye yadyasau goviśiṣṭaṃ vyavahāraṃ nājñāsīt tadā kathaṃ purovartivyaktau tasya kartavyatāmanumānādapi jānīyāt /
na hyaviditāgniranumānādagnisambandhaṃ bodhayituṃ śakyaḥ /
athājñāsīttadā jñātajñāpakatvena vyarthamanumānam /
na dvitīyaḥ /
tadā hyayaṃ gośabdābhidheyaḥ sāsnādimattvadityanumānaṃ syāt /
tatra cātiprasaṅgaḥ /
tatra eva jabagaḍadaśādiśabdābhidheyatvamapi sādhyaṃ syāt /
te sāmānyato 'pyarthavattayā na prasiddhāḥ /
naivaṃ gośabda ityasti viśeṣa iti cet /
tathāpi śaśaviṣāṇādiśabdābhidheyatvaṃ sādhyatām /
te 'pyasadviṣayatayaiva prasiddhāḥ /
gaurastītyādiprayogādgośabdo naivamiti cet /
evamapi svastimatītyādiśabdavācyatānumānaṃ gomātre syāt /
atha satyapi gotve tadanyatra tadaprayogānneti cet /
evaṃ tarhi yatra sāsnādimattvaṃ nāsti tatra gośabdaprayogo 'pi nāsti, yatra sāsnādimattvamasti tatra sarvatrāstīti yo jānīte taṃ prati lakṣaṇābhidhānamiti syāt /
sa ca vyavahārāntaravadanvayavyatirekābhyāmeva vācyavācakabhāvamavadhāritavāniti vyarthamanumānamiti /


*5,155f.*

maivam /
ubhayatrāpi doṣābhāvāt /
kevalavyatirekitve hi kathañcidetadabhidhātuṃ yuktam /
upadeśādinā viśeṣaṇena gavā viśeṣitaṃ vyavahāramavagatavo hi tadanyatra tatkartavyatānumānasādhyetyaṅgīkāre ko virodhaḥ syāt /
śabdaviśeṣitavyavahārakartavyatāsādhane 'tiprasaṅgaḥ kiṃ bodhyasya bodhakasya veti vācyam /
nādyaḥ /
tena tadvayāpteranavagatatvāt /
avagatatvācca gośabdavācyatāvyāpteḥ /
na dvitīyaḥ /
tenāpi pūrvaṃ vṛddhavacanādinā tathaiva vyāpteravagatatvāt /
prayogabhāvābhāvābhyāṃ bādhasya nirṇītatvācca /
nahi bodhyo bādhaparicayaśūnya ityetāvatā paricitabādhenāpi bodhakena viparītaṃ bodhanīyam /
vipralambhakatvāpātāt /
tattvanirṇayārthatvācca vādakathānusāriṇaḥ śāstrasyeti /
evaṃ pakṣāntare 'pyanumānaprayogaprakāro boddhavyaḥ /


*5,161f.*

yadapyuktaṃ śāstrāntarasādhyatvādayamartho na vaktavya iti /
tadayuktam /
na hyevamasmābhiḥ pratijñātaṃ yatsarvathā śāstrāntarasādhyaṃ tannocyata iti /
na caivaṃ śāstrasāṅkaryamāśaṅkanīyam /
viṣayaprayojanabhedāt /
yadi ca śāstrāntarasādhyo 'pyartho bhavadīyaśāstrasya viṣayaḥ tarhi vyākaraṇādisādhyamanyadapi kasmānnocyata iti cenna /
sandigdhatvasaprayojanatvasadasadbhāvābhyāṃ vaiṣamyāt /
sandigdhatādisadbhāve 'pi yadavacanaṃ taduktadiśā śiṣyaireva śakyajñānatvāditi yatkiñcidetat /
anyathā parasyāpi kulīrasyeva svāpatyayuktihatatvaṃ syāt /
tenāpi hi smṛtirūpaḥ paratra pūrvadṛṣṭāvabhāso 'dhyāsa ityādīni lakṣaṇāni svaśāstre nibaddhāni /
sūtrakṛtā ca janmādyasya yata iti /
tatraite doṣāstāni lakṣaṇāni kiṃ samāskandantyuta neti vaktavyam /
na tāvaddvitīyaḥ /
sāmānyasamānanyāyatvāt /
nādyaḥ /
duṣyopādānasya parājayahetutvāt /
doṣāskanditānyapi tāni vyavahāraṃ nirvahantīti cenna /
āpātato 'pi duṣyānāṃ tathātve kathamunmattabhāṣitānāmapi tadbhāvo na syāt /
nahi teṣāmanirvāhakatve 'nupapatteranyatkāraṇamasti /


*5,168*

kiñcaivaṃ vadatā prāgbrahmasākṣātkārādbādhyamavyāvahārikaṃ brahmasākṣātkārabādhyaṃ vyāvahārikamiti matamapi parityaktaṃ syāt /
nahyayaṃ brahmasākṣātkāro nāpi bādhaḥ /


*5,170*

kiñcaivamasmadīyamapi lakṣaṇaṃ kuto na vyavahāraṃ nirvahet /
naca vyavahāranirvāhātiriktaṃ kimapi tatsādhyamabhilaṣāmaḥ /
bhavadabhilaṣitā pāramārthikatā bādhyata iti cet /
kiṃ lakṣaṇasyota lakṣyasya /
nādyaḥ /
tathāhi /
vimatamapāramārthikamaprayojanābhidhānatvādityādyuktaṃ syāt /
na cāsyāsmānprati vyāptiḥ śakyābhidhānā /
kiñcāsminpakṣe 'dhyāsalakṣaṇānupapattiśca bhavatā na pariharaṇīyā /
tasyā vyavahāranirvāhāvirodhāt /
pāramārthikatāniṣedhaupayikatveneṣyasādhanatvācca /
etenātivyāptyādidoṣo 'pi nāparamārtha(pāramārthika)tā sādhakaḥ /
alakṣaṇatāsādhakastu syāt /
na dvitīyaḥ /
anupapadyamānalakṣaṇatvena lakṣyamithyātvasādhane brahmaṇi vyabhicārāt /
uktāyā lakṣaṇānupapattestallakṣaṇe 'pi sāmyāt /


*5,171*

kiñcādhyāsalakṣaṇamupapannaṃ na vā /
ādye sapakṣāpraveśaḥ sādhanasya /
dvitīye tadanupapattinirāsāyāso vyarthaḥ syādityāstāṃ vistaraḥ /


*5,172*

arthaṃ nātivartata iti yathārthaṃ, tasya bhāvo yāthārthyaṃ, tadeva mānatvaṃ mānaśabdapravṛttinimittaṃ mālakṣaṇamiti yāvat yadyapi sāsnādimāngauritivadyathārthaṃ pramāṇamityukte 'pi bhavatyeva lakṣyalakṣaṇabhāvapratītiḥ /
tathāpi tadvadeva lakṣyaṃ lakṣaṇātiriktaṃ śaṅkayeta /
tataśca pṛthaṅnirūpyamapi syāttanmā śaṅkīti yāthārthyameva mānatvaṃ na tu sāsnādimattvādgotvamiva tato 'tiriktamityuktam /


*5,174*

nanu kimidaṃ lakṣaṇaṃ nāma /
lakṣyasyāsādhāraṇo dharmaḥ /
yāvastvekaḥ śabdo niveśayitumiṣyaḥ, yāvanti cetarasmādvayāvartanīyāni tānyucyante lakṣyāṇīti /


*5,175*

nanvasādhāra(ṇo)ṇadharmaścellakṣaṇamavyāpakasyāpi tadā lakṣaṇatāpattiḥ /
ativyāptyasambhavāviva avyāptirapi hi lakṣaṇadoṣaḥ /
ucyate /
liṅgatayā hi lakṣaṇamupayujyate /
naca vyāpakatā liṅgatvopayoginī /
vyāpyatvenaiva tadupapatteḥ /
itarathā dhūmādīnāmaliṅgatāpātāt /
kinnāma pakṣīkṛtadṛṣṭāntīkṛtavyāpakatātvapekṣitaiva /
upāyatvenopanyastasyābhāve tadupeyaprāpterasambhavāt /
ubhayadharmabhūtāyā vyāpteranyatarābhāve darśayitumaśakyatvāt /
tathāca tadānīṃ lilakṣayiṣitamātravyāptitvaṃ lakṣaṇasyāpekṣitam /
tacca lakṣyasya dharma ityuktameva /
avyāpakatva(dharma)sya lakṣaṇadoṣatāvādastu sarvasyāpi lilakṣayiṣitatve draṣṭavyaḥ /


*5,178*

yadvānyatra lakṣaṇāntarābhāvaniścayanimittā taduktiḥ /
vastutastvekamivānekamapi svasvāśraye vyāvṛttyādikaṃ kurvadbhavatyeva lakṣaṇam /
ata eva kaṇādaḥ kriyāvadguṇavatsamavāyikāraṇamiti kriyāvattvamapi dravyalakṣaṇatvenāha /
kriyāvadgrahaṇamanyārthamiti cet /
tatkimavyāpakasya lakṣaṇatānupapatteranyathāvyākhyānamuta nimittāntarāt /
nāntyaḥ /
tadadarśanāt /
na prathamaḥ /
anupapatterapākṛtatvāt /


*5,181*

nanu (ca) atra pṛthivyādīni navāpi pakṣīkṛtyaitāni dravyāṇi kriyāvattvāditi prayoktavyam, kriyāvantyeva vā mūrtāni /
nādyaḥ bhāgāsiddheḥ /
na dvitīyaḥ /
anadhyavasitatvāt /
tatkathaṃ nānupapattiḥ /
maivam /
kaiścidanadhyavasitasya doṣatānaṅgīkārāt /
yeṣāṃ ca sa doṣasteṣāmapyupadeśādinā ghaṭāderdravyatvaniścaye sati taditaramūrtapakṣīkāreṇa dravyatvasādhane kīdṛśo doṣaḥ syādityalam /


*5,182*

kecidvādino vijñānasya prāmāṇyamāsthiṣata /
apare tu tatkāraṇasya /
tat kimatra tattvam /
dvayamapīti brūmaḥ /
pramitiḥ pramāṇam, pramīyate 'neneti pramāṇamiti bhāvakaraṇayoḥ pramāṇaśabdasya sāmarthyāt /
yadyapi lyuṭ bhāvakāraṇayorivādhikaraṇe 'pi smaryate /
tathāpi pramāṇaśabdasyābhidhānābhāvānna tatra vṛttiḥ /
kṛttaddhitasamāsānāmabhidhānādhīnatvāt /

nanvasti viprāḥ pramāṇamityadhikaraṇe 'pi prayogaḥ /
maivam /
viprāṇāṃ pramāyāṃ (pramāṃ prati) svātantryeṇa kartṝṇāmadhikaraṇatvābhāvāt /
nahi kriyādhāro 'dhikaraṇam /
kinnāma kartṛkarmaṇoḥ kriyāśrayayordhāraṇakriyāṃ prati ya ādhārastatkārakam /
tasmāttadīyavijñānasya vākyasya vā prāmāṇyādviprāḥ pramāṇamityupacaryate /
yadi tarhi vijñānaṃ tatkāraṇaṃ ca pramāṇaṃ dvayamapi /
tatrobhayatra yāthārthyāparaparyāyaṃ prāmāṇyaṃ kimekaprakāraṃ vartate, utānekaprakāram /
ādye vijñānaṃ kevalapramāṇaṃ pratyakṣānumānāgamalakṣaṇaṃ tatkāraṇamanupramāṇamiti siddhāntavirodhāpātaḥ /
dvitīye lakṣaṇasyānupapattiḥ /
prakāradvayasyānyonyasminnavartanenāvyāptatvādityata āha- taditi //

... tanmukhyaṃ jñānaśabdayoḥ // MAnuv_2,1.21b //

NYĀYASUDHĀ:
karaṇabhūtayoḥ pratyakṣānumānayostvamukhyamiti śeṣaḥ /
etacca (spaṣṭī)sphuṭīkariṣyate /


*5,185*

syādetat /
yadi yāthārthyaṃ pramāṇalakṣaṇaṃ syāt /
naca tatsambhavatyativyāpteḥ /
tathāhi /
yogyatā, vīpsā, padārthānativṛttiḥ, sādṛśyaṃ ceti yatāśabdārthāḥ /
arthaśabdaścābhidheyadhanavastuprayojananivṛttiṣu vartate /
tatra sādṛśyārthasya yathāśabdasya tāvadatra na parigrahaḥ /
"yathāsādṛśye'; ityavyayībhāvavidhāne viśeṣaṇāt /
samāsāntarasya ca asāmarthyādipratihatatvāt /
ata eva yathārthānubhavaḥ prametyatra kiṃ yāthārthyamarthasādṛśyamityādiḥ kasyacitpraśco 'nupapannaḥ /
nāpi yogyatāvīpsārthasya /
vākyaśeṣā(doṣā)bhāvenārthayogyatāyā (arthānāṃ) arthavīpsāyā vā prāmāṇyāpatteḥ /
tasmātpadārthānanivṛttyarthasyedaṃ grahaṇam /
arthaśabdasyābhidheyavācino grahaṇe avyāptiprasaṅgāt viṣayāparaparyāyavasvacanasyaiva grahaṇam /

tathā cārthaṃ viṣayaṃ nātivartate na vyabhicarati yattatpramāṇamityuktaṃ syāt /
etacca sakarmakakriyāmātre 'sti /
nahi gamanaṃ gamyamativartate, nāpi chidā chedyam /
yadeva(hi) gatyādinā prāpyaṃ tadeva gamyādi /
tato nedaṃ lakṣaṇamityata āha- arthatvamiti //

arthatvamaryataiva syān ... // MAnuv_2,1.21c //


*5,186*

NYĀYASUDHĀ:
arthataiva jñeyataivārthatvamarthaśabdapravṛttinimittamasmākaṃ vivakṣi(tā)taṃ syāt /
natu viṣayatvamityarthaḥ /
etaduktaṃ bhavati /
yathāśabdasya padārthānativṛttivācitvamaṅgīkṛtameva /
arthaśabdastu na viṣayaparyāyo gṛhyate /
kintu jñeyavācī /
yadyapi na tatra tasya rūḍhistathāpyaryata(ityartha)iti vyutpatyā tadvācitāstyeva /
arterauṇādikasya thanpratyayasya prasiddhatvāt /
gatyarthānāṃ ca jñānārthatvāditi /
nanvarthateti katham /
"aryaḥ svāmivaiśyayoḥ'; iti viśeṣaṇāt /
maivam /
svāmitvopacārāt /
artho hi jñānādyapekṣayā pradhānaṃ vivakṣyate /


*5,195*

kimato yadyevaṃ jñeyataivārthatvamityata āha- neti //

... na kriyārtheṣu sā matā // MAnuv_2,1.21d //

NYĀYASUDHĀ:
kriyārtheṣu kriyāviṣayeṣu sā aryatā /
tadabhāvācca na yathārthatā /
kriyāsviti nātivyāpakaṃ pramāralakṣaṇamiti śeṣaḥ /

nanvetāvatāpi nātivyāptiparihāraḥ /
gamanādīnāmapi jñeyānativṛttitvāt /
nahi tadviṣayo grāmādiḥ sarvathā na jñeya iti śakyate vaktum /
tadatyantābhāvaprasaṅgāditi /
maivam /
yathā hi pitari sādhurmātari sādhuritivākyaṃ yatkiñcitpitrādau sādhutvena na paryavasyati, kintu svīye pitrādau /
tatkasya hetoḥ /
pitrādiśabdānāṃ sambandhiśabdatvāt /
sambandhiśabdānāṃ hyeṣa mahimā /
anyathā piturdhanamupādadyādityādau bahuviplavaḥ syāt /
sati caivaṃ śabdamahimānamanādṛtya pratyavatiṣṭhamānaḥ chalavāditayā jīyeta /
tathā prakṛte 'pi jñeyaśabdasya sambandhiśabdatvātsvajñeyaṃ nātivartate yat tatpramāṇamityuktaṃ syāt /
naca gama(ne)nopādhinā gamanena vā nimittena grāmo jñeyaḥ /
yena tamanatikramya vartamānaṃ gamanaṃ yathārthaṃ syāt /
kintu gamya eva /
tatkathamativyāptiḥ /
bhavati ca ghaṭādirjñānatatkāraṇābhyāmupādhinimittābhyāṃ jñeya iti /
tadidamuktaṃ kriyārtheṣu sā na matā śabdārthatattvaviduṣāmiti /

nanu tathāpyanyonyāśrayatvamātmāśrayatvaṃ vā, svaśabdena pramāṇasyābhidhānāditi cenna /
jñānatatkāraṇamātropādanena lakṣaṇasya vyākhyātatvāt /
svaguṇa(grāhaka)grahaṇamindriyaṃ śrotramityatra yatheti /


*5,198*

nanu kimidaṃ pramāṇasya jñeyāvyabhicāritvaṃ nāma /
kiṃ prameyavyāpyatvaṃ kiṃ vā yāvatprameyagocaratvam /
ādye 'pi vyāptiḥ kiṃ deśataḥ kiṃvā kālataḥ /
na prathamaḥ /
pramāṇāsamānadeśārthaviṣayapramāṇeṣvavyāpteḥ /
na dvitīyaḥ /
atītādiviṣayapramāṇāvyāpteḥ /
nāntyaḥ /
asarvajñajñānānāṃ tatkāraṇānāṃ vāprāmāṇyaprasaṅgāditi /

maivam /
advaitāgamādestattvāvedakatvalakṣaṇaṃ prāmāṇyamabhyupagacchatā pareṇā(pi) tasyā)pyasyārthasya nirvaktavyatvāt /

pareṇāṅgīkṛtamupādāyāsmābhirvyavahriyate na tu kimapi lakṣaṇaṃ vyavasthāpyata iti cenna /
svapratipattāvavaśyāśrayaṇīyatvādvayavasthāyāḥ /
nahi svaprakāśaṃ tattvamityetāvatā vinā vedāntādhigamaṃ tadadhigamaḥ śakyo 'ṅgīkartum /
athāveditasya sattvaṃ tattvāvedakatvamiti nirbrūyāttadā vibhrame 'tivyāptiḥ syāt /
tatrāpyāveditasyedamākārasya sattvāt /
atha yāvadāveditasya sattvaṃ tattvāvedakatvaṃ sadekagocaratvamiti yāvaditi vadet, tadevāsmākamapi yāthārthyamiti vadāmaḥ /


*5,202*

nanvevamapi bhrame 'tivyāptiḥ /
na hīdamaṃśo vā rajatatvādijātirvā tatsambandhaḥ samavāyo vā tattādātmyaṃ vā na sat /
anyatra sattve 'pyatrāsaditi cet /
nahi devadatto gṛhe 'sannityasanneva /
nacāyamastyasmākaṃ prasaṅgaḥ /
adhiṣṭhānetarasya sarvasyānirvacanīyatayāṅgīkārāditi /
maivam /
asmābhirapi tasyātyantāsattvasvīkārāt /


*5,205*

atha mataṃ kiṃ viṣayasattvaṃ tadānīmabhimatamuta pūrvamatha paścādyadvā sarvadāthavā yadākadācidyadi vā yadyaddeśakālayoryathāpratītaṃ tasya taddeśakālayostathātvena /
nādyaḥ /
atītānāgataviṣayapramāṇāvyāpanāt /
na dvitīyaḥ /
vartamānānāgataviṣayāvyāpteḥ /
pākarakte 'pi ghaṭe nīlapratītau vibhāgottarakālaṃ saṃyuktapratyaye vātivyāpteśca /
na tṛtīyaḥ /
atītādiviṣayāvyāpteḥ /
bhāvipākajarāge kumbhe śyāme 'pi raktapittinā raktatāpratibhāse 'tivyāpteśca /
na caturthaḥ /
anityaviṣayāvyāpteḥ /
na pañcamaḥ /
pūrvoktavibhrame 'tivyāpteḥ /
nāpi ṣaṣṭhaḥ /
deśakālapramāṇāvyāpteḥ /
nahi deśakālayordeśakālāntaramastīti /

maivam /
deśakālayorapi svasambandhena nirūpaṇasya vakṣyamāṇatvāt /
yadvā yadyathābhūtaṃ pratītaṃ tasya tathābhūtasya sattvamityukta eva nātiprasaṅgaḥ /
deśakālayorapi viśeṣaṇāntaravat yathābhūtamityanenaiva gṛhītatvāt /
viśeṣānukteruktadoṣā(prāpte)prasakteśca /


*5,208*

tathātrapa niścāyakābhāvenāsambhavīdaṃ lakṣaṇam /
tathāhi /
jñānayāthārthyaṃ kimaduṣyakaraṇajanyatvenāvadhāraṇīyam, uta duṣyakaraṇājanyatvena, atha pravṛttisāmarthyena, yadvā jñānāntarasaṃvādena, kiṃvā visaṃvādābhāvena /
nādyaḥ /
tasyāpi duravadhāraṇatvāt /
jñānayāthārthyena tadanumāne cetaretarāśrayatvāpatteḥ /
nityajñāneṣu tadabhāvācca /
na dvitīyaḥ /
aśakyāvadhāraṇatvāt /
na tṛtīyaḥ /
sarvatra tadabhāvāt /
na caturthaḥ /
sukhādijñāne tadabhāvāt /
jñānamātrasaṃvādāṅgīkāre ca dhārāvāhikavibhrame('pi) tadgrahāpattiḥ /
yathārthajñānasaṃvādābhyupagame tu tattadyāthārthyāvadhāraṇenānavasthā /
na pañcamaḥ /
asañjātabādhabhrameṣvapi tadāpātāt /
puruṣadeśakālavikalpānupapatteśceti /

maivam /
tathā sati vedāntajanitavijñānasyāpi yāthārthyānavadhāraṇaprasaṅgāt /
viṣayasatyatvāttadavadhāraṇamiti cettadeva katham /
jñānasāmarthyāditi cet /
kiṃ jñānamātrasya sāmarthyamuta yathārthatayā niścitasya /
ādye śuktirajatāderapi satyatāpattiḥ /
dvitīye('pi) kimetasyaiva jñānasyota jñānāntarasya /
na prathamaḥ /
parasparāśrayaprasaṅgāt /
na dvitīyaḥ /
anavasthādyāpātāt /


*5,212*

atha manyeta svata eva vijñānānāṃ prāmāṇyagrahaḥ bādhena kvacidapodyate /
naca brahmajñānasya bādhaḥ sambhavati /
yathāśakti parīkṣāyāmapi tadadarśanāt /
nirmūlaśaṅkāyāśca anudayāt /
niravadhikasya nissākṣikasya bādhasyādarśanāt /
avadhyādisvīkāre ca tasyaiva brahmatvena bādhitumaśakyatvāditi /
tadetatsamānamasmanmate 'pi /
vivṛtaścāyamarthastatra tatretyupapannaṃ yāthārthyasya pramāṇalakṣaṇatvamiti /
tanmukhyaṃ jñānaśabdayoriti na yuktam /
tathā sati jñānavacchabdasyāpi kevalatvāpatteḥ /
ityāśaṅkāṃ sopapattikaṃ pariharati- jñānārtha iti //

jñānārthe jñeyatā mukhyā śabdārthe tadanantaram // MAnuv_2,1.22ab //

NYĀYASUDHĀ:
yasmājjñānārthe jñānaviṣaye jñeyatā mukhyā śabdārthe śabdaviṣaye tadanantaraṃ jñeyatāmukhyeti yāvat /
tasmājjñāna eva yāthārthyalakṣaṇaṃ prāmāṇyaṃ mukhyaṃ, śabde tvamukhyam /
tathāca na tasya kevalatvāpattirityarthaḥ /
jñānārtheṣvaryatā mukhyeti prakṛtatvādvaktavye 'ryatāpi gatikarmasu vidyata iti gatāvativyāptistadavasthetyāśaṅkānirāsāya jñeyatetyaryatāvyākhyānaṃ kṛtam /
idamuktaṃ bhavati /
na jñānasamakakṣatayā śabde yāthārthyaṃ mukhyam /
kintu karaṇa(mātrā)trayāpekṣayā /
jñāna eva mukhyaṃ yāthārthyaṃ karaṇeṣvapi nirdhāraṇāyāṃ śabde mukhyam /
tadete paramamukhyamukhye ekīkṛtya tanmukhyaṃ jñānaśabdayorityuktamiti /


*5,215*

yadvā tanmukhyaṃ jñānaśabdayorityatraivāyamartho vyākhyātavyaḥ /
tathāhi /
tadyāthārthye jñāne mukhyaṃ karaṇeṣu tvamukhyam /
karaṇeṣvapi kimekaprakāramanekaprakāraṃ veti jijñāsāyāṃ śabde mukhyaṃ pratyakṣānumānayoramukhyamityuktam /
atra ca śabdaśabdane vedamevādhikurute bhagavānmuniḥ /
tanmukhyatākathanasyaiva mīmāṃsopayogitvāt /
anyathā vyarthāyā jijñāsāyāstatparihārasya cāsaṅgatiprasaṅgāt /
yadyapi jñāna(śabda)śabdau dvandvanirdiṣyau tathāpi karaṇeṣvamukhyamityata āha- jñānārtha iti //
śabda ityupalakṣaṇam /
pratyakṣānumānayorapīti draṣṭavyam /
vyākhyānaṃ tu pūrvavat /
śabdasya svaśabdenopādānaṃ (tu) pūrvatra jñānasamakakṣatayā pratītiṃ vārayitumiti /


*5,216*

jñāne mukhyaṃ yāthārthyaṃ karaṇeṣvamukhyam /
tatrāpi śabde mukhyamityuktam /
tatra jñānakaraṇayoryāthārthyasya mukhyatvāmukhyatvopapādanāya tadviṣayayorjñeyatāyā(yāṃ) mukhyāmukhyatve hetutayokte /
tadupapādanārthamāha- yathārtheti //


*5,217*

yathārthajñānajanakā yathārthā yuktayaḥ smṛtāḥ // MAnuv_2,1.22cd //

NYĀYASUDHĀ:
sopaskarāṇi vākyāni bhavanti /
tena jñānaṃ sākṣādyathārthamityādau paṭhitavyam /
bahuvacanamādyarthe /
yuktyādaya ityarthaḥ /
tena janakā ityupapannam /

avyayībhāvasya klībāvyayatvaṃ chandastulyatvenānāśritya yathārthā ityuktam, kathañcidbahuvrīhitāmāśritya vā, yadvā bhāvapradhānādyathātharśabdānmatvarthe 'rśa āditvādaca yāthārthyopetā ityarthaḥ /

tadayamarthaḥ /
jñānameva hi viṣayasya jñeyasya jñeyatāyāṃ sākṣādupādhirbhavati /
jñātatāyā nirākariṣyamāṇatvāt /
atastadviṣayasya (eva)jñeyatvaṃ mukhyamiti jñānasyaiva mukhyato yāthārthyam /
yuktyādikaraṇāni tu viṣayasya jñeyatāyāmupādhibhūtaṃ jñānaṃ janayantīti tadviṣayasya jñeyatvamamukhyam /
tata eva teṣāṃ yāthārthyamapyamukhyamiti /


*5,224*

atra"yathārthajñānajanakā yathārthāḥ'; ityuktistu paramasādhyamapi sūcayitum /
yukteramukhyatāyāmāditvena grahaṇaṃ triṣvapyapakarṣasūcanārtham /
āgamayuktyorutkarṣāpakarṣau tatratatra samarthitāviti nehoktam /


*5,225*

kimato yadyevaṃ jñānasya yāthārthyaṃ mukhyaṃ pratyakṣādikaraṇānāṃ cāmukhyamityata āha- anupramāṇamiti //

anupramāṇametāni hyakṣayuktivacāṃsyataḥ // MAnuv_2,1.23ab //


*5,225f.*

NYĀYASUDHĀ:
atrāpi jñānaṃ kevalapramāṇamiti prathamaṃ paṭhitavyam /
hi yasmādevamata iti sambandhaḥ /
anupramāṇamityekavacanaṃ bahuvacanārthe /
supāṃ sulugiti smaraṇāt /
athavākṣayuktavacāṃsīti dvandvanirdiṣyānāmapi buddhayā vivekena pratyekamanupramāṇamiti sambandhaḥ /
yadvānupramāṇānuvādena akṣāditvakathanamatreti na doṣaḥ /
avāntaravyāpāramavivakṣitvā karaṇadharmiṇa eva vivakṣayā(kṣetyu)kṣamityuktam /
anyathā pratyakṣamiti vaktavyam /
vaca ityāgamopalakṣaṇam /


*5,227*

nacaivamapyavyāptirlakṣaṇasyeti vācyam /
jñānameva yathārthaṃ karaṇāni tu tajjanakatayā tathopacaryanta ityaṅgīkāre hi sā syāt /
na caivam /
yathāvasthitārthaviṣayitvasyobhayatrāpi sāmyāt /
jñānaviṣaya eva hi karaṇānāṃ viṣayaḥ /
nahi kamapyaviṣayīkurvantyeva tāni jñānaṃ janayanti /
nāpyanyaviṣayāṇi /
atiprasaṅgāt /
kevalaṃ viṣayasya jñeyatāṃ jñānamupādhitayā karaṇāni tu tajjanakatayā sampādayantītyetāvantaṃ viśeṣamāśritya kevalānupramāṇabhedaḥ samathirtaḥ /
yadi caitāvatāpyavyāptidoṣastadā sarvatrāpi yatkiñcidvailakṣaṇyasya vaktuṃ śakyatvādatiprasaṅgaḥ syāditi /


*5,229*

ayamatra samudāyārthaḥ /
yathārthaṃ pramāṇam /
tad dvividham /
kevalamanupramāṇaṃ ca /
tatra yathārthajñānaṃ kevalam /
tatsādhanamanupramāṇam /
kevalamapi dvividham /
caitanyaṃ vṛttirūpaṃ ceti /
caitanyamapi trividham /
uttamamadhyamādhamabhedāt /
tatrottamaṃ yathārthameva /
madhyamaṃ miśram /
adhamamayathārthameve /
dvitīyamapi kevalaṃ pratyakṣānumānāgamajabhedāttrividhameveti /
anupramāṇamapi pratyakṣānumānāgamabhedāttrividhameveti /


*5,230f.*

nanu tathāpi kākatālīye 'tivyāptiraparihāryā /
tathāhi /
pāṇau pañca varāṭakānpidhāya kaścitkañcitpṛcchati mama kare kati varāṭakā iti /
saca pṛṣṭo 'jākṛpāṇīyanyāyenāha- pañceti //
tadetatpraṣṭurvaktuśca jñānaṃ yathārthamiti pramāṇaṃ prasajyate /
naca nissādhanaṃ tadutpannamiti tatsādhanasyāpi pramāṇatvāpātaḥ /
yādṛcchikasaṃvādiliṅgavibhramādiṣvapyevaṃ prasaṅgo durvāra iti /

maivam /
vakturjñānasya saṃśayatvenāprasaṅgāt /
tatra(ca)pākṣikavyavahārastu vaiyātyanibandhanaḥ /
na svajñānanibandhanaḥ /
anyathā vipralambhakasyāpi tādṛśaniścayāpattau viparyastāviśeṣaprasaṅgāt /
etenāhāryaniścayakalpanamapyapāstam /
praṣṭustu prāgūrdhvaṃ ca jñānaṃ (yathārtha)pramāṇameva /
tanmūlaṃ ca pratyakṣam /
vākyajanitamapi pārśvasthādervijñānamevameva /
vākyaṃ tu yādṛcchikasaṃvādi /
yādṛcchikasaṃvādiliṅgavibhramavākyābhāsajanyasya kevalapramāṇatve 'pi na tayoḥ prāmāṇyam /
tathāhi /
na tāvattatra bāṣpasya bāṣpatayā (vi)jñātasya vā yathārthajñānasādhanatvaṃ vaktuṃ śakyam /
nāpi dhūmasya asataḥ sādhanatvāyogāt /
sattve 'pyaparāmṛṣṭatvāt /
tato dhūmatvena jñātasya bāṣpasya bāṣpaviṣayasya dhūmavibhramasya veti vaktavyaṃ, naca tatsambhavati /
tajjātīyasya sarvatra kāryo(karaṇikākriyo)(kāraṇakāryo)tpattirāpanneti cenna /
liṅgavibhramasya laukikakāra(kara)ṇatve 'pi pāribhāṣikasādhanatvābhāvasyoktatvāt /

vākyābhāsasyāpi prāmāṇyaprasaṅgo 'nena nirastaḥ /
tasya prāmāṇyaprasaṅge 'pi na kācidasmākaṃ kṣatiḥ /
nahi tārkikāṇāmivāsmākamāptoktatayā prāmāṇyānumānādikamasti /


*5,238*

yadvā nirdoṣatayā sādhanaṃ viśiṣṭate /
nirdoṣatā ca liṅgajñānāderyathārthatvādilakṣaṇā vyākhyeyā /
tathātve nirdoṣaṃ jñānasādhanamanupramāṇamityevāstu /
kṛtaṃ yathārtheti jñānaviśeṣaṇeneti cet(na) /
tatphalitārthasyaiva nirdoṣagrahaṇena varṇitatvāt /
nirdoṣakaraṇajaṃ jñānaṃ yāthārthyaṃ na vyabhicaratīti svarūpakathanaṃ vā taditi /


*5,240*

nanu darśanāntarokte lakṣaṇe sati kimapūrvanirmāṇenetyata āha- prāmāṇyamiti /

prāmāṇyaṃ nānuvādasya smṛterapi vihīyate // MAnuv_2,1.23cd //
yāthārthyameva prāmāṇyaśabdārtho yad vivakṣitaḥ // MAnuv_2,1.24ab //


NYĀYASUDHĀ:
yadyadā yāthārthyameva prāmāṇyaśabdārtho vivakṣito bhavati tadaiva yathārthayoḥ smṛtyanuvādayoḥ prāmāṇyaṃ na hīyate /
darśanāntaroktalakṣaṇakakṣīkāre tu taiḥ svalakṣaṇasya vyāpakatayā aṅgīkṛtatvāt /
smṛtyādau tadabhāvātprāmāṇyābhāva eva prasajyata iti yuktaṃ tadanādareṇa lakṣaṇāntaranirmāṇamiti /


*5,240f.*

tathāhi anadhigatārthagantṛ pramāṇamiti mīmāṃsakoktasya lakṣaṇasya smṛtyādāvabhāvaḥ sphuṭaḥ /
tasyādhigatagocaratvāt /
anubhūtiḥ pramāṇamiti prābhākaro(bhāskaro)ktaṃ lakṣaṇamapi na tatrāsti /
smṛtivyatiriktaṃ jñānamanubhūtiriti nirvacanāt /
tathā pramāvyāptaṃ pramāṇaṃ pramākaraṇaṃ pramāṇamiti naiyāyikoktamapi /
tairapi yathārthānubhavaḥ prameti vyākhyātatvāt /
ata eva pramāsāmagrī pramāramiti nirastam /
avisaṃvādivijñānaṃ pramāṇamiti saugatoktamapi /
tadabhipretasyārthajatvāderavisaṃvādasyābhāvātsmṛtyāderavyāpakam /
svāpūrvārthavyavasāyātmakaṃ jñānaṃ pramāṇamiti jainoktamapi na smṛtyādau vartate /
tasyāpūrvārthaviṣayatvābhāvāt /
nanu smṛtirapūrvārthaviṣayā /
tadityullekhāt /
tasya cānubhavenāviṣayīkaraṇāditi cet(na /
tathā satyapūrvagrahaṇasya vyavacchedyābhāvaprasaṅgāt /
dhārāvāhikaṃ tadvayavacchedyamiti cenna /
anekānta(tā)vāde padārthānāṃ kṣaṇikatvasyāṅgīkṛtatvena dhārāvāhike(kavibhrame)'pyevamapūrvārthatābhyupagamasaulabhyāt /
mā bhūdvātra smṛtiprāmāṇyahānirdoṣaḥ /
dhārāvāhike tu taddhāniravarjanīyā /
tadapi smṛtyanuvādapadābhyāmupalakṣyata iti /


*5,245*

nanu bhavatpakṣe 'pi smṛteḥ prāmāṇyaṃ hīyata eva /
tasyā yāthārthyābhāvāt /
nahi yādṛśo 'rthaḥ smaryate yadā, tādṛśa evāsau tadā /
pūrvāvasthāyā vartamāne nivṛttatvāt /
anivṛttau hi pūrvataiva na syāt /
naca nivṛttapūrvāvasthatayaiva tamarthaṃ smṛtirālambate /
pūrvāvasthānivṛttāvanubhavāpravṛtteḥ /
nanu samānaviṣayatve 'pi smṛtyanubhavayeranubhavo yathārtho na tu smṛtiriti kuta etatnubhavakāle tasyārthasya tādavasthyāt /
smṛtikāle tvatādavasthyāt /
nanu pūrvaṃ tāvattadavastha evāsāvasīdetāvataiva jñānamastu yathārtham /
na /
pākarakte 'pi śyāmatāpratyayasya yathārthatvaprasaṅgāt /
nanvatītaśyāmatāpratyayastatra yathārtha eva /
satyam /
tadviṣayasya tadānīmeva tadavasthātvam /
natu smaryamāṇāvasthastadānīṃ tadavasthaḥ /
tasmātsmṛtirayathārthaiva /

maivam /
apasiddhāntāpātāt /
tathāhi /
upalabdhihetuḥ pramāṇamityatra saṃśayādāvativyāptimāśaṅkaya prakṛtayāthārthyenopalabdhirviśeṣitā /
tasyāpi smṛtihetāvativyāptimāśaṅkayopalabdhiśabdo 'nubhavavacano na jñānasāmānyavacana ityuktaṃ vācaspatinā /
tena jñāyate tenābhyupagataṃ smṛteryāthārthyamiti /
anyathā yāthārthyena smṛtau vyāvṛttāyāṃ punarna śaṅketa /
śaṅkamāno vā tameva parihāramanatidiśannupalabdhipadamanubhūtiparatayā na vyākuryāt /
yathārthānubhavaḥ pramā samyaganubhavasādhanaṃ pramāṇamityādīni nyāyavidāṃ vacanānyapīmamevārthamavagamayanti anyathā dvayaṅgavikalatvātsmṛteranubhavapadavyāvartyatā na syāt /

kāṇādairapi pratyakṣalaiṅgikasmṛtyārṣabhedena vidyācāturvidhyamaṅgīkurvāṇairyathārthatvaṃ smṛteraṅgīkṛtam /


*5,246*

yadapi"nahi (yadā)yo yādṛśaḥ'; ityādi, tadanena kimuktaṃ bhavati /
smaraṇakāle 'rthasya tadavasthātvābhāvādayāthārthyaṃ smṛteriti vā, pūrvāvasthānivṛtteraviṣayīkaraṇāditi vā, anivṛttapūrvāvasthatvena viṣayīkaraṇāditi vā /
ādye 'tītānāgataviṣayānumānāgamaprāmāṇyapracyutiḥ /
atītādiviṣayasya tadānīmasattvāt /
dvitīye sarvapramāṇāprāmāṇyaprasaṅgaḥ /
kasyāpi sarvātmanā viṣayīkaraṇābhāvāt /
tṛtīye tvasiddhiḥ /
na hyanivṛttatadavastho 'sāviti smṛtirālambate /
kintu tadāsau tādṛśa iti /
tadavasthānivṛttyanivṛttyostūdāsīnaiva /

nanvanubhavena"tadā('sau) tādṛśaḥ'; ityaviṣayīkṛtaṃ tathā viṣayīkurvāṇāḥ kathaṃ yāthārthyaṃ labhanta iti cet na /
syādidam yadyanubhavānusāritvaṃ yāthārthyamiti vadāmaḥ /
arthānusāritvaṃ tu tathetyuktam /
anubhave 'nyākāre kutastyo 'yaṃ smṛteranyākāra iti cet /
kimayaṃ nāstītyabhimānaḥ, uta nirhetuka iti vā, yadvā praśnamātram /
nādyaḥ /
sākṣisiddhatvāt /
na dvitīyaḥ /
vyāghātāt /
tṛtīye 'nubhavasyāpi kutastyaḥ /
svahetusamāsādita iti cettulyam /
yadi ca saṃskāramātrajanyatā smṛteḥ syāt /
(syātta)tadā kathañcidvaisādṛśyānupapattiḥ /
mānasaṃ taddhi vijñānamiti vakṣyate /
tasmādvaiyātyamātranimittaṃ smṛtiyāthāthyarnirākaraṇam /
tathāca smṛtyanuvādaprāmāṇyasaṅgrahāya lakṣaṇāntararacanamiti sūktam /


*5,255*

nanu ca saṅgrāhyasya saṅgraho guṇo, na tvasaṅgrahyasyāpi /
kinnāmātivyāptyā doṣa eva /
naca smṛtyādi lakṣaṇasaṅgrāhyam /
prāmāṇyābhāvāditi cet /
tatkiṃ smṛtyādiprāmāṇyaṃ sādhakapramāṇābhāvānnāṅgīkāryam, uta bādhakasadbhāvāt /


*5,256*

nādyaḥ /
lokavyavahārasya sattvāt /
yathārthajñānatatsādhane hi pramāṇatayā loko vyavaharati /
nahyasti pratyakṣādiprāmāṇyasādhakamanyallokavyavahārāt /

nanu pramāṇābhiyuktānāṃ kaṇabhuga(bhakṣā)kṣapādādīnāṃ tatra (prāmāṇya)pramāṇavyavahāro nāstīti cenna /
"smṛtiḥ pratyakṣamaitihyam'; ityādiśruti(smṛti)siddhārthamanaṅgīkurvatāmāptatvasyāsiddheḥ /
smṛtiḥ pauruṣeyo grantha iti cet /
kimatrāyamakhaṇḍavṛttiḥ śabdaḥ kiṃvā yaugikaḥ /
nādyaḥ /
kṛdantatāyāḥ spaṣṭāvabhāsatvāt /
na dvitīyaḥ /
avyāptyativyāptibhyāṃ yogānupapatteḥ /
tasmānmanvādismaraṇamūlatvātsmṛtirityupacāro grāhyaḥ /
te hi śrutyādinānubhūtamarthaṃ smṛtvā tatpratipādakaṃ granthamāracayanti vyāsādipraṇīteṣu tatsādṛśyātprayogaḥ /
naca mukhye bādhakamantareṇopacāro labhyate /

santu vākṣacaraṇādayo('pyā)hyāptāḥ /
tathāpi tattadvayavahārābhāvamātreṇa smṛtyādiprāmāṇyānabhyupagamo 'yuktaḥ /
nahi taiḥ prativyakti padārthā nirūpitāḥ /
tathāpyuktalakṣaṇaiḥ saṅgṛhītā iti cet /
tulyaṃ smṛtyāderapi /
pratyakṣādyantarbhāvasya suvacatvāt /

api ca smṛtyādikaṃ pramāṇapadavācyam yathārthatvāt pratyakṣavat /
na cānubhavatvamupādhiḥ /
samavyāptipakṣe saṃśayādau vyāptibhaṅgāt /
viṣamavyāptitve(pakṣe)'pi karaṇarūpe pratyakṣe sādhyāvyāpakatvāt /
kiñcedamanubhavatvaṃ smṛtivyatiriktajñānatvamiti cet /
kimarthamidaṃ viśeṣaṇam /
pakṣavyāvṛttyarthamiti cet /
tarhi pakṣetaratvenānupādhitvam /
anyatheśvarānumāne 'pyupādhiraśakyanirāsaḥ syāt /
etenānubhavatatkaraṇayoranyataratvamapi pratyuktam /
Vyāsa-(11)


*5,261*

astu tarhi bādhakasadbhāvāditi dvitīya ityata āha- aṅgīkṛtaṃ cediti //

aṅgīkṛtaṃ cet prāmāṇyaṃ smṛtyādeḥ kā virodhatā // MAnuv_2,1.24cd //

NYĀYASUDHĀ:
smṛtyādeḥ prāmāṇyamiti sambandhaḥ /
kimākṣepe /
tarhīti śeṣaḥ /
samṛtiranuvādaścāpramāṇam niṣphalatvāt /
yadyatpramāṇaṃ tattatsaphalaṃ dṛṣṭaṃ yathā pratyakṣādīti bādhakasadbhāvātkathametaditi cet /
kimatra sarvā smṛtiḥ sarvo 'pyanuvādaśca (savarścānuvādaḥ) pakṣīkriyate, kiṃvā tadekadeśaḥ /
ādye bhāgāsiddhirityāha- na ceti //

nacāphalatvaṃ vaktavyaṃ sarvasmṛtyanuvādayoḥ // MAnuv_2,1.25ab //

NYĀYASUDHĀ:
kāsāñcitsmṛtīnāṃ keṣāñcidanuvādānāṃ ca saphalatvopalambhāditi cārthaḥ /
upapādayiṣyate caitat /
aprayojakaścāyaṃ heturityāha- phalavattvamiti //

phalavattvaṃ nacāsmābhiḥ prāmāṇyaṃ hi vivakṣitam // MAnuv_2,1.25cd //

NYĀYASUDHĀ:
yadi hi phalavattvaṃ prāmāṇyaṃ prāmāṇyasya vyāpakamasmābhiḥ parīkṣakairvivakṣitaṃ syāt /
syānnāma tadā vyāpakasya tasya nivṛttyā smṛtyādeḥ prāmāṇyanivṛttiḥ /
na caivamityarthaḥ /
ayamabhisandhiḥ /
apramāṇa(prāmāṇya)vyavahāre yāthārthyābhāva eva prayojakaḥ, aprāmāṇye tu karaṇadoṣabādhakapratyayau na niṣphalatvamiti /
etenāphalāṃśasyaiva pakṣīkaraṇamiti dvitīyo 'pi nirastaḥ /


*5,363*

karaṇadoṣabādhakapratyayāviva viphalatvamapyaprāmāṇyaprayojakaṃ kinna syādityata āha- tṛṇādīti //

tṛṇādidarśane kiṃ ca phalavattvaṃ nigadyate // MAnuv_2,1.26ab //

NYĀYASUDHĀ:
dharmasya dharmyadhikaraṇamiti saptamī /
grāmaṃ gacchataḥ pathi paritatṛṇādidarśanasya /
upalakṣaṇaṃ caitat /

sva(ka)kāraṇasāmarthyāyātānumiteścetyapi draṣṭavyam /
kimākṣepe /
viphalatvasyāprāmāṇyaprayojakatve tṛṇādidarśanādestathātvenāprāmāṇyaṃ syāt /
na caivam /
lokavyavahāravirādhādityāśayaḥ /

yadvānaikāntikaścāyaṃ heturiti anenācaṣṭe /
pramāṇatayā sammate vipakṣabhūte tṛṇādidaśarne kiṃ phalavattvaṃ nigadyate na kiñcida(kima)pītyaphalatvaṃ tatra gatamiti /


*5,263f.*

nanu kāryajātaṃ prāṇināṃ dharmādharmābhyāmupajāyata iti tāvadavivādam /
tataśca dharmādharmābhyāmujanitatṛṇādidarśanaṃ svayamasukhaduḥkhātmakaṃ yadi sukhaṃ duḥkhaṃ vā tatsādhanaṃ vā na janayet tadā dharmādharmayorvaiyarthyaṃ śrutyāderaprāmāṇyaṃ vā(cā)padyeta /
tataśca tṛṇādidarśanenāpi sukhaduḥkhādikaṃ kiñcidupajanayitavyameva /
ataḥ kathaṃ tasya viphalatvamityata āha- sukheti //

sukhaduḥkhādikaṃ kiñcit smṛtāvapi hi dṛśyate // MAnuv_2,1.26cd //
NYĀYASUDHĀ:
anena nyāyena sarvasyā smṛteḥ sarvasya cānuvādasya saphalatvātsvarūpāsiddha eva hetuḥ syāt /
bhāgāsiddhatā tu spaṣṭaphalopalambhā(bhāvā)bhiprāyeṇokteti bhāvaḥ /
iyāṃstu viśeṣaḥ /
tṛṇādidarśanasya phalaṃ sarvathā(pya)vyaktam naivaṃ smṛtyāderityuktaṃ dṛśyate 'pi hīti /
atrānuvādo 'pi grāhyaḥ /
tathāhi /
iṣyārthasmṛtau sukhaṃ, tajjātīye rāgaḥ, saṃskārapāṭavaṃ ca /
aniṣyārthasmṛtau duḥkhaṃ, tajjātīye dveṣaḥ, saṃskārapāṭavaṃ ca /
praśastārthasmaraṇe dharmaḥ, apraśastārthasmaraṇe tvadharmaḥ /
evamanuvāde 'pi draṣṭavyam /
anyathā praṇidhānādivaiyathyarprasaṅgāt /
"śabdārthayoḥ punarvacanaṃ punaruktam anyatrānuvādāt'; iti vadatākṣapādenāpyanuvādasya sāphalyamaṅgīkṛtam /
nigamanasya ca prayojanāni nyāyavidbhirupapāditānīti /


*5,268*

athāpi syāt /
prākaṭyāparaparyāyāmarthagatāṃ jñātatāmupajanayadeva pramāṇam /
yathā pratyakṣādi /
naca smṛtyādinā 'rthe jñātatopajaniḥ sambhavati /
anubhavenaiva tasyā jātatvāt /
nahi chinne chidā punarutpadyate /
tatkathaṃ tasya prāmāṇyaṃ syāditi /
tatrāha- neti //

na paricchedakāryeva pramāṇamiti ca pramā // MAnuv_2,1.27ab //

NYĀYASUDHĀ:
paricchedo jñātatā /
eveti prativādyuktānuvādaḥ /
paricchedakāryeva pramāṇam /
tadabhāvātsmṛtyādikamapramāṇamiti netyarthaḥ /
kuto netyata āha- iti ceti //
itiśabdenārthagatāṃ jñātatāṃ parāmṛśati /
netyasyānukarṣaṇārthaścakāraḥ /
jñātatāyāṃ pramā pramāṇaṃ nāstītyarthaḥ /
tathā ca jñātatājanakatvaṃ sapakṣe vibhramādāviva vipakṣe pratyakṣādāvapi vartata iti sādhāraṇānaikāntikamiti bhāvaḥ /
kiñca dhārāvāhikavijñānāni smṛtyādikamiva na jñātatāmupajanayantīti kuto nānaikāntyam /
api ca saṃśayaviparyayāvapi jñātatāmupajanayata iti tvayāṅgīkaraṇīyam /
samānanyāyatvāt /
tataśca vipakṣā(tpratyakṣā)diva sapakṣādapi vyāvṛttestavāsādhāraṇo hetuḥ syāt /
yadvā jñātatālakṣaṇasya paricchedasyaivāprāmāṇikatvātparicchedakāryeva pramāṇamityasyāṃ vyāptau na pramāṇamastītyekagranthatayā yojyam /
tathāca vyāpakānupalabdhiliṅgakamanumānaṃ dūrāpāstamiti bhāvaḥ /


*5,270*

nanu cājñātajñāpakameva pramāṇam, ajñātajñānameva vā /
na caitatsmṛtyādāvastīti tadapramāṇamityato vā'ha- neti //
paricchedo 'jñātajñānaṃ, tatkartuṃ śīlamasyāstīti paricchedakāri(rī) /
yadvā pariccheda eva kāra akāraḥ paricchedakāraḥ so 'syāstīti paricchedakāri /
kiṃ paricchedakāritvaṃ prāmāṇyasya vyāpyavyāpakabhūtaṃ lakṣaṇamiti tadabhāvātsmṛtyāderaprāmāṇyamucyate, kiṃvā vyāpakameveti /


*5,270f.*

ādye paricchedakāryeva pramāṇamiti lakṣaṇaṃ na pramā nopapannamiti yojanā /
avyāpterativyāpteśceti /
tathāhi /
dharmiṇamādāyānadhigatārthagantṛtvamucyate prakāraṃ vā /
ādye nityaviṣayāṇāmaprāmāṇyāpātaḥ /
vyāpyavattayāvagataṃ dharmiṇaṃ vyāpakavattayā viṣayīkurvato 'numānasya pṛthagavagatānarthāntsaṃsṛṣṭatayā gocarayataḥ śabdasya cāprāmāṇyaprasaṅgaḥ /
dvitīye tu dhārāvāhikavijñānānāmaprāmāṇyaṃ syāt /
nahi vaināśikānāmiva mīmāṃsakānāmanya eva ghaṭaḥ /
nāpi sāṅkhayānāmiva pariṇāmī /
nāpi prakāramapyupajanāpāyavantamīkṣāmahe /

*5,271*

nanu yadyapi svarūpasya prakārasya vā tādavasthyam /
tathāpi ghaṭo 'yaṃ ghaṭo 'yamiti pratyakṣajñānadhārāyāṃ vartamāna evārthaḥ (pari)sphurati /
naca kramabhāvināṃ jñānānāmeka eva vartamānakāle viṣayo nānāpratipattṛvat jñānayaugapadyaprasaṅgāt /
(tatpra)pratyabhijñānānupapatteśca /
jñānānekatve 'pyekakālāvasthānākalanāt /
tasmātpūvarvūrvavijñānairanākalita eva vartamāno 'rtha uttarottarairavasīyata ityanadhigatārthatvameveti /
evaṃ tarhi smṛtyāderapyanadhigatārthatvameva /
smṛtirapi vartamānatatkālatayānubhūtamatharmatītatatkālatayāvagāhate /
anyathā sa iti na syāt /
anuvādo 'pi yadi vādaviṣayastadā sphuṭamanadhigatārthatvam /
yadi ca pūrvavijñānaviśiṣṭārthagocarastathāpi dhārāvāhikasamāno nyāyaḥ /
adhikavidhānenaikavākyatāyāmapi tatheti /
saṃśayaviparyāsayorapyanadhigataviṣayatvāt prāmāṇyaṃ syāt /
anadhigatatathābhūtārtha(gantṛ)tvaṃ vivakṣitamiti cenna /
anadhigataviśeṣaṇavaiyarthyāt /
smṛtyādivyāvṛttyarthaṃ taditi cet(na) /
smṛtyādikameva kuto vyāvartanīyam /
lakṣaṇābhāvāditi cet /
tadidamitaretarāśrayatvamiti /


*5,286*

astu tarhi vyāpakanivṛttyā vyāpyanivṛttiriti dvitīyaḥ pakṣaḥ /
syādapyevam /
yadi paricchedakāryeva pramāṇamiti pramā pramāṇaṃ syānna ca tadasti /
tathāhi /
prāmāṇyasyānadhigatārthatvena vyāptiḥ kiṃ sāhacaryadarśanamātrātsiddhayati, uta vyabhicāradarśanasahakṛtāt, uta vipakṣe bādhakopetāt /
nādyaḥ /
atiprasaṅgāt /
na dvitīyaḥ /
dhārāvāhini vyabhicāradarśanāt, atiprasaṅgāparihārācca /
na tṛtīyaḥ /
tadabhāvāt /

adhigatamevārthamadhigamayatā pramāṇena piṣyaṃ piṣyaṃ syāditi cet /
kimidaṃ piṣyapeṣaṇaṃ nāma /
kimadhigate 'rthe 'dhigatyantasyānudayaḥ, kiṃvā viphalatvam, utāviśiṣṭaphalatvam, atha anapekṣitaphalatvam /
nādyaḥ /
syādapyevaṃ yadi jñānābhavo 'pi jñānasāmagṣekadeśaḥ syāt /
jñānaṃ vā tatpratibandhakaṃ bhavet /
nacaivam /
tathātve smṛterevānudayaprasaṅgāt /
na dvitīyaḥ /
uktottaratvāt /
na tṛtīyaḥ /
ādye 'pyāpatteḥ /
na caturthaḥ /
tṛṇādidarśane, heyadaśarne ca prasaṅgāt /

nanu ca karaṇaviśeṣaḥ pramāṇam /
kāraṇaṃ ca sādhakatamam /
naca sādhyasiddhau tajjātīyasyāpi sādhakatamatvamasti, chinne paraśoriveti cet /
maivam /
nahi karaṇasya sādhakatamatvaṃ sādhakatamāntarāpekṣayā /
kintu pradhānakriyākārakāntarāpekṣayā /
anyathā yatra karaṇānāṃ samuccayastatra parasparāpekṣayānatiśayitatvādakaraṇatvaṃ syāt /
chinne kuṭhārasyākaraṇatvaṃ tu phalānudayāt /
naca prakṛte tathāstītyuktamiti /


*5,291*

nanvanapekṣatvaṃ prāmāṇyasya vyāpakam, anyonyanirapekṣā(stu) dhārāvāhikā buddhayaḥ /
ataḥ prāmāṇyamaśnuvate /
na caivaṃ smṛtyādītyapramāṇameveti cenna /
asyā api vyāpteraprāmāṇikatvādityāha- neti //
paricchedo 'napekṣaṃ jñānam /
kiñcānapekṣatvaṃ sarvathā cedanityapramāṇeṣu nāsti /
jñānāntarānapekṣatvaṃ cedanumityādau tadabhāvaḥ /
utpattāvevānumityādikaṃ liṅgādyapekṣaṃ nārthapariccheda iti cet(na) /
jñānavyatiriktasyārthaparicchedasyaivābhāvāt /
smṛtyādāvapyevameva suvacatvācca /
samānaviṣaya(ka)jñānānapekṣatvaṃ ceddharmiṇamādāyānumityādāvapi tadabhāvaḥ /
prakārato 'pi smṛtyādāvastītyasiddhiriti /

ananubhavatvātsmṛtirapramāṇam /
anubhavatatsādhanayoreva prāmāṇyādityetadapyasat /
pūrvavadvayāpterasiddherityāha- neti //
paricchedo 'nubhavaḥ /


*5,294*

evaṃ pramāṇasāmānyalakṣaṇamabhidhāya tadviśeṣān lilakṣayiṣurādau pratyakṣasyoddiṣṭatvāttallakṣaṇamāha- nirdoṣeti //

nirdoṣākṣodbhavaṃ hy atra pratyakṣamiti gīyate // MAnuv_2,1.27cd //

NYĀYASUDHĀ:
atra pramāṇeṣu /
lokavedayoriti vā /
nanu kathamidaṃ vijñāyate /
kiṃ nirdoṣairakṣairudbhavo yasyeti, kiṃvā nirdoṣaṃ ca tadakṣodbhavaṃ ceti /
nādyaḥ /
avyāpterativyāpteśca /
tathāhi /
īśvarādipratyakṣaṃ nākṣodbhavaṃ nityatvāt /
akṣakāryaṃ kriyādikamapi pratyakṣaṃ syāt /
na dvitīyaḥ /
dvayorapi viśeṣaṇatvena samāsānupapatteḥ /
uktāvyāptyanistārācceti /
ucyate /
astu tāvadādyaḥ /
ajñānaviparītajñānahetubhiḥ kācakāmalādidoṣai rahitāni yānyakṣāṇīndriyāṇi tairudbhavo yasyeti /

na cāvyāptiḥ /
udbhavaśabdasyotpattyabhivyaktyanyatarāthartvāt /
yathoktam"sarvamakṣātmakaṃ matam'; iti /
nāpyativyāptiḥ /
jñānasya prakaraṇaprāptatvāt /
tathāpyakṣaliṅgake 'numāne 'tivyāptiriti cenna /
tasyākṣajñānodbhavatvenākṣamātrodbhavatvābhāvāt /
nirdoṣākṣodbhavamapyarthadoṣādayathārthamutpadyate jñānam /
yathoktam /
"atidūrādatisāmīpyādindriyadoṣānmano 'navasthānāt /
saukṣmyādyavadhānādabhibhavātsamānābhighātācca'; iti /
tathāpi nirdoṣārthasannikṛṣṭeti viśeṣaṇādadoṣaḥ /


*5,298*

atra jñānagrahaṇaṃ sukhādivyāvṛttyarthamiti kecit /
tadasat /
viṣayasākṣātkārasyaiva sukhādihetutvāt /
indriyārthasannikarṣaḥ(tu) tadarthamabhyarthyate /

nanvevaṃ sati sarvārthasākṣātkāravataḥ parameśvarasya sukhādyutpādaprasaṅga iti cet /
līlāvigrahagrahaṇe tasyendriyārthasannikarṣavataḥ kuto na tatprasaṅgaḥ /
atha na tāvanmātraṃ sukhādikāraṇam /
kinnāma dharmādikamapi /
atastadabhāvānna tasya sukhādyutpāda iti cet /
tulyam /
ata eva na yogiṣvapi prasaṅgaḥ /
tathācāhuḥ /
"dehe śītoṣṇādisambandhāddhi śītoṣyādyanubhava ātmanaḥ tataśca sukhaduḥkhe'; iti /
atra dehaśabdena tadāśritānīndriyāṇyupalakṣyante /
tadayaṃ lakṣaṇātharḥ /
nirdoṣārthasannikṛṣṭanirdoṣendriyodbhavaṃ jñānaṃ pratyakṣamiti /


*5,300*

yadvā nirdoṣārthendriyasannikarṣajaṃ jñānaṃ pratyakṣamityevārthaḥ /
janyapratyakṣaviṣayameva (vā ta)etadvayākhyātam(nam) iti noktadoṣaḥ /
anugatalakṣaṇasiddhayarthaṃ tu dvitīyaṃ pakṣaṃ parigṛhṇīmaḥ /
nirdoṣaṃ yathārthamakṣodbhavamiti /
akṣodbhavaśabdena (ca)sākṣātkāro lakṣyata iti na kaściddoṣaḥ /
sākṣātkāratvaṃ ca jñānagata eva viśeṣo na karaṇopādhikaḥ /
tadanena kevalaṃ pratyakṣaṃ lakṣitam /


*5,301f.*

atraiva yatastaditi padadvayādhyāhāreṇa yathārthāparokṣajñānasādhanamityanupramāṇapratyakṣalakṣaṇamapi vyākhyeyam /
tacca vivakṣābhedena nirdoṣārthendriyasannikarṣo vā nirdoṣārthasannikṛṣṭamaduṣyamindriyaṃ veti /
nanu"aduṣyamindriyaṃ tvakṣam'; iti vacanādakṣaśabda evāduṣyatāmācaṣṭe /
tatkimarthaṃ nirdoṣetyakṣaviśeṣaṇam /
maivam /
indriyaṃ tvakṣaṃ taccāduṣyamiha vivakṣitamiti tadvayakhyānāt /


*5,303*

nanvetallakṣaṇaṃ pratigatamakṣaṃ pratyakṣamityevaṃ śabdanirvacanādeva pratīyamānaṃ lakṣyātpratyakṣānna bhidyate /
nacaikasyaiva lakṣyalakṣaṇabhāvaḥ sambhavati /
jñātā(tva)jñātatvāsambhavāditi cenna /
atra pratyakṣapadavācyatāyāḥ sādhyatvena vivakṣitatvādityāśayenoktam- iti gīyata iti //


*5,303f.*

nanu nirdoṣatendriyāṇāṃ kuto 'vagantavyā /
jñānayāthārthyāditi cet /
tadapi kiṃ karaṇa(gatayā)nirdoṣatayā jñātavyaṃ, kiṃvā viruddhapramāṇābhāvāt /
nādyaḥ /
parasparāśrayatāpatteḥ /
na dvitīyaḥ /
asañjātavirodhivibhrame 'pyāpatteḥ /
maivam /
jñānayāthārthyasya sākṣisiddhatvāṅgīkārāt /
parīkṣāpekṣāyāṃ tu prabalavirodha(dhā)bhāvaḥ sācivyamācarati /
yathoktam"balavatpramāṇataścaiva jñeyā doṣā na cānyathā'; iti /
asañjātavirodhī tu vibhrama eveti kutaḥ /
deśakālapuruṣāntarasambandhiviparītapramāvaśāditi cet /
kathaṃ tarhyasañjātavirodhitvam /
evaṃ tarhi sarvathā viparītapramābhāvo 'ṅgīkṛtaḥ syāt /
addhā /
so 'pi taistaiḥ parīkṣāviśeṣairniścīyate /
nirmūlaṃ tu na śaṅkayate /
anyathā sarvatrānāśvāsenābhimatamapi na siddhayediti /


*5,307*

nanvindriyārthasannikarṣasya pratyakṣatve gagananayanasannikarṣādapi jñānamutpadyatām /
maivam /
arthaśabdena tattadindriyagrahaṇayogyasyaiva vivakṣitatvāt /
gaganādau ca tadyogyatābhāvasya kāryābhāvādeva siddheḥ /
etena cakṣurādinā gandhādigrahaṇaprasaṅgo 'pyapāstaḥ /


*5,307f.*

atha matam /
yadyāśritā yogyatā, kimantargaḍunā sannikarṣeṇa /
tattadindriyaviṣayastena tenendriyeṇa gṛhyate /
kathamanyathā kācābhrapaṭalādyantaritopalabdhiḥ syāt /
sāntaragrahaṇaṃ ca prāptipakṣe na sambhavati /
prāpyakāriṣu tavagādiṣu tadabhāvāt /
kiñca nayanaṃ cetprāpyakāri tadā svasaṃyuktamātraṃ gṛhṇīyāt /
kuṭhārādiṣu tathā darśanāt /
pṛthutaraṃ ca gṛhṇāti /
digviśeṣasandehaścaiva sati na syāt /
prāptyā tanniścayaprāpteḥ /
sannikṛṣṭaviprakṛṣṭayoḥ śākhācandramasoryugapadgrahaṇācca /
nahi prāpyakāriṇyevaṃ bhavitumarhati /
api ca cakṣuḥ aprāpyārthaprakāśakam atyāsannāprakāśakatvāt /
vyatirekeṇa śrotrādivat cakṣurgatvā nārthena sambadhyate indriyatvāt sparśanādivat /
nacārthasya āgamanaṃ pratyakṣavirodhāt /
tathā cāprāpyaprakāśakatvasiddhiriti /


*5,310*

atrocyate /
viṣayakaraṇayoryogyatāmātramupādāya sannikarṣāpākaraṇaṃ kiṃ sarvatrota nayana eveti vaktavyam /
na prathamaḥ /
aprāptaireva kuṭhārādibhiḥ kāṣṭhādau chidādyudayaprasaṅgāt /
ghrāṇarasanasparśanairaprāptaireva gandhādyavabodhodayāpatteśca /
tathāca yogyatāvadanvayavyatirekasiddhā prāptirapi kriyotpādopayoginī /
na dvitīyaḥ /
viśeṣakāraṇābhāvāt /
yogyatāyā anvayavyatirekadaśarnātprāpteścānupalambhāditi cenna cakṣuṣo 'pi karaṇatvendriyatvābhyāṃ prāptyupalambhāt /


*5,311*

nanvatra kiṃ golakaṃ pakṣīkriyate uta tadatiriktaṃ cakṣuḥ /
ādye pramāṇabādhaḥ /
dvitīye tvāśrayāsiddhiriti cenna /
tavāpi golakapakṣīkāre siddhasādhanam /
anyatrāśrayāsiddhiriti vaktuṃ śakyatvāt /
atha viśeṣaṃ vihāya rūpadarśanānumitaṃ karaṇamātraṃ pakṣīkriyata iti brūṣe /
samaṃ mamāpi /
ata eva golakātiriktamapi tatsetsyati /
sannikarṣaśca pratyāsattimātraṃ vivakṣitam, na saṃyogādiriti na śabdādibhirvyabhicāraḥ /


*5,313*

kā ceyaṃ yogyatā yanmātrādasannikṛṣṭamapi cakṣuḥ prakāśayet /
yadi rūpaviśeṣādirūpā tadātītānāgatayorapi tadbhāvāccākṣuṣatāpattiḥ /
sannikarṣārthaṃ khalu vartamānatābhyarthanam /
sannikarṣasyānyathāsiddhau pratyabhijñāyāṃ tattāṃśasya cakṣuṣāvabhāsanāt sa cedanapekṣitaḥ, kiṃ tadā vatarmānatayā /
atha vartamānatāpi rūpadivadyogyatāntargatā, tadā pratyabhijñā na siddhayet /
kuḍyādivyavahitapratītiprasaṅgaśca /
prāptipratibandhakaṃ hi kuḍyādivyavadhānamiti prāptyarthaṃ tadabhāvo 'nveṣaṇīyaḥ syāt /
sā yadi neṣyate tadā kuḍyādikaṃ kasyāpakuryāt /
āvaraṇābhāvo 'pi yogyateti cet /
na /
kuḍya(ḍyā)parabhāgāvasthitenāpyagrahaṇaprasaṅgāt /
atha nayanaviṣayayormadhye nibiḍa(ḍāvayava)dravyābhāvo vivakṣita iti cet /
sphaṭikādyantaritānupalabdhriprasaṅgāt /
asvacchadravyābhāvo vivakṣita iti cet /
tathāpyavyavahitadūradarśanāpattireva /
atha kṣaṇabhaṅgapariṇāmāvāśritya tathābhūtasyotpādānutpādau eva yogyatāyogyate manyase, tadā so 'rthaḥ kadācitsarvairupalabhyeta kadācinna kenāpi /
draṣṭṛnibandhano 'pi tadbhedo 'stīti cenna /
pramitasannikarṣaparityāgenāpramitānekakalpanasyānucitatvāt /


*5,317*

kiñcāsannikṛṣṭapratītau ca āsannasannikṛṣṭaviprakṛṣṭayorvaiśadyāvaiśadye na syātām /
asmākaṃ tu nayanaraśmayaḥ samyagāsannena sannikṛṣṭante viprakṛṣṭena tvasamyak pradīparaśmaya iveti yukte pratītervaiśadyāvaiśadye /
kācādyantaritopalabdhyā kimaprāpyaprakāśakatvaṃ kalpayāmaḥ kiṃvā kācādīnāṃ praptipratibandhakatvābhāvāt /
ādyaḥ pramāṇaviruddho 'nekātiprasaṅgaparāhata iti dvitīya evāśrayaṇīyaḥ /
tathātve kācādervyūhāntaratāpatti(tte)riti cet /
(na) jalānalavyatibhede 'pi ghaṭādestadabhāvāt /
tatrāpi sūkṣmataratadabhyupagame 'trāpi sāstu /
sāntaragrahaṇamapyasannikṛṣṭasya grahaṇaṃ cedasiddham /
sāntara iti grahaṇaṃ cetpradīpe 'naikāntikam /

yathā khalu dīpo raśmibhirarthasannikṛṣṭo 'pi svarūpāpekṣayā sāntara iti pratīyate tathā cakṣurapyadhiṣṭhānāpekṣayeti kimanupapannam /
pṛthutaragrahaṇamapi nayanaraśmīnāmunmattakakusumavatpṛthvagratayopapatsyate /
aprāptau tvalpasyāpi grahaṇaṃ na syāt /
prāptau digviśeṣasandeho na syāditi cet(na) /
aprāptau sarvatra kalpayiṣyati /
yugapadgrahaṇābhimānastu tejasaḥ śīghragāmitānibandhano bhrama eva /
prāpteḥ pramāṇasiddhatvāt /


*5,323*

apara āha /
nayanaraśmayaḥ śākhācandrasaṃyuktaiḥ sauraraśmibhirekībhūtā yugapacchākhācandramasau grāhayantīti /
tadasat /
sarvārthagrahaṇaprasaṅgāt /
adṛṣṭāttadvayavastheti cet /
(na) bāhyasādhanasākalye 'dṛṣṭavaikalyena kāryānudayasya kvāpyadarśanāt /
adṛṣṭavaikalye hi bāhyasāmagrī vikalā syāt /
anyathā samanaskendriyasannikṛṣṭaḥ sphītālokamadhyamadhyāsīno 'pi ghaṭaḥ kadācinnopalabhyeta /
aprāpyārthaprakāśakamiti cāprasiddhaviśeṣaṇatā /
atyāsannāprakāśakatvaṃ prāpyaprakāśakeṣu ghrāṇādiṣvapi vidyate /
svagatagandhāderagrahaṇāt /
parasyaiva atyāsannakācādyagrahaṇamayuktam /
yogyatāyā anapāyāt /


*5,325*

gatvā nārthena sannikṛṣṭata ityatra kiṃ gatipratiṣedhaḥ sādhyaḥ, kiṃvā sannikaṣarpratiṣedhaḥ, utobhayapratiṣedhaḥ /
nādyaḥ /
kālātītatvādanaikāntyācca /
na dvitīyaḥ /
anaikāntikatvādeva /
ata eva na tṛtīyo 'pi /

viśiṣṭaniṣedho 'yamiti cenna /
so 'pi viśeṣaṇābhāvena vetyādivikalpadūṣaṇānistārāt /

sannikarṣārthaṃ gatimanna bhavatīti sādhyamiti cenna sparśanādāvanaikāntyāt /
śīlajalasannikarṣārthaṃ tvagindriyagataye hi śarīraparispando bhavati /

athāyamabhiprāyo 'dhiṣṭhānādbahirna gacchatīti /
tadendriyatve samāne 'pi ghrāṇādīnāmataijasānāmanevambhāvaḥ /
cakṣuṣastu taija(se)sasyetthambhūta(tvā)tetyaṅgīkāre bādhakābhāvādaprayojakatvam /
cākṣuṣaraśmīnāmupalabdhiprasaṅga iti cenna /
atīndriyatvopapatteḥ /
mahattejojātīyamaindriyakamupalabdhamiti cet cākṣuṣamapyupalabdhamiti vāristhaṃ tathā syāt /
adṛṣṭavaśādanudbhūtarūpaṃ taditi cet /
idamapyanudbhūtarūpasparśaṃ kuto na kalpyate /
kalpikāyāṃ prāpyakāritāyāṃ pramāṇasyoktatvāt /

yadi ca nayanaṃ nirgatyārthaṃ gṛhīyāttadā unmīlyanimīlane 'pi arthapratipattiḥ syāt /
yadi (cākṣuṣa)vākṣamadhiṣṭhānātiriktaṃ syādadhiṣṭhānopaghātacikitse vyarthe syātāmiti tu pradīpena samānayogakṣemam /

api ca /
chāyāyāmupaviṣyasyā(pyātapālokane)tapāvalokanena nayanasyāśiśiratvamātapopaviṣyasyāpi śiśiradravyāvalokanena śiśiratvaṃ caitamevārthaṃ gamayataḥ /
na hyaprāptāvetadupapadyate /
tadetadakhilamapi pramāṇaprasiddhamiti kimatra vaktavyamiti hiśabdenācaṣṭe /

// iti pratyakṣasāmānyalakṣaṇanirūpaṇam //



*5,330*

yadakṣaviśeṣaṇaṃ nirdoṣatvamuktaṃ tadvayavacchedyaṃ darśayitumakṣabhedaṃ tāvadāha- prākṛmiti //

prākṛtaṃ śuddhacaitanyamakṣaṃ tu dvividhaṃ matam // MAnuv_2,1.28ab //

NYĀYASUDHĀ:
prakṛtiśabdenāhaṅkāraḥ pañcabhūtāni cocyante /
sūkṣmarūpeṇa nityamapyahaṅkārabhūtāṃśairupacitatvātprākṛtam /
śuddhamityasyaiva vivaraṇaṃ caitanyamiti /
cetiśabdāvadhyāhāryau /
tuśabdenācaitanyamevendriyaṃ taccāhaṅkārikameveti vadatāṃ sāṅkhayādīnāṃ, bhautikameveti bhāṣamāṇānāṃ vaiśeṣikādīnāṃ, dravyendriyabhā(vye)vendriyabhedāddvividhamiti jalpatāṃ jainānāṃ ca mataṃ vyavacchinatti /
matamiti svoktārthasya pramitatvamāha /


*5,333*

tatra jaḍacaitanyabhedamanupadamevopapādayiṣyati /
jaḍasya ca nityāhaṅkārikabhautikatvam"sūkṣmendriyāṇi santyeva syuḥ sthūlānyapyahaṅkṛteḥ /
teṣāṃ bhūtairupacayaḥ sṛṣṭikāle vidhīyate'; ityādismṛtisiddham /
naca kevalāhaṅkārikatve bhautikatve vā pramāṇamasti /
kapilādīnāmāptatvāsiddheḥ /
ghrāṇaṃ pārthivaṃ rasāvyañjakatve sati gandhavyañjakatvāt kuṅkumagandhābhivyañjakaghṛtavat /
rasanamāpyaṃ rūpāvyañjakatve sati rasavyañjakatvāt /
lālāvat /
cakṣustaijasaṃ sparśāvyañjakatve sati rūpavyañjakatvāt pradīpavat /
sparśanaṃ vāyavīyaṃ śabdāvyañjakatve sati spaśarvyañjakatvāt vyajanavātavaditi /


*5,335*

atra pārthi(vāditva)vatvādimātrasādhane siddhasādhanatvam /
tanmātratvasādhane dṛṣṭāntānāṃ sādhyavaikalyam /
sarvatra pāñcabhautikatvābhyupagamāt /
sarvatra cādṛṣṭena vyabhicārā(raḥ)t /


*5,336*

tat sarvavyañjakamiti cet /
kiṃ vyaktipuraskāreṇocyate utopādhyavacchedapuraskāreṇa /
nādyaḥ /
yadadṛṣṭamekaikavyañjakaṃ tatra vyabhicārānistārāt /
tanna niścitamiti cet /
tathāpi sandigdhavyabhicāritā /
na dvitīyaḥ /
indriyatvāvacchedenāsiddheḥ /


*5,337*

kiñca pārthivādipadaiḥ pṛthivītvādyabhidhāne tattatsannikarṣairanaikāntyam /
indriyatvena hetuviśeṣaṇe dṛṣṭāntānāṃ sādhanavaikalyam /
pṛthivyādikāryatāsādhane prāguktasiddhasādhanatāparihārāya mātrapadaprayoge pṛthivyādirūpādivyañjakasannikarṣeṣu vyabhicāratādavasthyam /


*5,343*

api ca /
carmādigandhavyañjakatvaṃ jalādeḥ, rasavyañjakatvam lavaṇādeḥ, rūpavyañjakatvamañjanādeḥ, sparśavyañjakatvaṃ karpūrāderapyastīti vyabhicāra eva (iti) /


*5,346*

indriyadvaividhyasya pramitatvamuktam /
tatkathamityata āha- śuddhamiti //

śuddhamīśaramāmukteṣvanyatra prākṛtairyutam // MAnuv_2,1.28cd //

NYĀYASUDHĀ:
prāk prasiddhitāratamyamapekṣyoddeśe 'pi prādhānyatāratamyāpekṣayopapādanamiti draṣṭavyam /
anyatra saṃsāriṣu /
prākṛtairakṣairyutaṃ śuddhamastītyarthaḥ /
ayamabhisandhiḥ /
upapādayiṣyate hīśaramāmuktānāmakṣavattā /
naca tadakṣaṃ prākṛtamiti yuktam /
nirguṇatvādiśrutismṛtivirodhāt /
tatastacchuddhacaitanyameva bhavitumarhati /
saṃsāriṣu cākṣavattā suprasiddhā /
naca tanmuktāvakṣapratipādakapramāṇabalāyātaṃ śuddhamevāstviti yuktam /
saṃsāre 'pi samyagjñānaniyamādyāpatteḥ /
atastatra prākṛtaṃ śuddhaṃ ceti dvividhamapyastīti svīkāryam /
tataḥ siddhamuktarūpākṣadvaividhyamiti /
parairīśalakṣmyorlīlāvigrahagrahaṇa(ṇā)maṅgīkāribhistadakṣasya prākṛtatvamaṅgīkriyate /
tānprati kiṃ vādāntareṇeti muktagrahaṇam /
svamate muktānāṃ līlāvigrahasvīkārāt /
kimanyadāpīndriyopapādanāyāsenetīśarameti /


*5,349*

kimato yadyevamakṣadvaividhyamityata āha- nirdoṣameveti //

nirdoṣameva caitanyamanyatrobhayamiṣyate // MAnuv_2,1.29ab //

NYĀYASUDHĀ:
tatrottamajīvasambandhicaitanyamakṣaṃ nirdoṣamevetyarthaḥ /
anyatrāpi nirdoṣatāsadbhāvādevetyuktam /
anyatra madhyamajīvasambandhicaitanye /
sarvatra prākṛte cākṣe nirdoṣatvaṃ sadoṣatvaṃ cobhayaṃ kālādibhedeneṣyate /
adhamasambandhicaitanye tu sadoṣatvameveti śeṣaḥ /
iṣyate prāmāṇikairiti /
anenāgamaṃ kāryaliṅgakamanumānaṃ cātrārthe darśayati /
yāvadatra sadoṣamuktaṃ tannirdoṣagrahaṇavyavacchedyamiti bhāvaḥ /


*5,354*

nanu ca saṃsāriṣu pravṛttisiddhayarthamindriyamavaśyamaṅgīkaraṇīyam /
naca tacchuddham /
uktānupapatteḥ /
ta(a)taḥ prākṛtenaiva savarsyopapatteḥ saṃsāriṣu śuddhendriyābhyupagamo nirbīja eva /
naca muktau śuddhasadbhāvātprāgapi tadaṅgīkaraṇīyam /
muktivacchuddhendriyasyāpi paścātprāptyupapatterityata āha- sukheti //

sukhaduḥkhādiviṣayaṃ śuddhaṃ saṃsārageṣvapi // MAnuv_2,1.29cd //

NYĀYASUDHĀ:
na kevalamīśaramāmukteṣu (kintu) saṃsārageṣvapi śuddhamindriyamaṅgīkaraṇīyam /
kutaḥ sukhaduḥkhādiviṣayam /
ayamarthaḥ /
asti tāvatsaṃsāriṇāṃ sukhaduḥkhecchādiviṣaye(yo)'parokṣāvabhāsaḥ /
liṅgādyananusandhānenaivāhaṃ sukhītyādispaṣṭāvabhāsadarśanāt /
nacendriyaviṣayatāmantareṇāparokṣāvabhāsitvaṃ sukhādīnāṃ yuktam /
dharmāderapi tatprasaṅgāt /
tasmātsukhaduḥkhādiviṣayamindriyamaṅgīkartavyam /
tadeva śuddhamiti /

astu sukhaduḥkhādiviṣayamindriyaṃ saṃsāriṣu /
tacchuddhamiti kutaḥ /
prākṛtenāpi tadaparokṣāvabhāsopapatterityata āha- nirdoṣatveti //

nirdoṣatvātiniyamāt tad baliṣṭhatamaṃ matam // MAnuv_2,1.30ab //


*5,355*

NYĀYASUDHĀ:
tatsukhādiviṣayamindriyaṃ tāvadbaliṣṭhatamaṃ sarvathā(pya)'bādhyaṃ mataṃ sarveṣāṃ sammatam /
na hi kadācidapyasati sukhe ahaṃ sukhīti pratyayo 'sti /
nāpi sati nāsti sukhīti /
tathā hi satīndriyasya bādhyatā syāt /
baliṣṭhatamatā cendriyasya nirdoṣatvādiniyamādevopapadyate nānyathā /
sadoṣāṇāṃ bādhadarśanā(niyamā)t /
nirdoṣatvātiniyamaśca śuddhasyaiva dharmo na prākṛtasyeti sukhādiviṣayasyendriyasya śuddhatāsiddhiriti /
etaduktaṃ bhavati /
sukhādikamindriyaviṣayaḥ aparokṣāvabhāsitvāt ghaṭavat /
sukhādiviṣayamindriyaṃ śuddham nirdoṣatāniyamavattvāt īśvarādīndriyavat /
vimataṃ nirdoṣatāniya(tima)mavat sarvathāpyabādhyatvāt tadvadeveti /
yadyapi muktānāṃ śuddhendriyavattvena saṃsāriṇāṃ tadvattā śakyasādhanā tasya tatsvarūpatāvagamāt /
svarūpasya cānāgantukatvāt /
tathāpi sākṣiṇo yatpratyakṣatvamuktaṃ tadvibhāvayitumayaṃ pramāṇāntaropanyāsaḥ /
sukhādiviṣayaṃ svarūpabhūtaṃ caitanyendriyaṃ hi sākṣītyucyate /
tadabhivyaktaṃ jñānaṃ ceti /


*5,356*

nanu prākṛtaśuddhabhedāt dvividhamindriyamityasat /
"śrotraṃ cakṣuḥsparśanaṃ ca rasanaṃ ghrāṇameva ca /
adhiṣṭhāya manaścāyam'; iti pañcendriyamanobhedenendriyaṣāḍvidhyasmaraṇavirodhādityata āha- pañceti //

pañcendriyamanobhedāt prākṛtaṃ ṣaḍvidhaṃ smṛtam // MAnuv_2,1.30cd //

NYĀYASUDHĀ:
yatpañcendriyamanobhedādindriyaṃ ṣaḍvidhamiti smṛtaṃ tatprākṛtaṃ na tu sarvamityato na virodhaḥ /
jñānendriyāṇāmevātra(vivakṣita)uktatvānnaikādaśatvo(śo)ktivirodhaḥ /
buddherapi manasyantarbhāvānna saptatvavirodhaḥ /
nanvākāśātmakasya śrotrasya kathaṃ prākṛtatvāt /
maivam /
bhūtākāśapariṇāmatvābhyupagamāt /
avyākṛtākāśātmakatve sārvatrikaśabdopalabdhiprasaṅgaḥ /
karṇaśaṣkulyavacchedāṅgīkāre 'pi badhirābhāvaprasaktiḥ /
adṛṣṭopagrahānneti cenna /
tathā satyākāśasyaiva tattadavacchinnasyādṛṣṭopagṛhītasya ghrāṇādibhāvopapattau pārthivatvādyabhyupagamavaiyarthyāt /
gandhādimattvāttatsiddhiriti cenna, asiddheḥ /
yadindriyaṃ yaṃ viśeṣaguṇaṃ gṛhṇāti tat tadvaditi vyāpteḥ sukhādigrāhiṇi manasi, sāṃsiddhikadravatvasnehagrāhiṇi cakṣuṣi, śītoṣṇasparśagrāhiṇi sparśane ca bhagnatvāt /
āgamātpṛthivyādiprākṛtikatāvagamyata iti cet /
tarhyahaṅkārikākāśakāryatā śrotrasyāpi tata evāṅgīkaraṇīyā /


*5,360*

nanu manonādinityaṃ kathaṃ prākṛtam /
maivam /
pramāṇābhāvāt /
sparśarahitadravyatvādeḥ sattvānneti cet(na) /
tamasmasmākamanaikāntyāt /
nityatvādimātrasādhane siddhasādhanatvāt /
kūṭasthatāsādhane tvāgamavirodhāditi /

// iti pratyakṣanirūpaṇam //
Vyāsa-(12)


*5,362*
kramaprāptaṃ kevalamanupramāṇaṃ ca anumānaṃ lakṣayati- anumeti //

anumā yuktirevoktā ... // MAnuv_2,1.31a //

NYĀYASUDHĀ:
atrānumeti lakṣyam /
yuktiriti lakṣaṇam /
yadi ca yuktereva bahuśaḥ prakṛtatvāttatsvarūpajijñāsāyāmidaṃ pravṛttam /
tadā viparīto lakṣyalakṣaṇabhāvaḥ /

nanvanumā yuktiriti paryāyāvetau /
tathāhi /
phalaprāmāṇyapakṣe 'numitiranumeti bhāvasādhano 'numāśabdo liṅgadarśanasamutthaṃ laiṅgikaviṣayamanumitināmakaṃ yathārthajñānamāha /
tadeva yojanaṃ yuktirita yuktiśabdo 'pi /
sādhanaprāmāṇyapakṣe 'pyapakṣe 'apyanumīyate 'nayeti karaṇasādhano 'numāśabdo yamarthamācaṣṭe tameva yujyate 'nayeti yuktiśabdo 'pi /
tatkathaṃ lakṣyalakṣaṇabhāva ityata uktam- uktaiveti //
atrāpi vyavahāra eva sādhyo na tvanumātvaṃ, yuktitvaṃ vā /
yenoktadoṣaḥ syāditi bhāvaḥ /


*5,363*

nanu yuktyupapattiśabdāvekārthau tathā cānyatra nirdoṣopapattiranumetyādau yadi nirdoṣagrahaṇasya vyāvartyamasti tadātrāpi tatkartavyaṃ syāt /
anyathātivyāptiprasaṅgāt /
na (nāsti) cenna (tatka)kartavyamiti /
ucyate asti khalu śabdānāṃ mukhyāmukhyabhedena dvayī vṛttiḥ /
evañcopapattiśabdādupapattāviva tadābhāse 'pi pratipattāvutpannāyāṃ tadvayavacchedena mukhyārthopadarśanārthaṃ tatra nirdoṣagrahaṇaṃ kṛtam /
atra punarantargatanirdoṣatvaṃ mukhyamevārthamupādāya yuktirityevoktam /
samīcīno heturanaikāntiko heturiti yatheti /
tadidamapyuktaṃ yuktireveti /
natu nirdoṣatvaviśeṣitā /
yuktiśabdamukhyārthavivakṣāyāṃ tadanapekṣaṇāditi śeṣaḥ /


*5,364*

athavā nedaṃ paryāyalakṣaṇam /
kinnāma yujyate sambaddhayate iti yuktiranumokteti yojyam /
nanvevaṃ sati viruddhānadhyavasitavyavacchede 'pyanaikāntikasyānumānatvaṃ syādityato yuktirevetyuktam /
yujyata eva na tu (vi)yujyate 'pītyarthaḥ /
prameyatvādikaṃ hyanityatvādinā yujyate, na yujyate ca /
natu yujyata eva /
tadanena sāhityaniyamavat vyāpyaṃ, liṅgam, anumānamiti cocyata ityuktaṃ bhavati /


*5,366*

saugatāstu manyante /
tādātmyatadutpattī evānumānāṅgabhūtau sambandhāviti /
vaiśeṣikāstvasyedaṃ kāryaṃ kāraṇaṃ sambandhyekārthasamavāyi virodhi ceti laiṅgikanimittasambandhānparisañcakṣate /
evaṃ
"mātrānimittasaṃyogivirodhisahacāribhiḥ /
svasvāmivadhyaghātādyaiḥ sāṅkhayānāṃ saptadhānumā'; //
iti sāṅkhayāḥ parisaṅkhayātavantaḥ /
tatsarvamapākartuṃ vā yuktirevetyavadhāraṇam /
niyatasambandhavadevānumānaṃ na sambandhaviśeṣavadityarthaḥ /
etaccopapādayiṣyāmaḥ /


*5,370*

kecidāhuḥ /
pakṣadharmatāpyanumānāṅgamiti /
tadapyapākurvannuktameva vivṛṇoti- vyāptireveti //

... vyāptireva tu sā smṛtā // MAnuv_2,1.31b //

NYĀYASUDHĀ:
viśeṣeṇāpyata iti vyāptiḥ /
yadavyabhicaritasāhityopetameva liṅgaṃ sānumā /
na pakṣadharmatāvaśyambhā(vavatītya)vinītyarthaḥ /
yadvā vyāptiriti bhāvasādhanaḥ /
tathātve vyāptireva sānumeti gauṇo nirdeśaḥ /
vyāptirevānumānāṅgaṃ na pakṣadharmatetyarthaḥ /
upapādayiṣyate caitadvayadhikaraṇasyāpi sādhakatāmupapādayatācāryeṇaiva /
etena"jñātasambandhaniyamasyaikadeśasya darśanāt /
ekadeśāntare jñānamanumānamabādhitam'; ityapi nirastam /
ekadeśatāniyamasyāprayojakatvāt /


*5,372*

yaduktaṃ pakṣadharmatvaṃ sapakṣe sattvaṃ vipakṣādvayāvṛttirabādhitaviṣayatvamasatpratipakṣatvamiti pañcarūpopapannamanumānamiti /
yathā(''ha) /
"anumeyena sambaddhaṃ prasiddhaṃ ca caśabdasaṅgṛhītamiti /
tadasat /
kevalānvayino vipakṣādvayāvṛttyabhāvena kevalavyatirekiṇaśca sapakṣe sattābhāvenāvyāpakatvāt /
kvaciccatūrūpopapannatvaṃ kvacitpañcarūpopapannatvamiti cet(na) /
ekaprayojakālābhāt /
vyāptipakṣadhamartaupayikatvenaiṣāṃ grahaṇam /
vastutastu te evānumānāṅgamiti cenna /
pakṣadharmatāyā apyaprayojakatvāt /
tathāca vyāptireva prayojiketi vaktavyam /
kimanena jalpitenetyāha- vyāptireveti //
avinābhāvo vyāptiḥ /


*5,376*

sā dvividhā /
anvayavyatirekabhedāt /
sādhyena sādhanasya vyāptiranvayaḥ /
sādhanābhāvena sādhyābhāvasya vyāptirvyatireka iti kecidācakṣate /
taddvaividhyaṃ tuśabdena vyavacchinatti /

tathāhi /
yo 'gnimānna bhavati sa dhūmavānna bhavatīti vyatirekavyāptiḥ kiṃ dhūmenāgnisādhane upayujyate kiṃvāgnyabhāvena dhūmābhāvasādhane /
nādyaḥ /
yo dhūmavānasāvagnimānityanvayavyāptyaiva tatsiddheḥ /
anyathā kevalānvayavato 'sādhakatvaprasaṅgāt /
kiñcātrābhāvayorvyāpyavyāpakabhāvo, bhāvena bhāvasādhanamiti subhāṣitam /
anyagatayā vyāptyānyasya sādhakatve 'tiprasaṅgāt /
yadabhāvayorvyāpyavyāpakabhāvastayoreva sādhyasādhanabhāva ityabhyupagame nātiprasaṅga iti cenna /
tathāpi vyāpyaṃ liṅgamityasyāvyāptiprasakteḥ /
yadabhāvayorvyāpyavyāpakabhāvastayoreva sādhyasādhanabhāva ityabhyupagame nātiprasaṅga iti cenna /
tathāpi vyāpyaṃ liṅgamityasyāvyaptiprasakteḥ /
yadabhāvo yadabhāvasya vyāpakaḥ sa tasya vyāpya iti niyamādadoṣa iti cet(na) /
tarhi na vyatirekavyāptiḥ prakṛtasādhyasiddhayupayoginī, kinnāma prakṛtasādhanavyāptisādhanopayoginī /
tatra cānvayirūpataiva tasyāḥ /
dvitīyastviṣyata eva /
kinnāma sāpyanvayarūpaiveti na sarvathā vyāptidvaividhyaṃ sambhavatīti /


*5,377*

etenānumānasya kevalānvayikevalavyatirekyanvayavyatirekibhedena traividhyamapi parāstam /
vyatirekavyāpteranumānānaṅgatvāt /
sadbhāvamātreṇa vyutpādanasyātiprasaṅgitvāt /
kathaṃ tarhi kevalavyatirekiṇo gamakatvamiti cet /
ko 'yaṃ kevalavyatirekī nāma /
kevalo vyatireka eva yasyāsāviti cet /
tarhi kathamatyantāsatoḥ sādhyasādhanatā syāt /
dṛśyate tāvaditi cenna /
yatastasyānyaiva gatiḥ /
prāṇādimattvasya sātmakatvena vyāptirjīvaccharīra eva gṛhītā /
atastatraiva vipratipattau na sopadarśayituṃ śakyābhūt /
vyāptimātramevānumānāṅgaṃ na punaḥ sapakṣe tadupadarśanamapītyato vyatirekayorvyāptyā tadupapādanaṃ kriyate /

ayamatra prayogakramaḥ /
jīvaccharīraṃ sātmakaṃ prāṇādimattvāt yatprāṇādimattatsātmakaṃ prāṇādimaccedaṃ tasmātsātmakamiti prayukte dhūmasyāgninevāsya na vyāptirdṛśyate /
tatkathamityākāṅkṣāyāṃ prayogāntaraṃ pravartate /
prāṇādimattvaṃ sātmakatvena vyāptam tadabhāvavyāpakābhāvatvāt /
yo yadabhāvavyāpakābhāvaḥ /
sa tadvayāpto yathā dhūmo 'gnineti /
tadetāvati vaktavye yadanyathā prayujyate tadvivekināṃ sphuṭapratītikatayā saṅgraharucitayā veti /


*5,379f.*

syādetat /
vyāpyaṃ cedanumānaṃ tadā dhūmaḥ śabdānityatve 'pyanumānaṃ syāt /
vyāpto hi so 'pyagnineti /
maivam /
vyāpyamityasya sambandhiśabdatvāt /
tathāca yo yena vyāpyaḥ sa tasminnanumānamityuktaṃ syāt /
na caivamatiprasaṅgo 'sti /

dvividhā hi dharmā bhavanti /
kecitparasparaparihāreṇaiva vatarmānāḥ /
yathā kṛtakatvanityatve, svātantryapāratantrye cetyevamādayaḥ /
kecitsamāviṣyāḥ /
te 'pi trividhāḥ /
kecitsaṅkīrṇāḥ /
parasparaparihāreṇaiva vartamānayorekatra samāveśaḥ saṅkaraḥ /
yathā bhūtatvamūrtatve, puruṣatvapācakatve cetyevamādayaḥ /
kecitparāparabhāvāvasthitāḥ /
yathā sattvadravyatve, dhūmavattvāgnimattve cetyevamādayaḥ /
kecittulyavṛttayaḥ /
yathā kṛtakatvānityatve, gurutvarasavattve cetyā(tyevamā)dayaḥ /
tatrādyānāṃ parasparasambandha eva nāstīti nānumānānumeyabhāvaḥ /
viruddhasamākhyayā te 'bhidhīyante /
dvitīyānāmapi satyapi sambandhe parasparavyabhicāreṇa vyāpyavyāpakabhāvābhāvānnānumānānumeyatā /
kintu parasparamanaikāntikatayābhidhīyate /
tṛtīyeṣvapareṣāṃ vyāpyatayāpareṣāṃ vyāpakatayāstyanumānānumeyatvam /
pare tvavyāpyatayā nāpareṣvanumānatāmaśnute /
kinnāmānaikāntikā eva /
caturthāstu parasparaṃ vyāpyavyāpakabhāvādanyonyamanumānatāmarhantaḥ prasiddhayaprasiddhibhyāṃ viśiṣṭanta iti saṅkṣepaḥ /


*5,382*

nanvevamapi dhūmenāgnijñānaṃ sarveṣāṃ syādityata uktaṃ smṛteti /
pramitatvasyopalakṣaṇametat /
smṛtā vyāptireva pramitameva vyāpyamanumā /
na tvindriyavatsattāmātreṇa pramākaraṇamityarthaḥ /
nanu tathāpi nārikeladvīpavāsino dhūmadarśanādagnyanumitiprasaktiḥ /
maivam /
vyāpyasvarūpapramitivadvayāptipramiterapyapekṣitatvāt /
tathāpi gṛhī(tavismṛ)tāsmṛtavyāptestadavasthaḥ prasaṅga ityata uktaṃ smṛteti /
smṛtā vyāptireva sānumopayoginītyarthaḥ /
tathāca vyāptismaraṇasavyapekṣaṃ vyāpyajñānamanumānamityuktaṃ bhavati /


*5,383*

liṅgaparāmarśo 'numānaṃ parāmarśaścānusandhānātmakaṃ tṛtīyaṃ jñānamiti kaścit /
tathāhi /
mahānasādau dhūmasyāgninā vyāptigrahaṇasamaye yajjñānaṃ tatprathamam /
gṛhītavyāptikasya parvatādau yaddhūmajñānaṃ taddvitīyam /
tataḥ sambandhidaśarnasamudbuddhasaṃskārakāraṇa(ka)sya yo dhūmavānasāvagnimāniti vyāptismaraṇasyānantaramayaṃ cāgnivyāptadhūmavāniti pratisandhānātmakaṃ yaddhūmajñānaṃ tattṛtīyamanumānamiti /
tatetadanyo na manyate /
vyāptismaraṇaṃ pakṣadharmatājñānamityetāvadeva hyanumānasāmarthyam /
tatrānanubhūtāyā vyāpteḥ smartumaśakyatvātprathamaṃ jñānamiṣyate /
dvitīya(jñāna)mapi pakṣadharmatāviṣayatvādaṅgīkriyate /
tato vyāptismṛtau satyāṃ kimaparamavaśiṣyate yadarthaṃ tṛtīyaṃ jñānameṣyavyamiti /
sa sthūladṛśvetyādyaḥ /
na khalu sahakāritānupapatteḥ /
kintu saṅkalite /

naca tatsaṅkalitatvaṃ vinā tṛtīyajñānāditi kathaṃ tannaiṣyavyam /
ātmā saṅkalayatīti cet /
satyam /
vṛttyā hyasau saṅkalayenna tu svarūpeṇaiva /
nacaivaṃ tadevāstviti vācyam /
pūrveṇa vinā tadanupapatteriti /

vayaṃ tu brūmaḥ /
yatra liṅgadarśanādeva vyāptismṛtiḥ astu tatroktaprakāraḥ /
yadā tu gṛhītavyāptervināpi liṅgadarśanādvacanādinaiva vyāptismṛtirāvirasti yadā dvitīyameva liṅgadarśanaṃ pratisandhānātmakamudeṣyatīti nāvaśyambhāvinīyaṃ prakriyā /
yathā khalu saṃskārasāhitye satīndriyasannikarṣādeva so 'yamiti pratyabhijñā jāyate tathe(thātrāpī)tyaṅgīkāre na kaścidvirodha iti /


*5,386*

nanu vyāptireva kena pramāṇena grāhyā /
yathāyathaṃ pratyakṣānumānāgamairityuktam /
yathā caitattathā vakṣyāmaḥ /


*5,387*

dvividhamanumānaṃ svārthaṃ parārthaṃ ceti /
tatra yatparopadeśānupe(kṣya)kṣaṃ vyāptismṛtimadvayāpyadarśanaṃ tatsvārtham /
paropadeśāpekṣaṃ tu parārtham /
sasāmarthyaliṅgapratītijanakaṃ vākyaṃ paropadeśaḥ /
tacca pratijñāhetūdāharaṇopanayanigamanaiḥ pañcabhiravayavairupetamityeke /
tamimaṃ niyamamarocayamāna āha- ukteti //
uktā vyāptireva sānumā /
vyāptyuktireva paropadeśa iti yāvat /
evaśabdo niyamanirākaraṇaparo na punaḥ pakṣāntaranivṛttyarthaḥ /
pakṣāntarasya svayameva vakṣyamāṇatvāt /

nanu yo dhūmavānso 'gnimāniti vyāptyuktiḥ kathaṃ pratyāyanāṅgam /
vādiprativādinoranyonyasminnanāśvāsādityata uktaṃ smṛteti /
tuśabdaścaśabdārtho jijñāsiteti samuccinoti /
gṛhītavyāptestaduktiḥ smaraṇaheturagṛhītavyāptestu jijñāsājaniketyucyate /
na tvāgamatayopayujyata ityāśayaḥ /


*5,389*

nanu ca vyāptyuktireva paropadeśa ityayuktam /
prathamata eva vyāptyukterasaṅgatatvādityāśaṅkāṃ pariharan"uktā vyāptireva sā'; iti pratijñātamupapādayati- pratijñāteti //

pratijñātārthasiddhayarthaṃ vyāptireva yadoditā // MAnuv_2,1.31cd //
avaśiṣyaṃ kimatrāsti ... // MAnuv_2,1.32a //


NYĀYASUDHĀ:
pratijñātārthasiddhayarthamityasaṅgateḥ parihāraḥ /
tadetyadhyahāyarm /
kimākṣepe /
atra vaktavye /
etaduktaṃ bhavati /
yo hi parvatamagnimantaṃ pratipadyamānaḥ pareṇa niragnikaṃ manyamānena kiṃ parvatasyāgnimatve mānamityanuyujyate, sa yadi yo dhūmavānasāvagnimāniti vyāptimātraṃ (paraṃ prati) svapratipannārthasiddhayarthaṃ brūyāttadā kā nāmāsaṅgatiḥ /
parapṛṣṭapramāṇasyopanyasyamānatvāt /
kiṃvā (kiñcā)paraṃ vaktavyamavaśiṣyaṃ yadarthaṃ śabdānta(ramavaśiṣyaṃ)raṃ vaktavyaṃ syāt /
ato vyāptivacanameva paropadeśa iti /


*5,389f.*

syādetat /
vyāptipakṣadharmatopetatayā liṅgānusandhānaṃ khalvanumānam /
pakṣadharmatāmanaṅgaṃ manyamānairapi liṅgasya sattā tāvada(vaśyama)ṅgīkaraṇīyā /
anyathā vyāptyaṅgīkāravyāghātāt /
sā ca nāvivakṣitasthānā /
tathā sati yasyakasyaciddhūmavattvādinā sarva(parvata)syāpyagnimattvādiprasaṅgāt /
ato vyāptyanusāreṇa niyatadeśadharmatāpyaṅgīkaraṇīyaiva /
vyadhikaraṇo 'pi hi kṛttikāgata evodayo rohiṇyudayāsattiṃ gamayati /
natu yatratatratyaḥ /
tatastāvadanena vaktavyaṃ yāvatā vyāptivivakṣitasthaladharmatopetatayā liṅgasyānusandhānaṃ syāt tadapyākāṅkṣākrameṇābhidhātavyamiti sthite, nirāśrayasya pramāṇasyābhidhātumaśakyatvāt pramāṇajijñāsotthāpanāya viṣayopakṣeparūpaṃ parvato 'gnimāniti pratijñāvākyaṃ vaktavyam /
tataḥ kasmādidaṃ pramāṇātpratipattavyamityākāṅkṣāyāṃ parāṅgatāpannaliṅgasvarūpamātrapratipādakaṃ dhūmavattvāditi hetuvacanam /
tato 'sya sāmarthyajijñāsāyāṃ vyāptipratipādanāyā yo dhūmavānasāvagnimānityudāharaṇavākyam /
pakṣādivivakṣitasthaladharmatāpratipādanārthaṃ dhūmavāṃścāyamityupanayaḥ /
tataḥ sarvasya buddhayārohāyaikavākyatāmāpādayituṃ tasmādagnimāneveti nigamanam /
ata eva pratijñāhetubhyāmupanayanigamanayorgatārthatāṃ manyamānā nirastā bhavanti /
tadevametāvati vaktavye kathaṃ vyāptimātramuktvā kṛtī syāditi /


*5,390*

ucyate /
yattāvatpratijñāvaśyambhāve kāraṇamuktaṃ tadasat /
vivādenaiva viṣayopakṣepasya siddhatayākāṅkṣodayasya samarthitatvāt /
tathāpyākāṅkṣitatvālliṅgasvarūpasya tatpakṣadharmatāyāśca pratipādanāya hetūpanayau vaktavyāviti cenna /
vikalpānupapatteḥ /
tathāhi /
kiṃ yena dhūmavattvaṃ parvatavṛttitayāvagataṃ taṃ prati hetūpanayau vaktavyau, uta viparītaṃ prati /

ādyaṃ dūṣayati- liṅgamiti //
... liṅgaṃ tatra vijānataḥ // MAnuv_2,1.32b //

NYĀYASUDHĀ:
tatra vivakṣite sthale /
avaśiṣyaṃ kimastīti pūrveṇānvayaḥ /
liṅgasvarūpatadīyapakṣadharjñatāvijñāpanāya hi hetūpayanopayogaḥ /
taccedvijñānaṃ parasya svatassiddhaṃ tadā kiṃ hetūpanayābhyāmiti bhāvaḥ /

dvitīyamanūdya dūṣayati- yadīti //

yadi liṅgamasiddhaṃ syāt kuta evāsya mānatā // MAnuv_2,1.32cd //

NYĀYASUDHĀ:
tatretyanuvartate /
asiddhaṃ pareṇāprasiddham /
tadāsya liṅgasya svarūpāsiddhasya mānataiva kutaḥ /
nāstīti yāvat /
dūre vaktavyateti evaśabdārthaḥ /


*5,392*

nanvevaṃ sati vyāptirapi na vaktavyā /
sāpi yadi viditavyāptikaṃ pratyucyate tadābhidhānavaiyarthyam /
viparatītasya tu vyāpyatvāsiddhayā tatpramāṇameva na bhavati (iti)kuto vyāptyabhidhānamiti tatrāpi vaktuṃ śakyatvāt /
tathāca vādiprativādinormaunamevāpatitamiti /
maivam /
ubhayathāpyadoṣāt /
vyāptirhi na svarūpeṇopayoginī /
nāpi jñātatāmātreṇa /
api tarhi smaryamāṇā /
tathāca gṛhītavyāptikaṃ prati tasmārakatvena, (tayā) agṛhītavyāptikaṃ prati tu (tadaiva) tajjijñāsājanakatayā vyāptivacanamupayujyata ityuktameva /
evaṃ tarhi hetūpanayāvapi nānupayuktau /
nahi pakṣadharmopetaṃ liṅgaṃ svarūpeṇopayuktam /
nāpi viditatvamātreṇa /
kintu jñātacaram /
smaryamāṇatayā jñāyamānamapi na vṛkṣādisādhāraṇyena /
kintarhi liṅgatayā /
tathāca viditaliṅgasvarūpapakṣadharmatvaṃ prati tatsmārakatvena liṅgatayānusandhāyakatvenetaraṃ prati tajjijñāsājanakatvena hetūpanayayoḥ sārthakyamevetyāśaṅkayāha- yadīti //

yadi smārakamātraṃ syāt smarturnātra prayojanam // MAnuv_2,1.33ab //

NYĀYASUDHĀ:
smārakatvamuktasya sarvasyopalakṣaṇam /
mātragrahaṇena pratyāyakatvaṃ vyāvartayati /
hetvādikamiti śeṣaḥ /
pakṣadharmator(mo)petasya liṅgasyeti ca /
syādityataḥparaṃ tanna yata ityadhyāhāryam /
smarturityupalakṣaṇam /
atra vyāptivacane /
nimittasaptamīyam /
hetvādāviti ca /


*5,395*

tataśca vyāptivacanavaddhetvādikamapi pakṣadharmator(mo)petasya liṅgasya smaraṇānusandhānajijñāsājanakaṃ syāditi yadyucyate tanna /
yato vyāptivacanenaiva tatsmaraṇādimatastasya hetvādinā prayojanaṃ nāstīti yojanā /
etaduktaṃ bhavati /
yadi hi hetvādikaṃ vākyatayā pratyāyakaṃ syāttadā samārthyacintopayujyate /
yadā tu tatsmārakatvādinaivopayuktaṃ tadā saṃskārodbodhopayuktaṃ sādṛśyasambandhādikaṃ kimapyanve(pye)ṣyavyam /
tadvayāptivacane 'pi samānam /
yo dhūmavānasāvagnimānityabhihite khalvanumānamudrāvit atra dhūmavattvaṃ vyāpyamityavabudhyata eva /
tatastadīyapakṣadharmatādismṛtyādimānapi kathaṃ na bhavediti /


*5,397*

yadvā paropadeśasya pañcāvayavatāniyatiṃ vadanpraṣṭavyaḥ /
kimetatpañcāvayavaṃ vākyamāgamatayā vyāptipakṣadharmator(mo)petasya liṅgasya pratyāyakam /
uta smārakādimātram /

ādye tu syāde(vedaṃ)vaṃ paravyutpāditarītyā (vākyaparimāṇaṃ) vākyaṃ pramāṇaṃ kathañcit /
nacāsau yujyate /
vādipratavādinoritaretarasminnanāśvāsāt /
āśvāse vā pratijñāmātreṇārthasiddhau hetvādyabhidhānavaiyarthyāt /
dvitīye tvāha- yadīti //


*5,398*

parepadeśaṃ vākyaṃ yadi smaraṇādimātrakāraṇamaṅgīkriyate tadātra vyāptivacane satyeva smarturvyāptivacanādeva smaraṇādyutpatteriti yāvat /
atra vyāptivacanātirikte śabde prayojanaṃ nāstīti nāsāvavaśyaṃ vaktavyaḥ /
dṛśyate khalu loke padaikadeśādito 'pi padārthasmaraṇādikam /
śāstre 'pi ca vākyaikadeśaprayogaḥ /
tatra vakturāptatvāvadhāraṇādanusaraṇaṃ prativādini tu tannāstīti cenmā bhūt /
na hyetadāgamatayā pratyāyakamityaktam /
anyathā sāṃvyāvahārikaḥ kevalavyatirekiprayogo 'pi nānusaraṇīyaḥ /
vāstavaprayogaparimāṇānyathātvasyopapāditatvāt /
prativādinyapyanusaraṇe nigrahasthānodbhāvanaṃ na syāditi cet /
laukikaśāstrīyasaṃvyavahārātikrame tadavakāśāt /
anyathā prakaraṇādyāpannasyāsaṅkīrtanamapi nigrahahetuḥ syāt /
kiṃ prakaraṇādyāpannatayāyaṃ na vadatyutāpratipannatvādineti sandehasya prakṛte 'pi tulyatvāditi /


*5,402*

apara āha /
prameyāvadhāraṇārthaṃ hi pramāṇopanyāsaḥ /
prameyāvadhāraṇaṃ ca nirvivādā tatpratītiḥ /
naca sā pramāṇasvarūpamātropadarśane(na) bhavati /
kinnāma tadābhāsoddhāreṇāpi /
anyathā tatprāmāṇyasyaivānavasthānāt /
tathāca pratijñāvākyena viṣayamupakṣipya tatra hetunā pramāṇasvarūpamupadarśya tasyodāharaṇavākyena viruddhānadhyavasitānaikāntikatvanirāsaḥ kriyate /
upanayenāsiddhirapāsyate /
nigamanenāpi hetvanuvādena tasmādeva nānyasmāditi siddhasādhanatāpakṣipyate /
sādhyānuvādena (tu)agnimāneva na tu niragnika iti bādhapratipakṣapratikṣepaḥ kriyate /
tadevaṃ vidhūtavivādasādhyapratipattaye pañcāvayavavākyamāvaśyakamiti /
tadayuktam /
evaṃ vadatā hi ('pi) yāvatā vivādāvasānaṃ tāvānparopadeśa ityuktaṃ syāt /
tathāca pañcāvayavaṃ vākyaṃ paropadeśa ityayuktam /
pañcāvayavoktāvapi vivādāvasiterabhāvāt /
kintvākathāparisamāpteḥ paropadeśa iti vaktavyamityāśayavānāha- neti //

na pañcāvayoktau ca vivādāvasitirbhavet // MAnuv_2,1.33cd //

NYĀYASUDHĀ:
vivādādhyavasitiḥ vivādāvasānopetā sādhyapratītiḥ /


*5,403*

nanvetadayuktam /
udāharaṇādyavayavatrayeṇābhāsoddhārasya kṛtatvāt /
nirastasamastābhāsapramāṇopanyāse 'pi vivādānavasāne sarva(dā)thāpi tatprasaṅgādityata āha- dṛṣṭānteti //


*5,404*

dṛṣṭāntādiṣu caivaṃ syāt sādhanaṃ punareva hi // MAnuv_2,1.34ab //

NYĀYASUDHĀ:
dṛṣṭāntapadenodāharaṇārthamupalakṣayati /
ādipadenopanayanigamanārthagrahaṇam /
viṣayasaptamīyam /
evaṃ yathā pra(tijñā)tītārthe /
sādhanaṃ vaktavyamiti śeṣaḥ /
syādeveti sambandhaḥ /
tuśabdo yasmādityarthe /
ayamarthaḥ /
satyamuddhṛtābhāsātpramāṇātprameyāvadhāraṇaṃ bhavatīti /
kintu pañcabhirapyavayavaistādṛśapramāṇapratītireva na bhavatīti brūmaḥ /
ābhāsoddhāraparodāharaṇādyarthavipratipattau tatsādhanasyāpi vaktavyatvāt /
naca tatra vipratipattirna kartavyā /
nāpi vāṅmātreṇa tannivṛttiḥ /
pratijñārthasamānayogakṣematvāt /
nacodāharaṇādiṣveva sarvaśaṅkoddhārakāraṇamasti /
anupalambhāt /
pañcāvayavaprayoga eva kathāpudraṇāpātāt /
ataḥ prameyaniṇaryāvadhitve 'numānaprayogasya na pañcāvayavatvaniyamo yujyate /
api tu kathaparisamāptyavadhikatvamevāṅgīkāryamiti /


*5,405*

satyaṃ niḥśeṣato vivādanivṛttirna pañcāvayavaprayoge 'pi bhavatīti /
tathāpyavāntarākāṅkṣānivartakatvena pañcāvayavamevāvāntaravākyaṃ parisamāpyata ityata āha- liṅgeti //

liṅgoktāvapi caivaṃ syādanumāvasitirdhruvā // MAnuv_2,1.34cd //

NYĀYASUDHĀ:
co hetvarthe /
anumeti tatsambandhivākyamupalakṣyate /
evaṃ sati kimatra pramāṇamityavāntarākāṅkṣānivṛttihetau dhūmatvamiti liṅgoktau kṛtāyāmapi avāntaravākyaparyavasānamavaśyaṃ bhavatīti tanmātrameva vākyamaṅgīkaraṇīyam /
natu pañcāvayavatvaniyatiriti /


*5,406*

yaduktaṃ smaraṇādimātrahetutvena vākyasyopayogastacca vyāptivacanamātreṇa bhavatīti vyāptireva vaktavyeti tadayuktam /
tathā sati liṅgamātravacanasyāpi prayoktavyatvāpātāt /
sambhavati hi tasyāpi vyāptipakṣadharmatāsmaraṇādihetutvami(te)tyuktābhiprāyamajānānasya codyaṃ vā pariharati- liṅgeti //
yathā vyāptyuktāvevaṃ liṅgoktāvapyanumāvasitirdhruvā syāt /
iṣyāpādanametadityarthaḥ /
caśabdaḥ pratijñāhetugarbhaivetyādyuktapakṣāntarasamuccaye /
nacaivaṃ sati vyāptirevetyavadhāraṇānupapattiḥ /
yena yena prakāreṇa vyāptyādismaraṇādikaṃ bhavati /
yaśca sāṃvyāvahārikastaṃ tamupādāya niyamanirākaraṇasya tatreṣṭatvādityabhisandhiḥ /

etena pratijñāhetubhyāmupanayanigamanayorgatārthatāpi samarthitā veditavyeti /

// ityanumānalakṣaṇanirūpaṇam //


*5,407*


nirdoṣatāmantarbhāvya yuktiranumetyaktam /
doṣaparijñāna eva tadviyuktā yuktiḥ sujñānetyato yuktidoṣo nirūpaṇīyaḥ /
dhūmāderagnyādipramitijanakatve 'pi,yannimittaṃ kaścidartho 'rthāntarajñānaṃ na janayati, saṃśayaviparyayau vā karoti, sa yuktidoṣaḥ /
sa dvividhaḥ /
sākṣādvācanikaśca /
tatrādyaṃ vibhāgenoddiśati- virodha iti //

virodho 'saṅgatiścaiva sākṣād yuktestu dūṣaṇam // MAnuv_2,1.35ab //


*5,409*

NYĀYASUDHĀ:
prāyeṇānumānadoṣo virodha evāntarbhava(ntī)tīti prādhānyātprathamaṃ taduddeśaḥ /
eveti paraparisaṅkhayātamādhikyaṃ nirākaroti /
doṣāṇāṃ satāmatraivāntarbhāvāt /
anantarbhūtānāṃ ca doṣatvanirāsāt /
sākṣāditi //
vacanopadhānena vinā arthaniṣṭham (uktaṃ) uktayukteḥ sāmarthyam /
dūṣaṇaṃ tviti tuśabdasambandhaḥ, sākṣātviti vā /
yukteryuktitvābhimatasyārthasya /


*5,411*

sādhanābhimatasyārthasya sādhyābhimatenārthena sambhāvitapratītikasyāpi sādhyasādhanabhāvasya bādhalakṣaṇamayogyatvaṃ virodha iti śiṣyairevohyatāmityāśayavānasaṅgatiṃ nirūpayati- pratijñāyāmiti //

pratijñāyāmasambandho yukteruktā hyasaṅgatiḥ // MAnuv_2,1.35cd //

NYĀYASUDHĀ:
pratijñāpadena tadartho lakṣyate /
viṣayasaptamīyam /
asambandho 'trākāṅkṣālakṣaṇasambandhavirahaḥ /
atrāpi yukteriti gauṇo nirdeśaḥ /
asambandho 'saṅgatiriti paryāyāvityato vyavahārasādhyatāsūcanāyoktetyuktam /
virodhāsaṅgatisvarūpasya sphuṭatvādanyairupadarśitatvācca kimatrodāharaṇopadarśaneneti hiśabdenāha /


*5,413*

nanu kathaṃ dve evānumānadūṣaṇe paraparigaṇitānāmasiddhatvādīnāṃ bahūnāṃ sattvādityatasteṣāmatrāntarbhāvaṃ vibhāvayitu virodhavibhāgamāha- virodho 'pīti //

virodho 'pi tridhaiva syāt ... // MAnuv_2,1.36a //

NYĀYASUDHĀ:
sāmānyavibhāgena saha viśeṣavibhāgasya samuccaye apiśabdaḥ /
asaṅgatirapyanekavidheti vā tridhaiva na tvekavidhaiva yenāsiddhayādīnāmantarbhāvo durghaṭaḥ syāt /
yadvā yāvanto 'numānābhāsāḥ paraparigaṇitāstāvadbhedatāṃ ni(rākartu)vataryitumevaśabdaḥ /
sarveṣāmatraivāntarbhāvāt /

traividhyaṃ darśayati- pratijñārtheti //


*5,414*

... pratijñārthaviruddhatā /
liṅgarāhityamavyāptir ... // MAnuv_2,1.36bc //


NYĀYASUDHĀ:
sādhyadharmaviśiṣṭo dharmī pratijñārthaḥ /
tasya pratispardhisadbhāvo viruddhatā /
yatrārthe liṅgapramitiḥ sādhyasiddhayupayoginī tatra tadabhāvo liṅgarāhityam /
vyāpterabhāvo 'vyāptiḥ /
itiśabdo 'dhyāhāryaḥ /


*5,415*

sādhyasādhanabhāvasambandhayogyatāviraho hi sādhyasādhanābhimatayostadbhāvāsambhave bhavati /
naca sādhanasya tadbhāve 'pi viruddhasya sādhyatā sambhavati /
niśitatve 'pi paraśorākāśasya chedyatābhāvāt /
nāpi sādhyasya tathātvasambhave 'pyasamarthasya

sādhanatopapadyate /
chedyatve 'pi kāṣṭhasya kuṇṭhakuṭhārasya chedana(ka)tvābhāvāt /
ataḥ pratijñārthaviruddhatādīnāṃ yuktaṃ virodhitvam /


*5,416f.*

astu liṅgarāhityāvyāptyoryuktidoṣatvam /
pratijñārthaviruddhatā tu kathaṃ taddoṣaḥ /
sādhyasambandhitvāditi cenna /
sādhyābhimatasya tadbhāvāsambhave sādhanābhimatasyāviṣayavṛttitvāt /
nanvevaṃ sati siddhasādhanatāpi virodha eva syāt /
nahi siddhasya sādhyatā sambhavati /
nacāstviti vācyam /
uktaprakāratrayānantarbhāvāt /
siddhasādhako 'saṅgata iti svavacanavirodhācceti /
maivam /
sati sākāṅkṣatve 'nvayāyogyatvaṃ virodhaḥ /
naca siddhasādhanasya sākāṅkṣatā astīti nāsau virodhe 'ntarbhavati /


*5,418f.*

nanu cānyatra trividho virodha ityādinā liṅgarāhityāvyāptyorekatāmupādāya sādhyasya sādhanasya vānugamo dṛṣṭāntavirodhastṛtīyatayā parigṛhītaḥ /
atrāpi sādhyasādhanavaikalyaṃ dṛṣṭāntasyeti vakṣyati /
tatkathametat /
nacātrāpi tadadhyāhāreṇa tathaiva vyākhyānaṃ yuktam /
dṛṣṭāntadoṣasyānumānadoṣatānupapatteḥ /
nahi dṛṣṭānto 'numānam /
tathāpyanumānāṅgavyāptidūṣakatayānumānadoṣatvamastu /
dṛṣṭāntasya sādhyavaikalye sādhanasya sādhyaparityāgāt /
sādhanavaikalye tu vyāpteranupadarśanāditi cenna /
tathā satyavyāptyaiva saṅgṛhītatvena tṛtīyatvānupapatteriti /
ucyate /
svārthānumāne hi dṛṣṭavyāptikasya liṅgasya vivakṣitasthale siddhimātreṇa sādhyapramitirutpadyata iti tatparipanthināṃ doṣatvamabhipretya pratijñārthaviruddhatāliṅgarāhityāvyāptīnāmatra grahaṇam /
parārthānumāne('pya)tvavyāptyaupayikasyāpi dṛṣṭāntadoṣasya tadāśrayatayā pratītatvena tathaivodbhavanīyatājñāpanāya tena saha trividhatvamanyatroktamiti na virodhaḥ /


*5,420*

yadvā sādhyasādhanobhayāśrayahīnasādhyasādhanobhayavyāvṛttāśrayahīnānaṣṭau dṛṣṭāntadoṣāneke bhāṣante /
tannirāsāya dṛṣṭāntadoṣasya pṛthagupādānam /
tathāhi ubhayavikalastāvanna parisaṅkhayeyaḥ /
anyataravaikalyenaiva (dṛṣṭānta)duṣyatāsiddhāvādhikyaprasaṅgāt /
anyathaikaikavikalaparisaṅkhayānānupapatteḥ /
kathaṃ tarhyanvayavyatirekīti cet /
na kathañcidityuktameva /
sādhyādyavyāptistu dṛṣṭāntasya guṇa eva na doṣaḥ /
sato hi satā vyāptiṃ pradarśayituṃ dṛṣṭānto 'nveṣyavyaḥ /
vaidharmyadṛṣṭāntasyāyaṃ doṣa iti cetsa eva kimarthaḥ /
vyatirekavyāptibodhayeti cenna /
tasyāḥ sākṣādanupayogāt /
pāramparyeṇopayogo tu sādharmyadṛṣṭānta evāsāviti kiṃ pṛthagupādānena /
ubhayāvyāvṛttaścādhikyānni(kyani)rastaḥ /
āśrayahīnastvāśrayāsiddhisamānayogakṣema iti dvāveva dṛṣṭāntadoṣau /
asārvatrikaśca dṛṣṭāntadoṣaḥ /
nahi sarvatra dṛṣṭānta eva vyāptirupadarśanīyetyasti niyamaḥ /
ānumānikāgamikavyāptestadanapekṣaṇāt /


*5,423*

syādetat /
pratijñārthaviruddhatayā hi kālātītaprakaraṇasamau saṅgṛhītau /
liṅgarāhityamityasiddhiḥ /
avyāptiśca trividhā bhavati /
sādhanasya sādhyena sambandhābhāvaḥ /
satyapi sambandhe tadabhāvenāpi sambandhaḥ, sādhyābhāvavyā(pta)pyatā ceti /
tadetattrayaṃ krameṇānadhyavasitā naikāntikaviruddhasaṃjñāṃ labhate /
tathāca paranirūpitaprastārasya samasanamevānena kṛtaṃ syāt /
nacānena kimapi prayojanam /
anyathā puruṣamativaiśvarūpyeṇa prakriyāntarasyāpi sāvakāśatvāt /
naca brahmatarkāditarkaśāstramanusṛtyetthaṃ vyutpādanamiti vācyam /
prayojanābhāve 'ndhaparamparāpatteriti /


*5,423f.*

ucyate /
asti prakriyāntarakaraṇasya prayojanam /
tathāhi /
pratijñārthaviruddhatayā hi svavākyavirodhasyāpi saṅgrahaṃ vakṣyati /
naca kālātītatvādinā sa labhyate /
api ca vyavahāro 'pi pratijñārthaviruddhatayopapadyate, na kālātītatvādinā, vaiyarthyaprasaṅgāt /
asādhakamidaṃ kālātītatvāt /
satpratipakṣatvādityasya prabalasamabalapramāṇaviruddhatvādityarthaḥ /
nacātra viśeṣaṇasya kimapi prayojanamasti /
hīnabalasya pramāṇapadenaiva nirastatvāt /
pramāṇatadābhāsāviveka eva hi pramāṇaśabdaprayogo na tvaprāmāṇyaniścaye /
ahīnabalatayā vā viśeṣaṇe sambhavati tadavāntarabhedopādānaṃ niratharkameva /
tathācaikamevedaṃ dūṣaṇaṃ syāt /
liṅgarāhityagrahaṇena cādūṣaṇānāmapi dūṣaṇatayā paraparigaṇitānāmāśrayavyadhikaraṇasādhyānyathāsiddhīnāṃ nirāso labhyate anyathāsiddherdūṣaṇatve 'pi prakārāntasya vakṣyamāṇatvāt /
Vyāsa-(13)


*5,427*

anadhyavasitatvādibhedo 'pi kiṃ vyāptyabhāve sambhavatītyetāvatā parisaṅkhayeyo vyavahāropayogitvādvā /
nādyaḥ /
vyarthavyutpādanasyātiprasaṅgitvāt /
na dvitīyaḥ /
vaiyarthyaprasakteḥ /
nedaṃ sādhakamanaikāntikatvādityasya hi sapakṣavṛttitve sati vipakṣavṛttitvādityarthaḥ /
nacātra viśeṣaṇavyavacchedyaṃ kiñcidasti /
evaṃ viruddhatvādityasya sapakṣāvṛttitve sati vipakṣavṛttitvādityarthaḥ /
tathāca vaiyarthyameva /
sādhyaviparyayavyāpyatvādityatrāpi sambandhamātreṇa kṛtārthatve vyāptigrahaṇaṃ vyarthameva /
evamavāntarabhedavyutpādanamapi nirastam /
śiṣyamativaiśadyāya vyutpādanaṃ tvanumatameveti na svīyavyavahāravirodha iti /
virodhavadasaṅgaterapi prabhedāḥ svayamevohanīyāḥ /


*5,429*

evaṃ sākṣādyuktidoṣamabhidhāya vācanikadoṣamāha- nyūneti //

... nyūnādhikye tu vācike // MAnuv_2,1.36d //

NYĀYASUDHĀ:
nyūnaśabdo bhāvapradhānaḥ /
yukterdūṣaṇamiti prakṛtamanuvartate /
avaśyavaktavyāparipūrtirnyūnatvam /
kṛtakāryatvamādhikyam /
vacanadoṣāttatpratipāditā yuktirapi duṣyā syādityetayorvācanikatvam /

nanvayukto 'yaṃ vibhāgaḥ /
virodhāsaṅgatyorapi vāci(cani)katvāt /
nahi kṛtakatvaṃ svayameva duṣyam /
anityatvasādhane 'pi tathātvāpatteḥ /
kṛśānuśaityādau tatheti cet /
tatkiṃ kṛtakatvaṃ kṛśānuśaityaṃ vā śabdanityatvaṃ vā sādhayituṃ svayameva pravṛttam /
yena tatra duṣyaṃ syāt /
kinnāma tatsādhanatayā śabdena pratipādi(darśi)tam /
evamasaṅgatāvapi siddhasādhanatādilakṣaṇāyāṃ vācyamityāśaṅkānirāsārthaṃ tuśabdaḥ /
nyūnādhikye eva vācanike, na virodhāsaṅgatī /
svārthānumāne 'pi darśanāditi bhāvaḥ /
santu tarhi pratipattṛpratipādakayorevaite doṣāḥ /
yathā niśātam kṛśānuśaityādau vyāpārayanpuruṣa evāparādhī syāt natu kṛtakatvādikamiti /

maivam /
kṛtakatvāderaduṣṭatve tadvayāpārayato 'pyaparādhānupapatteḥ /
anyathā śabdanityatvasādhane prayuñjāno 'pyaparādhyeta /
tataḥ kṛśānuśaityādeḥ sādhyatānarhatvaṃ nityatvādisādhane kṛtakatvāderasamarthatvamityādirarthaśabdagata eva doṣo 'ṅgīkaraṇīyaḥ /
na hyupādhimantarbhāvya bhavan doṣo na doṣo bhavati /
tathā sati bahuviplavāpatteriti /


*5,433*

nanu kathameta evānumānadoṣāḥ /
sopādhikatvasyāpyatiriktasya sattvādityatastatsvarūpānuvādenoktāntarbhāvamāha- sādhyeti //

sādhyavyāpakavailomyamavyāptiḥ sādhanasya ca // MAnuv_2,1.37ab //

NYĀYASUDHĀ:
sādhanasya yatsādhyavyāpakavailomyaṃ sāvyāptiḥ /
caśabdātsatpratipakṣatā ca /
sādhyasyādharmasādhanatvādervyāpako yo niṣiddhatvādidharmaḥ /
yatrādharmasādhanatvaṃ tatra niṣiddhatvamiti niyamāt /
tena sādhanasya hiṃsātvādervailomyaṃ sādhyāpekṣayā vaiparītyamavyāptatvamiti yāvat /
yatra hiṃsātvaṃ tatra niṣiddhatvamiti niyamābhāvāt /
vaidhahiṃsāyāṃ satyapi hiṃsātve niṣiddhatvābhāvāt /
tadanena sopādhikatvasya svarūpamuktam /
sādhyavyāpakatve sati sādhanāvyāpako hi dharma upādhiḥ, tadvattvaṃ ca sādhanasya sādhyavyāpakāvyāpyatvameva /

etatprāganumānādvayāptigrahaṇavelāyāmavyāptireva /
sādhyavyāpakaṃ parityajataḥ sādhyaparityāgāvaśyambhāvāt /
nahi sādhyamaparityajan tadvayāpakaṃ parityajatīti yujyate /
sādhyaparityāgaścāvyāptireva /


*5,434*

apare tu nirupādhikaḥ sambandho vyāptiḥ /
sopādhikatve tu lakṣaṇābhāvādvayāptyabhāva ityācakṣate /
tadasat /
vyāptijñānādhīnamupādhijñānaṃ tadadhīnaṃ ca nirupādhikatvajñānaṃ tadāyattaṃ vyāptijñānamiti cakrakaprasaṅgena tasya vyāptilakṣaṇatvānupapatteḥ /
tatkiṃ sāpādhikasyāpyasti vyāptiḥ /
maivam /
vyāptatvānupādhikatvayoḥ samaniyame 'pi vyāptibodhānaṅgatayopādhyabhāvasya lakṣaṇatvānupapatteruktatvāt /


*5,435*

nanvevaṃ cetkathaṃ sādhyasādhanavyavahāraḥ /
āgāmisambhāvanāpekṣayeti brūmaḥ /
vastutastu yo dharmo yadvayāpakāvyāptastasya tenāvyāptirityeva vaktavyam /
anumānapravṛttyuttarakālaṃ tu satpratipakṣataiva /
sādhanasya sādhyavyāpakaparityāgo hi pakṣādanyatra vā syātpakṣe vā /
na tāvadādyaḥ /
tathā sati sphuṭavyabhicāraparityāgenopādhyudbhāvanasyānavasaratvāt /
dvitīye tu sādhyavyāpakasya pakṣādvayāvṛttiḥ sādhyamapi vyāvartayatīti satpratipakṣataiva /

etenopādhyabhāvasya pratipakṣatve nopādherdūṣaṇatvam /
nahi yadabhāvo yatra dūṣaṇaṃ so 'pi tatra dūṣaṇamiti yukta virodhāditi parāstam /
pakṣavyāvṛttiprādhānyenaivopādhitvāt /
etadarthaṃ ca sādhyavyāpakasya vailomyaṃ pakṣādvayāvṛttiḥ sādhanasya satpratipakṣateti yojanīyam /
bhāvapradhānasyādoṣatvaṃ tviṣyameva /


*5,436f.*

nanu ca prāganumānādapi satpratipakṣatānumānottaramavyāptirvā kinna syāt /
maivam /
pakṣe hi sādhyasyopasaṃhāre pratipakṣāvasaraḥ /
naca vyāptigrahaṇasamaye pakṣādipravibhāgo 'stīti kathaṃ tadā pratipakṣatvaṃ syāt /
anumānottaramavyāptiḥ kathamiti vaktavyam /
sādhyavyāpaka upādhiḥ pakṣādvayāvartamānaḥ sādhyamapi vyāvartayati /
tathāca sādhyarahite tatra vartamānaṃ sādhanaṃ sādhyaṃ vyabhicaratīti cenna /
tathā sati bādhitasatpratipakṣayorapi vyabhicāritāpātāt /
omiti cenna /
nirasiṣyamāṇatvāt /
bādhapratipakṣābhyāmevānumānadūṣaṇasambhave kiṃ tadupajīvinā vyabhicāreṇeti cet, tarhi vyāpakavyāvṛttyā pratipakṣeṇaivānumāne dūṣite kiṃ tadupajīvinā vyabhicāreṇeti tulyam /


*5,437*

kiñca pakṣe vyabhicāraḥ kiṃ niścita uta sandigdhaḥ /
nādyaḥ /
vikalpānupapatteḥ /
tathāhi /
pakṣe sādhyābhāvo niścito na vā /
ādye kiṃ pramāṇāntareṇota sādhyavyāpakopādhivyāvṛttyā /
prathame tata evānumānaṃ duṣyamiti kimupādhinā /
na dvitīyaḥ /
parasparāśrayatvaprasaṅgāt /
upādheḥ sādhyavyāpakatvaniścaye tadvayāvṛttyā sādhyavyāvṛttiniścayaḥ sati ca tasminnasāviti /

neti pakṣe sādhyavyāpakatvāniścayāt upādheḥ, kathaṃ tadvayāvṛttyā pakṣe sādhanasya niścito vyabhicāraḥ syāt /
pakṣe sandigdho vyabhicārastu svata eva siddho sopādhimukhanirīkṣaṇāpekṣaḥ /
sarvānumānocchedahetuśca /
tasmādanumānottarakālaṃ satpratipakṣataivetyucitam /
etadevābhipretya"sa evopādhidoṣo 'pi'; ityādivacanāt /


*5,439*

anukūlatarkādinā sādhyavyāpakatvaniścaye sati pakṣe niścitavyabhicāritāsiddhiriti cenna /
niścisādhyavyāpakavyāvṛtterbādhakatvena tata evānumāne dūṣite vyabhicāravaiyarthyāt /
tathāpi sopādhikatvaṃ satpratipakṣatvamiti gataḥ pakṣa iti cenna /
pratipakṣasya yāvajjīvaṃ tadbhāvānaṅgīkārāt /
sāmarthyānirdhāraṇāyāmeva satpratipakṣaḥ, nirdhārite tu sāmarthye bādhako vā syāt, bādhyo veti ko nāma nābhyupaiti /


*5,440f.*

atra sopādhikatvamiti vaktavye sādhyavyāpakavailomyamiti vacanamupādhilakṣaṇasyāpi pradarśanārtham /
tadapi sādhyasamavyāpakatvapakṣanirāsāya /
nanveṣa pakṣaṣṭīkākṛtāṅgīkṛtaḥ /
maivam /
paramatānuvādatvāt /
anyathaikasādhyāvinābhāva ityudayanavacanodāharaṇavaiyarthyāt /
dūṣaṇaṃ tu sphuṭatvānnoktam /
tathā hi /
samapadaṃ kiṃ viṣamavyāptikavyavacchedārthamuta prayojanāntarārtham /
nādyaḥ /
pārthivaparamāṇurūpādayo nityāḥ paramāṇuviśeṣaguṇatvāt āpyaparamāṇurūpādivadityādau pṛthivīviśeṣaguṇatvābhāvāderviṣamavyāptikasyāpyupādhitvena tadvayavacchedasyāyuktatvāt /
pratipakṣonnāyakatvasambhavena dūṣaṇatvācca /
viṣamavyāptikasyopādhitve pakṣetaratvasyāpi tatprasaṅga iti cet /
tatkimuktaviśeṣaṇadvayopetaṃ na vā /
neti pakṣe tata evānupādhitvam /
ādye tu tasyāpyupādhitve ko doṣaḥ /
parvatetaratvādeḥ sarvatra sambhavena naivamiti cenna /

anumānavyāptyādigrāhakapramāṇaprābalye sati sādhyavyāpakatvabhaṅgāt /
tadabhāve cānumānabhaṅgasyeṣṭatvāt /
anyathā śabdo 'bhidheyaḥ prameyatvādghaṭavadityādāvaśabdatvādeḥ samavyāptikapakṣetarasyānirāsaprasaṅgāt /
tadidamiṣyamapi tyajati aniṣyamapi gṛhṇātīti na viśeṣaṇam /


*5,445f.*

yadapyayuktam /
"svasambandhena yaḥsvīyaṃ dharmamanyatra yojayet /
sa upādhiryathā loke japādiḥ sphaṭikādiṣu /
ihāpyavyāpyahetvarthavyāpyatvabhramahetutā /
upādheḥ syāttadā tasya samavyāptiryadā bhavet'; iti /
tatra vaktavyam /
kimanenoktaṃ bhavati /
kiṃ viṣamavyāptikasya vyāpyatvābhāvāttatsambandhena sādhanābhimate vyāpyatābhramānupapatteradoṣatvena tadvayavacchedāya samapadamiti, kiṃvānvarthopādhiśabdasampādanārthamiti /
nādyaḥ /
pratipakṣonnāyakatvena dūṣaṇatvasambhave svagatavyāptyavabhāsakatābhāvasyādoṣatvāt /
sādhyasāhacaryadarśanenaiva vyāpyatābhramasambhavācca /
na dvitīyaḥ /
upādhiśabdasambandhasya svakapolakalpitatvāt /
ata eva bhagavānācāyarvaryaḥ sopādhikatvamityanabhidhāya sādhyavyāpakavailomyamityāha /
vyavahārāstu parakṛtasaṅketenāpi nirvahaṇīyaḥ /
yadvā kvacitsādhyavyāpyatāsadbhāvenopādhitve 'nyatrāpi gauṇyā vṛttyā upādhivyavahāropapattiḥ /
ata eva na dvitīyo 'pi /


*5,449f.*

nanu ca viṣamavyāptikasya pratipakṣonnāyakatvaṃ na sambhavati /
kvacitpakṣetaraviparyayasyāsādhāraṇatvāditi /
maivam /
asādhāraṇatvasya dūṣaṇatvāsammateḥ /
sammatau vā tatropādhitvābhāvasya vyutpādanāt /
yatropādhiḥ pakṣaikadeśādvayāvartate tatra kathaṃ pratipakṣaḥ /
bhāgāsiddhiprasaṅgāt /
nacāsau nopādhiḥ /
pakṣaikadeśādvayāvṛttyāpi sādhanāvyāpakatvasambhavāt /
nacāyaṃ samavyāptipakṣe 'sti doṣaḥ /
upādhimatyekadeśe sādhyasadbhāvaniyamena taṃ vihāyaikadeśāntarasyaiva pakṣīkaraṇaucityāditi /
ucyate /
asmābhirapyupādhivyāvṛttimā(nevaika)nekadeśaḥ pakṣīkriyate /
ekadeśāntare 'pi yadi sādhyasammatistadā tasyāpakṣīkaraṇameva /
asammatau tu tatra doṣāntarameva bhaviṣyatīti kimanupapannam /

nanu śaṅkitopādhau kathaṃ pratipakṣaḥ sandigdhāsiddhiprasaṅgenāsamabalatvāditi cenna /
pākṣikasiddhayādinā satpratipakṣatāphalasya saṃśayasyānivāraṇāt /
saṃśayānaṅgatvamevāsamabalatvamabhipretam /


*5,453*

syādetat /
sādhyavyāpakatve sati sādhanāvyāpakatvaṃ kimupādhisāmānyalakṣaṇaṃ kiṃvā viśeṣalakṣaṇam /
nādyaḥ /
samavāyaḥ samavetaḥ sambandhatvātsaṃyogavadityatra sādhanāvacchinnasādhyavyāpakakṛtakatvopādhyavyāpanāt /
vāyuḥ spārśano 'nudbhūtarūpānadhikaraṇatve satyupalabhyamānasparśādhikaraṇatvādghaṭavadityatra dravyatvāvacchinnasādhyavyāpakacākṣuṣatvopādhyavyāpteśca /
naca sādhanāvacchinnasādhyavyāpakasya yatkiñcidavacchinnasādhyavyāpakasya ca nopādhitvamiti vācyam /
tatra tatrācāryairaṅgīkṛtatvāt /
vyatirekopādhyavyāpakatvācca /
na dvitīyaḥ /
sāmānyalakṣaṇāntarasya vaktavyatāpātāt /
na cānvayavyatirekidharmatvaṃ taditi vācyam /
tasyātrāyamupādhiriti vyavahārakāraṇatvābhāvāt /
tathātve ca lakṣaṇavaiyarthyāditi /


*5,458*

atra brūmaḥ /
idameva sāmānyalakṣaṇam /
sādhyapadenāvacchinnānavacchinnasādhyasyābhidhānāt /
naca tatra pratipakṣāsambhavaḥ /
yadavacchinnasādhye ya upādhistadvayāvṛttestadviśiṣṭābhāve hetutvopapatteḥ /
yathā samavāyaḥ sambandhatve sati samavetatvena hīno 'kāryatvādākāśavat /
vāyurdravyatve sati spārśanatvena hīno 'cākṣuṣatvādākāśavaditi /


*5,460*

nacātra sādhyaviśeṣaṇavaiyarthyam /
śabdo na sparśavadviśeṣaguṇaḥ pratyakṣatve satyakāraṇaguṇapūrvakatvādityādāviva vyabhicāraparihārārthatvāt /
kvacitsādhyāvacchedakāvacchinnasyopādhyabhāvasya hetutvāt /
yathā vāyuḥ spārśano na bhavati dravyatve satyacākṣuṣatvāditi /
vyatirekavyāptau tūktamevottaram /
sādhyasādhanapadābhyāṃ ca prakṛtayoreva vivakṣitatvānna kaścitkṣudropadravaḥ /
yo yatsādhyavyāpako yatsādhanāvyāpaka iti vāsyārtha iti sarvaṃ sustham /


*5,467*

nanu ca sopādhikatvasya satpratipakṣatve 'pi tenaivānumānadoṣādhikyamiti /
maivam /
pratijñārthaviruddhatetyanenaiva prabalapramāṇaviruddhatālakṣaṇakālātīta(tā)vatsamabalapramāṇaviruddhatāyāḥ satpratipakṣatāyā api saṅgṛhītatvāt /
pratispardhisadbhāvamātraṃ hi pratijñārthaviruddhatetyuktam /
evaṃ tarhi durbalena virodho 'pi pratijñārthaviruddhatā syāt, uktalakṣaṇopetatvādityata āha- durbaleneti //

durbalena virodhe 'pi na pramāṇamasādhakam // MAnuv_2,1.37cd //

NYĀYASUDHĀ:
ayamarthaḥ /
prakaraṇādivaśāddhi sāmānyaśabdā api viśeṣe vatarnta iti prasiddham /
yathā viśiṣṭasamaye puruṣamānayetyukte puruṣaviśeṣa evānīyate na tu yaḥ ko 'pi puruṣaḥ /
prakṛte cānumānasyāsādhakatvanimittaparisaṅkhayānam /
naca durbalena virodhe 'pyanumānamasādhakaṃ bhavati /
prabalavirodhādinā tasyaivābhāsatvāt /
yathā vimataścakṣuṣmānrūpāparokṣajñānitvādityatra vimato 'ndhaḥ puruṣatvāditi /
ataḥ sāmānyaśabdaprasakto 'pi durbalena virodho (nānumānasādhyakatāvacchinnapra) na prathijñārthaviruddhatā /
kintu prabalasamabalapramāṇaviruddhataiva (iti) /


*5,469*

nanvevamādhikyanirāse 'pi nānumānavirodhatraividhyaṃ sambhavati /
pratijñāvirodhasyāvyāptyaiva gatatvāt /
virodhenaiva sādhyavirahiṇi pakṣe vartamānasya hetorarvyāptibharvati /
nahi viredhasyāvyāptyasaṅkīrṇamudāharaṇamasti /
yatra tu virodhasambhavastatrāvyāpterevānyatrāvadhṛtasāmarthyāyā dūṣaṇatvāt /
virodhasyāvyāptyutthāpanena caritārthatvādityāśaṅkāṃ bhikṣu(ka)pādapra(sāraṇanyāyena)sāraṇena pariharati- svavākyeneti //

svavākyena virodhe 'pi naiva sādhakatāṃ vrajet // MAnuv_2,1.38ab //

NYĀYASUDHĀ:
pramāṇamityanuvartate /
na kevalaṃ pramāṇavirodhe, kintu svavākyena virodhe 'pi pramāṇaṃ naiva sādhakatāṃ vrajet /
evaśabdena pareṣāmapi siddho 'yamartha iti darśayati /
yathoktam /
avirodhigrahaṇātpratyakṣānumānagamasvaśāstrasvavacanavirodhino nirastā iti (bhavanti iti) /


*5,472*

etaduktaṃ bhavati /
pratijñārthavirodho dvedhā bhavati /
pramāṇavirodhaḥ svavākyavirodhaśceti /
tatrādyaḥ prabalasamabalapramāṇavirodhātmā dvividho bhavati /
dvitīyo 'pyapasiddhāntajātibhedena dvedhā /
jātiśca svavacanavirodhasvanyāyavirodhasvakriyāvirodhabhedena tredhā /
tatrāstāṃ tāvatpramāṇavirodhaḥ /
svavākyavirodhagrahaṇaṃ tāvatpṛthakkaraṇīyam /
tasyāpyavyāptyutthāpane vyāpārāyogāt /
svavākyavirodhe hi kiṃ sādhanasyobhayābhimatyā (pakṣe) vyabhicāro bhavet, kiṃvānyarābhimatyā /
nādyaḥ /
svavākyaprāmāṇyasyobhayāsammateḥ /
na dvitīyaḥ /
tasya svataḥsiddhatvena svavākyavirodhānapekṣatvāt /
adoṣatvācca /
tasmādaviṣayavṛvi(tāhetu)tvena pratijñārthaviruddhatā pṛthageva patisaṅkhayātavyeti /

kiñcāyaṃ na kevalaṃ vyāptyapekṣapravṛtteranumānasyaiva doṣaḥ /
kinnāma tadanapekṣasya pratyakṣāderapi tathā cānyatropalabdhasāmarthyasyānumāne 'pi svātantryasiddhirityāśayavatā prastāvādanumānamiti vaktavye pramāṇamityevādhikṛtam /


*5,475*

etenaitadapi (parā)nirastam /
astu svavākyavirodhasya pṛthagdoṣatvamavyāptyutthāpakatvāyogāt /
bādhapratirodharūpaḥ pramāṇavirodhastu na svatantradoṣaḥ /
pramāṇavirodhe hi heturapakṣadharmo vā syāt anaikāntiko vā (syāt) /
jijñāsitadharmaṇo dharmiṇaḥ pakṣatvāt /
pramāṇāvagatasādhyaviruddhadharmavataścāpakṣatvena taddharmasyāpakṣadharmatvaniyamāt /
sādhyadhar(ma)rmiṇyeva pramāṇopasthāpitasādhyadharmaviruddhadharmavati darśanena vyabhicārāt /
naca sapakṣavipakṣāvevānvayavyatirekagamyāvinābhāvadarśanaviṣayau na pakṣa iti sāmpratam /
yadi hi pakṣaṃ vihāya bahirevāvinābhāvo 'vagamyate tadā bahirvyāptibalena pakṣadharmo 'pi heturna pakṣe sādhyaṃ sādhayet /
asiddhā hi tatra tasya sādhyena vyāptiḥ /
tasmādantarbahirvā sarvopasaṃhāreṇāvinābhāvo 'vagantavyaḥ /
evañca siddhaḥ pakṣe vyabhicāraḥ sādhanadharmasya /


*5,477*

nanu pratirodhe katham /
tatrāpi vyāptigrāhakasya pramāṇasya prābalyam /
ubhayatrāpi pramāṇasadbhāve vyāpyatvāsiddhāvantarbhāvāditi /
pramāṇavirodhasya pramāṇāntare 'pyaviṣayavṛttitāhetutvenāvagatasvatantradūṣaṇabhāvasyānumāne 'pi tathaivāṅgīkartumucitatvāt /

api ca kiṃ vyāptigrahaṇasamaye 'vyāpterupasthāpakaḥ pramāṇavirodhaḥ syāt, utānumānapravṛttyuttaramapi /
ādyastviṣyata eva /
"mānabādhe na tadbhavet'; iti vakṣyamāṇatvāt /
na dvitīyaḥ /
upajīvyaparityāgenopajīvakasvīkārasyāyuktatvāt /
pramāṇaviruddhasyāpakṣadharmatve siddhasādhanasyāpi tathātvaṃ syāt /
samānanyāyatvāt /
omiti cenna /
svārthānumāne 'pi siddhasādhanasya doṣatvāpatteḥ /
nahi pakṣadharmatāsiddhiḥ parārtha evānumāne doṣaḥ /
tasmāt parānākāṅkṣitatvādasaṅgata eva siddhasādhana iti /

// ityanumānadoṣanirūpaṇam //


*5,479*

evamanumānadoṣānnirūpya prasaṅgātparanirūpitāśeṣanigrahasthānānāmapi virodhādiṣvevāntarbhāva ityāha- saṃvādeti //

saṃvādānuktisaṃyuktā eta eva ca nigrahāḥ // MAnuv_2,1.38cd //


*5,479f.*

NYĀYASUDHĀ:
nigṛhyate parājīyate ebhiriti nigrahāḥ nigrahasthānāni /
nanu ca pratijñāhānyādīnāṃ vaktṛdoṣāṇāṃ kathamarthavacanadoṣeṣu virodhāsaṅgatinyūnādhikyeṣvanupraveśa ityata uktam- saṃvādānuktisaṃyuktāṃ iti //
tathāpyanupapattireva /
virodhādicatuṣyayasyānumānadoṣatvenoktatvāt /
nigrahasthānānāṃ ca niyamenānumānāśrayatvābhāvāt /
nahi punaruktiranumāna eva sambhāvinī /
praśnādāvapyupapatterityato 'styatra viśeṣa iti tuśabdenāha /
dvividhaṃ hi virodhādicatuṣyayam /
samayabandhādikathāsarvarūpasādhāraṇamasādhāraṇaṃ ca /
tatrānumānasyaiva yadasādhāraṇaṃ virodhādi tatrānumānadoṣāṇāṃ sarveṣāṃ praveśo 'bhihitaḥ /
sādhāraṇe tu sarvanigrahasthānānāmiti na kaścidvirodhaḥ /

yadvā kathābāhyādīnāmeṣāṃ nigrahasthānatāvyavacchedārthastuśabdaḥ /


*5,482*

nanu keyaṃ kathā nāmetyapekṣāyāṃ tatsvarūpaṃ nirūpayansāmānyalakṣaṇaṃ vibhāgamuddeśaṃ cāha- vāda iti //

vādo jalpo vitaṇḍeti kathāstisro vijānatām // MAnuv_2,1.39ab //

NYĀYASUDHĀ:
atra katheti lakṣyapadamāvartanīyam /
vicāragocaretyupaskartavyam /
vijānatāmiti jātau bahuvacanam /
tathā cānekavidva(tkartṛ)dvaktṛkavicāragocarā kathā vākyasandṛddhiḥ(ndarbhaḥ) katheti sāmānyalakṣaṇasiddhiḥ /
tāśca kathā vādādibhedena tisraḥ trividhā ityarthaḥ /
vijānatāṃ matena tisra iti vā /
tena nyūnādhikasaṅkhayoktistadvirodhādayuktetyuktaṃ bhavati /


*5,488*

vādalakṣaṇamāha- svārthamiti //

svārthaṃ parārthamapi vā tattvanirṇayasādhanī // MAnuv_2,1.39cd //
kevalaṃ tu kathā vādo ... // MAnuv_2,1.40a //


NYĀYASUDHĀ:
tattvanirṇayasādhanītyarthādyarthajalpavitaṇḍāvyavacchedaḥ /
tathāpi vitaṇḍāviśeṣe 'tivyāptistadarthaṃ kevalamityuktam /
sākṣādityarthaḥ /
tuśabdena tattvanirṇayasādhanādapi jalpaviśeṣāt taduddeśena pravṛttatvavailakṣaṇyaṃ darśayita /
yadā tu viditatattvau vītarāgāvaviditatattvaiḥ parairabhyarthitau kathāṃ kurutastadā tatrāvyāptemetallakṣaṇam /
nacāsau na vādaḥ /
anyatrānantarbhāvena tisra ityasya vyāghātādityata uktam- svārthaṃ parārthamapi veti //
apiśabda ubhayārthatāsamuccayārthaḥ /


*5,491*

jalpalakṣaṇamāha- jalpa iti //

... jalpo 'rthādivyapekṣayā /
satāmeva kathā jñeyā ... // MAnuv_2,1.40bc //


NYĀYASUDHĀ:
ādipadena khyātyādergrahaṇam /
arthādivyapekṣayeti vādavyāvṛttyartham /
ānuṣaṅgikārthādisādhanatvaṃ vādasyāpi sambhavatīti vyapekṣāgrahaṇam /
vitaṇḍāvyāvṛttyarthaṃ satāmeveti /
satāmityevokte na vitaṇḍāvyāvṛttisiddhiḥ /
vitaṇḍāyāmapyekasya sattvāt /
bahuvacanasya jātyarthatvāt /
tena evetyuktam /


*5,491*

vitaṇḍāṃ lakṣayati- vitaṇḍeti //

... vitaṇḍā tvasatāṃ satām // MAnuv_2,1.40d //
aprakāśya svasiddhāntamasatāṃ pakṣadūṣaṇam // MAnuv_2,1.41ab //


NYĀYASUDHĀ:
tuśabdo vādajalpavyavacchedārthaḥ /
kathetyanuvartate /
kartṛbhedena kathābhede 'tiprasaṅga ityato lakṣaṇāntaramāha- aprakāśyeti //
sadbhiḥ svasiddhāntamaprakāśyāsādhayitvāsatāṃ pakṣasya dūṣaṇameva kriyate yatsā vitaṇḍetyarthaḥ /
prativādinaḥ svapakṣasādhanena vinā parapakṣapratikṣepamātreṇa paryavasyantī kathā vitaṇḍetyuktaṃ bhavati /
nanvetadeva kinnimittam /
prāśnikādyadhīnamiti brūmaḥ /
te 'pi kuta etādṛśaniyamaṃ kuryuriti cet(na) /
tattvajñānāyogyānasataḥ prati sadbhiḥ svasiddhāntasādhane teṣāṃ tattvajñānotpādaprasaṅgāt /
tasya ca niṣiddhatvādityāśayenāsatāmityuktam /
etena prathamalakṣaṇasyāpi samarthanaṃ veditavyam /


*5,494*

nanvasambhavīdaṃ lakṣaṇam /
parapakṣadūṣaṇaṃ hi tatpratipādakapramāṇadūṣaṇenaiva bhavet /
naca svapakṣasādhanahīnāyāṃ vitaṇḍāyāṃ tatsambhavatītyata āha- ukta iti //

ukte taiḥ prathamaṃ māne vaktavyaṃ tasya dūṣaṇam // MAnuv_2,1.41cd //

NYĀYASUDHĀ:
tairasadbhiḥ prathamaṃ svapakṣasādhanāya māne ukte sati sadbhistasya mānasya dūṣaṇaṃ vaktavyam /
asato vādibhūtasya svapakṣasādhanaṃ parapakṣanirākaraṇaṃ ca karaṇīyam /
satastu prativādinaḥ tatpramāṇadūṣaṇenaiva caritārthatvamityuktaṃ bhavati /

kvacitsatāmevetyādisārdhaśloko vādajalpayorityataḥparaṃ paṭhitaḥ /
tata etāmeva saṅgatimāśritya ṭīkākṛtā tatraiva vyākhyātaḥ /


*5,496f.*

kiñca guruśiṣyādayo 'samānavidyā api vāde 'dhikriyante /
tattvanirṇayārthitvāt /
jalpavitaṇḍayostu sambhāvitasamānavidyayorevādhikāraḥ /
"yayoreva samaṃ vittaṃ yayoreva samaṃ śrutam /
tayorvivāho vādaśca nottamādhamayoḥ kvacit'; iti smaraṇāt /
vādo jalpavitaṇḍālakṣaṇo vivādaḥ /
anyathātyantāpakṛṣṭo 'pyutkṛṣṭatamena vaiyātyāt ghaṭamāno yadi vā daivāyattamabhibhāvayet tadā vṛthākhyātiṃ labheta /
tathāca prāśnikādīnāmasujñātvaṃ pratyavāyaśca syāt /
apūjyaḥ pūjyate yatreti vacanāt /
evaṃ ca vādājjalpavitaṇḍayorbhedaḥ /
nanvetadayuktam /
parabuddherapratyakṣatvena vidyāsāmyavaiṣamyayorjñātumaśakyatvāditi cenna /
jalpavitaṇḍārthinorvidyāsāmyādeḥ parīkṣayā niścayopapatteḥ /
tadetadāha- vidyeti /

vidyāparīkṣāpūrvaiva vitaṇḍā jalpa eva ca // MAnuv_2,1.42ab //

NYĀYASUDHĀ:
vidyāparīkṣā pūrvā kāraṇabhūtā yasyāḥ sā tathoktā /
vidyāparīkṣayā niścitasāmyayoreva vitaṇḍā dātavyā, na viṣamavidyayoḥ /
jalpaścaivam vidyāparīkṣāpūrvaṃ eveti vyākhyeyam /
dvitīyaivaśabdo vādavyāvṛttyarthaḥ /
samānavidyayorevetyayaṃ niyamo na vāde 'stīti /


*5,498*

nanu jalpavitaṇḍārthinovirdyāsāmyādiniścayāya kartavyā parīkṣā kiṃ kathayā, utānyathā /
nānyathā /
anyonyasaṅgharṣaṇena vinā tadasiddheḥ /
ādye 'pi kiṃ vādena jalpavitaṇḍābhyāṃ vā /
na prathamaḥ /
khyātyādikāmayoḥ spardhāvatorvādānupapatteḥ /
na dvitīyaḥ /
anavasthāpātāditi cenna /
vādena tāvadvidyāparīkṣaṇasyeṣṭatvādityāśayavānvādasya vidyāparīkṣāyāṃ kāra(tatkāra)ṇatvamanvayavyatirekābhyāṃ sādhayitumupodghātaṃ tāvadāha- ucceti //

uccanīcatvanirṇītiryato jayaparājayau // MAnuv_2,1.42cd //

NYĀYASUDHĀ:
yato vidyayoccatvena nirṇītatvameva jayo nīcatvena nirṇītatvaṃ ca parājaya ityarthaḥ /
iti vidyāparīkṣaṇaṃ vādeneti vakṣyamāṇenānvayaḥ /

evamupayuktamabhidhāya vyatirekamāha- vinaiveti //

*5,498f.*

vinaiva tattvanirṇītiṃ nahi jalpādinā kvacit /
uccanīcatvavijñānamiti vidyāparīkṣaṇam // MAnuv_2,1.43 //


NYĀYASUDHĀ:
nirṇīyate 'nayeti nirṇītistattvasya nirṇītistattvanirṇītirvāda iti yāvat /
tattvanirṇītiṃ vinoccanīcatvavijñānaṃ na hītyevokte vinā vādeneti vakṣyamāṇavirodhaḥ syāt /
ato jalpādinetyuktam /
itiśabdastasmādityarthe /
vidyāparīkṣaṇaṃ vādeneti vakṣyamāṇamatrāpi sambaddhayate /
yadyapi satsādhanopalambhe jalpe 'pi bhavati vādinoruccanīcatvavijñānam /
tathāpi taduddeśenāpravṛttestādarthvasya prathamamaniścayānna tadarthaṃ jalpo dātuṃ śakyate /


*5,500*

vyatirekasyānyadīyākāraṇatvamātraniścayahetutvādvādasya kāraṇatāmavadhārayitumanvayaṃ cāha- vādeneti //

vādena coccanīcatvavijñānaṃ bhavati sphuṭam // MAnuv_2,1.44ab //


NYĀYASUDHĀ:
caśabdo 'nvayasya vyatirekeṇa samuccayārthaḥ /
anvayavyatirekābhyāṃ samarthitamarthamupasaṃharati- itīti //


*5,501*

iti vādasya pūrvatvaṃ ... // MAnuv_2,1.44c //

NYĀYASUDHĀ:
iti tasmādvādasya pūrvatvam /
jalpavitaṇḍārthinorvidyāsāmyādiniścayahetuparīkṣārthaṃ prathamānuṣṭheyatvaṃ siddhamityarthaḥ /

etaduktaṃ bhavati /
samānavidyayoreva jalpavitaṇḍe /
samānavidyatā ca parīkṣāniśceyā /
parīkṣā ca vādakathayā vidheyā /
na jalpavitaṇḍābhyām /
jayena hi vidyādhikyaṃ nirṇetavyam /
parājayena ca tannyūnatā /
jayaparājayau ca pramāṇatarkābhyāṃ prakṛtaprameyasādhanasāmarthyāsāmarthyalakṣaṇau uccanīcatvanirṇayaviṣayatāśabdavācyāveva prakṛtopayoginau /
tau ca vāda eva sambhavato na jalpavitaṇḍayoḥ /
tatra yatkiñcinnigrahodbhavanamātreṇa jayaparājayavyavasthāpanāt /
ato jalpavitaṇḍārthaṃ jalpavitaṇḍābhyarthanābhāvānnānavastheti /

jalpavitaṇḍārthinorvidyāparīkṣāyāṃ vādena kṛtāyāṃ kiṃ kāryam /
samavidyatvasambhāvanāyāṃ jalpavitaṇḍe kartavye ityuktameva /
viṣamavidyatāvadhāraṇāyāṃ kiṃ vidheyamityapekṣāyāmāha- tatsiddhāviti //

... tatsiddhau vyarthatānyayoḥ // MAnuv_2,1.44d //

NYĀYASUDHĀ:
tena vādenaiva tasya nīcoccabhāvasya siddhau satyāmanyayorjalpavitaṇḍayorvyarthatā /
tataśca akartavyatetyarthaḥ /
parīkṣārthena vādenaivoparama iti /

bahuvidyatvasiddhau tu naiva vādo 'pi ... // MAnuv_2,1.45ab //

NYĀYASUDHĀ:
jalpavitaṇḍārthinorvidyāparīkṣārthaṃ vādakathā prathamaṃ dātavyetyuktasyāpavādamāha- bahuvidyatveti //


prāk parīkṣāto lokasaṃvādādinānyatarasya pratiyogyapekṣayā bahuvidyatvasiddhau tu vādo 'pi naiva dātavyaḥ /
kimu jalpavitaṇḍe iti /

kuta ityata āha- kāraṇamiti //

... kāraṇam // MAnuv_2,1.45b //


NYĀYASUDHĀ:
vidyāparīkṣāyā iti śeṣaḥ /
vāda ityanuvartate /
vādo hi vidyāparīkṣākāraṇamityeṣyavyo na tu vyasanitayā /

tatphalaṃ tvanyata eva jātamiti kiṃ parīkṣayā kiṃ tadaṅgena vādeneti /


*5,503*

yaduktaṃ spardhāvatoḥ khyātyādikāmayorvādo na sambhavati, tatrāsatsādhanottaraprayogasyāvaśyamavarjanīyatvāt, tataśca vidyāsāmyavaiṣamyaniṇaryānupapatteriti tatrāha- sabheti //

sabhāsabhāpaprāśnīkapūrvastu spardhināmapi // MAnuv_2,1.45cd //
vāda eva ... // MAnuv_2,1.46a //


NYĀYASUDHĀ:
praśnaśabdātkarotītyarthe īkakpratyayo vaktavyaḥ /
spardhināmiti jātau bahuvacanam /
evetyasya yujyata ityadhyāhṛtenānvayaḥ /
yataḥ sabhādipūrvastataḥ spardhināmapi vādo yujyata eveti /
tuśabdo hetvarthaḥ /

sabhāsabhāpatiprāśnikairniyatayorasatsādhanādiprayogavarjanasambhavāditi bhāvaḥ /


*5,505*

yaduktaṃ"tatsiddhau vyarthatānyayoḥ'; iti tadayuktam /
vādena tattvanirṇayasiddhāvapi arthādyasiddheḥ /
tathācābhilaṣitaṃ na siddham, siddhaṃ cānabhilaṣitamiti tatrāha- ubhayeti //

... ubhayārthaḥ syānnirṇītijayakārakaḥ // MAnuv_2,1.46ab //

NYĀYASUDHĀ:
vāda ityanuvartate /
asyaiva vivaraṇaṃ nirṇītīti //
na kevalaṃ nirṇītikārakaḥ kintu jayakārakaśca /
jayaśabdena tatsādhyamarthyādikamupalakṣyate /
vidyāparīkṣārthe vāde jayino 'rthādikamapi sabhāpatinā sampādanīyamiti bhāvaḥ /

evaṃ tarhi na kadāpi jalpavitaṇḍāpravṛttiḥ"vyartharatānyayoḥ'; iti yukteḥ sama(māna)tvāt /
yathā hi vidyāvaiṣamyanirṇaye jitavato 'rthādilābhaḥ, tathā tatsāmye dvayorapi arthādilābhaḥ sambhavatyeva /
naca phalāntaramasti yena punarjalpavitaṇḍārambhaḥ syādityata āha- tattvāprakāśa eveti //


*5,506*

tattvāprakāśa evaiko vitaṇḍājalpayoḥ phalam // MAnuv_2,1.46cd //

NYĀYASUDHĀ:
tattvāprakāśa iti paravañcanasāmarthyamucyate /
tena tatsādhyo 'rthādilābho lakṣyate /
idamuktaṃ bhavati /
yadyapi vidyāsāmyavaiṣamyayornirṇītijayau syātāṃ tathāpi tāttvikakathāphalarūpāveva /
parācchādanacāturyaprayuktārthādilābhārthaṃ samānavidyayoḥ punarjalpavitaṇḍāpravṛttiriti /
nacaivaṃ viṣamavidyayorapi tatpravṛttiḥ, upaplavaprasaṅgasyoktatvāditi /

yadvā tattvanirṇayaphalo vādaḥ arthādiphale jalpavitaṇḍe, iti phalabhedena kathābheda uktaḥ /
so 'nupapannaḥ /
tathā satyarthādīnāṃ bhedena kathā'nantyaprasaṅgādityata āha- tattveti //
yadyapi arthādayo 'vāntarabhedabhinnāstathāpi tattvāprakāśa eka eva vitaṇḍājalpayoḥ phalam /
tattvanirṇayetaratvarūpeṇārthādīnāmekatvānnoktadoṣaḥ /
tadavāntarabhedavivakṣā tu vyarthaiveti bhāvaḥ /


*5,507*

evaṃ kathayā vidyāparīkṣaṇamiti pakṣaḥ samarthitaḥ /
idānīmanyatheti pakṣamapi samarthayamāna āha- vineti //

vinā vādena vidyāyā yadi śakyaṃ parīkṣaṇam /
syājjalpādirapi kvāpi ... // MAnuv_2,1.47a-c //


NYĀYASUDHĀ:
avigītavidvatprasiddhayādineti śeṣaḥ /
kvāpītyasya pūrvārdhenānvayaḥ /
tadā samavidyayoḥ prathamamapi jalpādiḥ kathāviśeṣaḥ kāryaḥ syādityarthaḥ /
tarhi vidyāparīkṣaṇaṃ vādenaivetyuktivirodha ityata āha- vā eveti //

... vāda evānyathā bhavet // MAnuv_2,1.47d //

NYĀYASUDHĀ:
vāda eva prathamaṃ kartavyo bhavediti yaduktaṃ tadanyathā vādena vinā vidyāparīkṣaṇasya kartumaśakyatva evāto na virodha iti /

astvevamupāyāntaravirahe kathayaiva vidyāparīkṣaṇam /
sā tu vāda iti kutaḥ /
tattvanirṇayārthinoradhikāritvāttatphalatvācceti cet(na /
evaṃ) /
tarhi vijigīṣāvatoradhikāritvādarthādiphalatvātsabhādyaṅgopetatvājjalpo 'pi syāditi /


*5,508*

kimatra jalpaśabdavācyatāmātramāpadyate, kiṃvā vādaśabdavācyatābhāvaḥ, athavā samāhārarūpaṃ kathāntaraṃ yadvā nimittadvayasamāveśe vādaśabdasyaiva vyavahārānupapattiḥ /
sarvatrāpyuttaramāha- jalpa iti //

jalpa ityapi nāma syād vādasyaitādṛśasya tu // MAnuv_2,1.48ab //


*5,508f.*

NYĀYASUDHĀ:
etādṛśasya nimittadvayopetasyātra jalpa iti nāma syādityabhyupagamenādyo nirastaḥ /
apiśabdena vādaśabdavācyatāṃ pratijñāyai tādṛśasyetyanena heturuktaḥ /
tena dvitīyo 'pi nirākṛtaḥ /
nahi nimittasadbhāve vācakāpravṛttiriti yuktam /
jalpaśabde 'pi sāmyāt /
atastulāyāṃ pramāṇādito vidhāntaravatī syāt /
vādasya jalpa ityapi nāma syāditi vādasaṃjñā tu mukhyā jalpasaṃjñā tvamukhyeti sūcitam /
tena caturtho 'pi nirastaḥ /
tatra hetuviśeṣasadbhāvaṃ tuśabdena dyotayati /

tathāhi /
yadyapi kathakāvādito vijigīṣū tathāpi sabhyādibhivirjigīṣāṃ paribhāvyotpāditā tattvanirṇayārthitaiva kathopayoginī /
arthādilābhaścāntarā prāpto na tvādita evoddiṣya ityamukhya eva /
ata eva pūrva ubhayārthaḥ syādityukte sāmyapratītiprasaktau nirṇītijayakāraka iti tattvanirṇīteḥ prādhānyapradarśanārthaṃ vivaraṇaṃ kṛtam /

anyathā kathāphaladvayasyaivobhayaśabdena pratītervivaraṇaṃ vyarthaṃ syāt /
alpāctaramiti lakṣaṇasya vyabhicāraṃ kurvāṇenāpyetadeva sūcitam /
anyathā jayanirṇītikāraka ityavakṣyat /
sabhyādisaṃvaraṇaṃ ca vijigīṣutāparibhavārthamiti vādatāprādhānyamevopodbalayatīti /


*5,513*

api cādhikāribhedādikaṃ bahiraṅgatayaiva kathābhedakam /
antaraṅgaṃ tu pravṛttiprakāra eva /
sa ca vādasambandhyevāsyāṃ kathāyāmastītyato vādatvameva mukhyamityāśayavānāha- pratijñeti //
Vyāsa-(14)

pratijñāmātrasādhyatvamapi syād yājñavalkyavat // MAnuv_2,1.48cd //

NYĀYASUDHĀ:
vidyāparīkṣārthāyāṃ kathāyāṃ kvāpi prameye pratijñāmātreṇa pramāṇopanyāsarahitena vacanena sādhyatvaṃ prajñāpanīyaṃ syāt /
kuta etat /
katyeva devā yājñavalkyeti śākalyena pṛṣṭe, (yājñavalkyena) trayastriṃśaditi vacanamātreṇa prajñāpanasya kṛtatvāt /
sā ca vidyāparīkṣārthā kathetyupakramaparyālocanayā siddham /
yājñavalkyaśabdena tatkathopalakṣyate /
saptamyarthe vatiḥ /
tataḥ kimityata āha- saṃvāda iti //

saṃvāde vādinoḥ kvāpi ... // MAnuv_2,1.48*a //

NYĀYASUDHĀ:
evambhāvo hi vādiprativādinoḥ saṃvāde 'nyonyāptatā'śvāse satyeva syāt tadāśvāso hi vāda eva sambhavati na jalpe /
vijigīṣuṇāpasiddhāntādiparihāreṇa sarvathā pramāṇapraśnasya kartavyatvāt /
tenāyaṃ vāda eveti (prati)jñāyata iti /

nanvevaṃ tarhi na vidyāparīkṣā sambhavati /
pramāṇopanyāse hi tatsamarthanopālambhābhyāṃ sā syāt /
natu praśnapratijñābhyupagamamātreṇetyata āha- vivāda iti //

... vivāde hetur iṣyate // MAnuv_2,1.48*b //

NYĀYASUDHĀ:
heturiti pramāṇamātropalakṣaṇam /
pramāheturiti vā /
na hyekatrāptaḥ sarvatrāpta eveti niyamo 'stīti bhāvaḥ /
yājñavalkyenāpi tatra tatra pramāṇopanyāsaḥ kṛta eveti sakalamanākulam /


*5,517*

prakṛtānāṃ sabhyasabhāpatiprāśnikānāṃ svarūpajijñāsāyāmāha- sabheti //

sabhā sabhāpatiścaiva prāśnikāścaiva vaiṣṇavāḥ /
rāgadveṣavihīnāśca ... // MAnuv_2,1.49a-c //


NYĀYASUDHĀ:
(dvau) caśabdau sabhā(bhyā)dīnāmanyonyasamuccaye /
tṛtīyo viśeṣaṇasamuccaye /
evaśabdau tu vaiṣṇavā eva rāgadveṣavihīnā eveti sambaddhayete /
anyathā kathānupapattisūcanaṃ tatprayojanam /
syuriti vakṣyamāṇamihāpi(matrāpi) sambaddhayate /

sabhyānāṃ prāśnikānāṃ ca viśeṣaṇāntaramāha- syuriti //

... syuḥ sabhyāḥ sarvavedinaḥ // MAnuv_2,1.49d //
prāśnikāś ... // MAnuv_2,1.50a //



*5,518*

NYĀYASUDHĀ:
sarvaśabdena vādiprativādidarśanasya kathopayuktasya vyākaraṇādeśca saṅgrahaḥ /
punaḥ sabhyaprāśnikagrahaṇaṃ sabhāpativyavacchedārtham /
tatsārvajñasya kathopayogābhāvāt /
sabhyāḥ prāśnikāśca sarvavedinaḥ syurityanvayaḥ /

nanu prāśnikānāṃ kvopayogaḥ /
vivadamānayorguṇadoṣāvadhāraṇādāviti brūmaḥ /
evaṃ tarhi tairevālaṃ kiṃ sabhyairityata āha- etaditi //

... caitadajñāne sabhyāśca ... // MAnuv_2,1.50ab //

NYĀYASUDHĀ:
anantaroktānprāśnikān etacchabdena parāmṛśati /
kvacitsūkṣme prameye eteṣāṃ prāśnikānāṃ kāraṇāntaradvājñāne sati vādinorguṇadoṣanirṇayāya sabhyāśca pramāṇaṃ syuriti vakṣyamāṇenānvayaḥ /
pramāṇāśrayeṣu pramāṇatvopacāraḥ /

yadyevaṃ prāśnikeṣvajñānaśaṅkayā sabhyānāṃ varaṇam, tadā teṣvapyajñānaśaṅkayānye 'pi varaṇīyāḥ /
anyathā nirṇayābhāvena kathāvaiyarthyāpatteḥ /
teṣvapyevamityata āha- eṣāṃ ceti //

... eṣāṃ ca dūragāḥ /
pramāṇaṃ nirṇayāya syuḥ ... // MAnuv_2,1.50bc //


NYĀYASUDHĀ:
eṣāṃ sabhyānāṃ cājñāne sati dūragā deśāntarasthāḥ /
nacaivaṃ sabhyasaṃvaraṇamapyanarthakam /
tataḥparaṃ prāyeṇājñānaśaṅkānudayāt /
laukikaścāyamartha iti /

dūragānnirṇāyakatvasambhavāya viśinaṣṭi- pakṣeti //

... pakṣapātavivarjitāḥ // MAnuv_2,1.50d //

NYĀYASUDHĀ:
ekadeśotkīrtanena yathoktaṃ sabhyādilakṣaṇamatidiśati /


*5,520*


aprakāśya svasiddhāntamiti vitaṇḍālakṣaṇamuktam /
tatkathaṃ vādajalpābhyāṃ vyāvartakamityata āha- ubhābhyāmiti //


*5,521*

ubhābhyāṃ sādhanaṃ caiva dūṣaṇaṃ vādajalpayoḥ // MAnuv_2,1.51ab //

NYĀYASUDHĀ:
vādajalpayorubhābhyāmeva svapakṣasādhanaṃ parapakṣadūṣaṇaṃ kartavyaṃ, natu prativādinaḥ parapakṣadūṣaṇamātreṇa kṛtārthateti /

satāmeveti sārdhaślokasyātra sanniveśe tu, lakṣitau vādajalpau /
idānīṃ tu vitaṇḍāyā lakṣaṇadvayaṃ vivakṣustāvadupayuktamāha- ubhābhyāmiti //
kathā vādajalpalakṣaṇā /
etena jalpo 'rthādivyapekṣayetyuktasya vitaṇḍāyāmativyāptirapi parihṛtā /
ubhayasādhanavattvena sadekādhikārikatvena vā 'rthādivyapekṣakathāyā viśeṣitatvāt /
yadarthaṃ satāmevetyuktaṃ tadvitaṇḍālakṣaṇamāha- vitaṇḍā tviti //
kathetyanuvartate /
ubhābhyāmiti yadarthamuktaṃ tallakṣaṇāntaramāha- aprakāśyeti //
ukte tairiti pūrvavaditi /


ubhābhyāṃ sādhanamityādyuktam /
tatra sādhanāya kiṃ pramāṇaṃ prayoktavyam /
yatra yadasti tatra tadeva (kiṃ) vaktavyam /
satyam /
pramāṇasamplave tu katham /
kiṃ sarvamevotaikameva tatrāpi kimityapekṣāyāmāha- sadbhiriti //

sadbhirāgama evaikaḥ prayojyo 'bhīṣyasādhakaḥ // MAnuv_2,1.51cd //


*5,522*

NYĀYASUDHĀ:
eka eva, natu sambhavatsarvamādhikyaprasaṅgāt /
sa cāgama eveti yojyam /
yadvaikaśabdo mukhyārthaḥ /
īśvarādiprameye mukhyo vedādirāgama eva vaktavyaḥ (tasya svātantryeṇa sādhyasiddhayaṅgatvāt) nānumānamiti /
nanvavaidikasya vedādyāgamopādāne 'pasiddhāntaḥ syādityata uktam- sadbhiriti //
kuto vedādiprayoganiyama ityata āha- abhīṣyeti //
yata iti śeṣaḥ /
anumānaṃ khalu na svātantryeṇeśvarādisādhanasyeṣye /
sarvatropādhipratipakṣayoḥ sambhavāt /
tadarthamantato 'pyāgamo 'nusaraṇīyaḥ /
tato varaṃ prathamameva (āgamo) vaktavyaḥ /
tasya svātantryeṇa sādhyasiddhayaṅgatvāt /
nanvavaidikaṃ prati katham /
āgamaṃ prayujya tatprāmāṇyaṃ sādhanīyamiti /


*5,524*

nanvasadbhiḥ kiṃ vaktavyam /
na tāvatpratyakṣam /
atīndriye tadayogāt /
na cāgamaḥ /
svaparāgamayoranyonyaṃ prāmāṇyāsammateḥ /
nāpyanumānam /
prayogaparimāṇāsammateḥ /
tathāhi /
saugato yadi dvayavayavaprayogaṃ kuryāttadā naiyāyikena nyūnena nigṛhyeta /
anigrahe vā prativādī paryanuyojyamupekṣeta /
pañcāvayavaprayoge tvadhikena nigṛhyeta /
tathā svīkāre cāpasiddhāntena /
tathāca niyatāvayavādivyatirekeṇa vitaṇḍaiva na syādityata āha- svasiddhānteti //

svasiddhāntānusāreṇa hyasadbhiranumocyate // MAnuv_2,1.52ab //

NYĀYASUDHĀ:
yathāsiddhāntaṃ vaktavyamiti prāṅniyamātsvasiddhāntanirṇītaprayogāvayavaparimāṇāpekṣayaiva nyūnādyavatārādanyathā(kathā)'nupapatteriti

hiśabdātharḥ /

sadbhirāgamo vaktavya iti na (itya)yuktam /
vaidikasya prativādinastaddūṣaṇe 'pasiddhāntāt /
adūṣaṇe tu parapakṣādūṣaṇena kathābhāvaprasaṅgādityata āha- pratyakṣeti /

pratyakṣāgamavairūpyamāśrityānyārthataiva tu // MAnuv_2,1.52cd //
āgame daśarnīyātra doṣo liṅgavilomatā // MAnuv_2,1.53ab //


NYĀYASUDHĀ:
āgame tu vādinā prayukte prativādinā vaidikena tasyānyārthataiva daśarnīyā /
nānumānasyevāprāmāṇyam /
yenāpasiddhāntaḥ syāt /
tata eva kṛtaparapakṣadūṣaṇo 'pi bhavet /
anyārthatāṃ darśitavatā'gamasya parābhimatārthātpracyāvitatvāt /
na hyapekṣitārthāsādhakatavādanyatpramāṇadūṣaṇamastīti /

nanvevaṃ sati kathaṃ kathāparyavasānam /
svasvābhimatārthāgrahaparityājanopāyābhāvādityata uktam- pratyakṣetyādi //
atra parābhimate 'rthe pratyakṣāgamavirodhamāśritya /
na kevalametāvat /
atropakramādiliṅgavilomatādoṣo 'pi darśanīyaḥ /
atrānyatama(ra)mātre tātparyam /
anyathā'dhikyaprasaṅgāt /


*5,527*

nanvetāvatāpi na kathāsamāptiḥ /
parābhimatārthānupapattimātreṇa svābhimatārthāsiddherityataḥ satyamityāha- liṅgeti //

liṅgānukūlyaṃ svārthasya śrutyādīnāmanugrahaḥ // MAnuv_2,1.53cd //

NYĀYASUDHĀ:
darśanīyapadamanuvartate /
śrutyādīnāṃ vedādīnāṃ śrutirliṅgaṃ samākhyā cetyuktānāṃ liṅgagrahaṇenaiva gṛhītatvāt /
upalakṣaṇaṃ caitat /
parārthe pramāṇānukūlyasya svārthe tatprātikūlyasya ca nirāso darśanīya ityapi draṣṭavyam /
svasiddhāntaprayogaparimāṇānatikrameṇa parārthānumānavākyaprayogaḥ kartavyaḥ /
tathātve ca na nyūnādyavatāraḥ /
tadatikrama eva tadavakāśa ityuktam /


*5,528*

apara āha /
yathāvastu prayoktavyam /
naca vastutattva eva vādināṃ vipratipatteravaśyaṃ nyūnādyavatārasambhavenāprayogaprāptiriti vācyam /
(ta)yasya yatra tāttvikatvābhimānastena tatprayogānantaraṃ pareṇa nyūnādāvudbhāvite tathārūpatāyāḥ sādha(nīyatvāt)nāt /
nacaivamarthāntarāpātaḥ /
hetoranyatarāsiddhayudbhāvane tatsiddhivyutpādanavatprakṛtopayogasadbhāvāditi /
tadayuktam /
dvitripañcāvayavādipakṣāṇāṃ sarveṣāmapi tāttvikatāyāḥ samarthitatvāt /
svasvaniyamasyaiva tātvikatvamupetya tadanatikrameṇaiva prayogāṅgīkāre tu sarvathā kathocchedāpatteḥ /
tattāttvikatāyāṃ prativādinā vipratipadyamānenāvaśyaṃ nyūnāderudbhāvanāt /


nanūktamatra svasvāvayavakalpanā paraṃ prati samarthanīyeti /
duruktaṃ tat /
tatsamarthanasyāśakyatvādityāha- tripañceti //


*5,529*

tripañcāvayavāmeva yugmāvayavinīmapi /
niyamād yo 'numāṃ brūyād taṃ brūyād yadi tādṛśī /
nānumeti tadā kena sādhyāvayavakalpanā // MAnuv_2,1.54 //


NYĀYASUDHĀ:
trayaḥ pratijñāhetūdāharaṇāni, udāharaṇopanayanigamanāni vā, pañca pratijñāhetūdāhaṇopanayanigamanāni vāvayavā yasyāḥ sā tripañcāvayavā /
evaśabdena pakṣadvayaniyamamāha /
yugmau dvāvudāharaṇopanayāvayavau yasyāḥ sā yugmāvayavinī /
niyamāditi sannihitenaiva sambaddhayate /
anumeti tādarthyātprayoga ucyate /
vaiśeṣikādīnāṃ tatraiva vyavahārāt /
taṃ brūyādyadi paro 'niyatavādīti śeṣaḥ /
yadvā yo mīmāṃsakastārkikādiśca tripañcāvayavāmevānumāṃ brūyāt /
taṃ prati yaḥ saugato niyamādyugmāvayavinīṃ brūyāt /
sa yadi tādṛśī tryavayavā pañcāvayavā ca nānumeti brūyāditi yojyam /
evaṃ (vi)parivartenāpi /
tādṛśī nānumetyasya pramāṇābhāvāditi śeṣaḥ /

etaduktaṃ bhavati /
naiyāyikena saugataṃ prati pañcāvayavaprayoge vihite saugato 'dhikamiti nigṛhṇīyāt /
tato naiyāyikena pañcāvayavaprayogasyaiva tāttvikatvānnaivamiti vaktavyam /
tataḥ saugato nedaṃ tattvamapramāṇikatvāditi vadedeva /
atha naiyāyikenāprāmāṇikatvamasiddhamiti vadatā kathamiti saugate pṛṣṭavati (sati) kena pramāṇena svīyā pañcāvayavakalpanā sādhyā /
tadagocaratvāt /
nahi kāryakāraṇabhāvaḥ kvāpi pratyakṣasya viṣayaḥ /
na cāgamena /
tadabhāvāt /
"pañcāvayavayuktasya vākyasya guṇadoṣavit'; iti bhāratādivākyamastīti cenna"saukṣmyaṃ saṅkhayākramaścaiva nirṇayaśca prayojanam'; ityādinā tatraivānyathā vyākhyātatvāt /
nāpyupamānābhāvābhyām /
niyataviṣayatvāt /
nacārthāpattyā /
tadabhāvāt /
anupānānatirekācceti /


*5,531*

mā bhūtpratyakṣādināvayavakalpanāsiddhiḥ /
anumānena tu bhaviṣyati /
vyāptipakṣadharmatopetaliṅgapratīteḥ pañcāvayavavākyaśravaṇānvayavyatirekānuvidhāyitvāditi cet /
na tāvadidamanumānaṃ tvaccetasi parivartamānaṃ paraṃ pratyāyanāṅgam /
kinnāma prayujyamānam /
tatra kiṃ pañcāvayavaprayogo 'sya vidhāsyate, atha dvayavayavaḥ /
nobhāvapītyāha- niyateti //

***[NOTE: jump in verse numbering, no lacuna in text!]***

niyatāvayavāsiddhau ... // MAnuv_2,1.57a //


NYĀYASUDHĀ:
niyatāvayavasya pañcāvayavasya dvayavayavasya ca /
yathāsaṅkhayaṃ saugatanaiyāyikayorbodhaupayikatvāsiddhau, nānumānenāpyavayavakalpanāsiddhiriti śeṣaḥ /

yadvottaravākye niyatāvayavāsiddhāvityanuvādo 'yam /
tato niyatāvayavāsiddheriti siddhayati /
pañcāvayavaprayoge pareṇādhikyodbhāvanāt /
dvayavayavaprayoge 'nyataranyūnatvāpasiddhāntayorudbhāvanādityarthaḥ /
tataḥ kimityata āha- vyāptīti //


*5,532*
... vyāptimātreṇa sādhanam /
kartavyameva tena syāt ... // MAnuv_2,1.57bc //


NYĀYASUDHĀ:
yata evaṃ nopāyāntaraṃ tena kāraṇena /
tena naiyāyikena vyāptimātreṇa yadyasyānyavavyatirekānuvidhatte tattatkāryamityādivyāptivacanamātreṇaiva /
upalakṣaṇametat /
"liṅgoktau'; ityādiprāgvyutpāditaprakāreṣvanyatamenetyapi draṣṭavyam /
sādhanaṃ pañcāvayavaniyamasya, kartavyaṃ syāt /
saugatenāpi tadanusaraṇīyam /
itarathā tasyāpi prayogānupapattiprasaṅgāditi /


*5,534*

tato 'pi kimityata āha- tasmāditi //

... tasmāt saivānumā matā // MAnuv_2,1.57d //

NYĀYASUDHĀ:
yasmātprayogeyattāsādhanaṃ vādiprativādibhyāmanyatareṇa vā svamataparityāgenānyamatābhyupagame kṛta evopapadyate nānyathā /
tasmātsaivānumā matā /
vyāptivacanādikameva parārthaprayogatvena sarvatra mantavyam /

idamuktaṃ bhavati /
yadā naiyāyiko dvayavayavena pañcāvayavaniyamaṃ sādhayati /
tadā dvayavayavasya tāttvikatvaṃ svayaṃ manyate na vā /
neti pakṣe pratārakaḥ syāt /
ādye 'nyatrāpi kathaṃ tattatvaṃ na syāt /
evaṃ kathābhāvaprasaṅgabhīruḥ saugato 'pi pañcāvayavena dvayavayavasyāvaśyakatāṃ pratipadyamānastattvaṃ manyate na vā /
dvitīye kathaṃ tataḥ pratipadyeta /
ādye 'nyatrāpi kutastanna tattvam /
ato 'tra sarvasiddhāntaprakārāṇāṃ tāttvikatvādyuktaṃ svasiddhāntānusāreṇeti /
asmādeva saṅkaṭādbibhyadudayano yathāvastu vaktavyamityuktvā yathāsiddhāntaṃ vā vaktavyamiti samayaṃ baddhvā pravṛttāyāṃ kathāyāṃ na nyūnādyavatāra iti pakṣāntaramavādīditi /
avasitamanumānam /


*5,535*

nirdoṣaṃ vākyamāgamaḥ /
sa dvividhaḥ /
pauruṣeyo 'pauruṣeyaśca /
tatrāpauruṣeyo vedaḥ /
anyastu pauruṣeya iti suprasiddhatvānnoktam /


*5,537*

kecidvākyaṃ vākyārthe 'numānamiti bruvate /
tadanupapannam /
vākyavākyārthayordeśataḥ kālato vānvayavyatirekābhāvāt /
athedaṃ vākyaṃ vākyātharvat vākyatvāditi sādhyate /
tatra kiṃ vākyārthamātraṃ sādhyate tadviśeṣo vā /
nādyaḥ /
viśeṣapramiternirnibandhanatvāpatteḥ /
dvitīye sa viśeṣaḥ pratīto na vā /
ādye vākyavaiyarthyam /
dvitīye 'prasiddhaviśeṣaṇatā /
viśeṣasyānyatrābhāvādanaikāntyaṃ ca /
matubārthaśca kiṃ pratipādyapratipādakabhāvaḥ, sambandhāntaraṃ vā /
ādye sākṣālliṅgatayā vā /
na prathamaḥ /
anumānavaiyarthyāt /
apasiddhāntācca /
dvitīye tu nedaṃ vākyārthānumānaṃ kintu siddhe 'rthe vākyasya liṅgatānumānameva /
tatra ca dṛṣṭānto 'nyatarasādhyavikalaḥ /
na dvitīyaḥ /
tadabhāvena bādhāt /


*5,539*

athaivaṃ prayujyate, vivādādhyasitāni padāni svasmāritārthānvayapramitipūrvakāṇi ākāṅkṣādimatpada(kadambaka)tvāditi /
tadayuktam /
vināpyanvayapramitiṃ daivātprayukteṣvākāṅkṣādimatsu padeṣvanaikāntyāt /
āptaprayuktatvena hetuviśeṣaṇe sādhyārthasya hetvarthe praveśāpatteḥ /
puruṣaviśeṣaprayuktatvasyādhyāpakaprayukteṣu vyabhicārāt /
mūlapramānumāne 'pi vedeṣu anupapatteḥ /
tadapauruṣeyatvasya sādhitatvāt /


*5,542*

apare tvapauruṣeyasyāgamatvamupagamya pauruṣeyasyānumānatvamabhyupagacchanti /
teṣāṃ tu sphuṭo vede vyabhicāraḥ /
kiñca padānāmanvitābhidhāne śaktiḥ /
padānyeva ca vākyam /
naca vaidikapadebhyo 'nyānyeva laukikāni padāni /
vaktā tu padajñāna evopayujyate /
tatkathaṃ lokavedayoḥ prakārabhedaḥ syāt /
api ca vedānusāreṇa paṭhyamāneṣu laukikavākyeṣu katham /
anvayapratītirutpadyata eva /
kinnāma punaḥ pauruṣeyatvajñānādapanīyata iti /
evaṃ tarhi vākyādeva vākyātharjñānam /
tatprāmāṇyaniścayāya tu vaktrādyanusaraṇamityāyātamityāstām /


*5,544*

tadevaṃ sāmānyato viśeṣataśca pramāṇāni lakṣitāni /
tatra svīyasāmānyalakṣaṇasamarthanenārthādvādyantaroktasāmānyalakṣaṇāni nirastānyeva /
tathāpi smṛtiviṣaye vaktavya(vi)śeṣasya vidyamānatvātprābhākaralakṣaṇaṃ viśeṣato nirākaroti- anubhūtiriti //

anubhūtiḥ pramāṇaṃ cet kena smṛtirapodyate // MAnuv_2,1.58ab //

NYĀYASUDHĀ:
"tadā vaktavyaṃ smṛtiḥ pramā na vā /
ādye 'pasiddhāntaḥ'; iti śeṣaḥ /
dvitīye tvāha- keneti //
yadi smṛtirna pramā tadā smṛtiḥ lakṣaṇena vyāvartanīyā /
anyathātivyāpteḥ /
(tatkena) tatkutaḥ smṛtirapodyate vyāvartyate /
smṛtirvyāvartakaṃ na kimapi /
lakṣaṇe 'stīti yāvat /


*5,544f.*

nanvanubhūtirityukta eva smṛtāvaprasaṅgaḥ /
smṛtivyatiriktaṃ jñānamanubhūtirityabhidhānāt /
nahi smṛtiḥ smṛtivyatiriktā bhavatīti /
maivam /
smṛterapi smṛtyantaravyatiriktatvasambhavenāvyavacchedakatvāt /
smṛtitvānadhikaraṇaṃ jñānamanubhūtiriti cet /
kimidaṃ smṛtitvam /
na tāvajjātiḥ /
guṇeṣu jāteranaṅgīkṛtatvāt /
saṃskāramātrajanyajñānatvaṃ tu na sambhavati /
adṛṣṭādijanyatvāt /
asādhāraṇakāraṇavivakṣāyāmapi tathā /
smṛtermānasatvasya vakṣyamāṇatvāt /
etena niyamena pratyutpannāsādhāraṇakāraṇakapratyagratvamanubhūtitvamityapyavacchedakaṃ draṣṭavyam /
smṛterapi mānasapratyakṣajanyāyāstathātvāt /
saṃskārasya kāraṇatve 'pi nāsau sattāmātreṇa smṛtiṃ janayati kinnāmodbuddha eva /
tathāca kathaṃ na pratyutpannāsādhāraṇakāraṇajanyatvam /
anyathendriyādimā(yamā)tramupādāyānubhūterapi tannirākuryāt /
kiñca smṛtirapi kācitpratyutpannasaṃskārajanyā sambhavatyeva /
nacāvacchedakena vinā niyamo jñātuṃ śakyata iti /


*5,549*

yadvā anubhūtiḥ pramāṇaṃ cettadā smṛtāvavyāptiriti śeṣaḥ /
nanu smṛtiḥ pramāṇameva na bhavati /
tatkathaṃ tatrāvyāptidoṣa ityata āha- keneti //
smṛtiḥ kena nimittenāpodyate pramāṇādbahiḥ kriyate na kenāpītyarthaḥ /
tathāhi /
kimayathārthatvāt /
yāthārthye 'pyananubhūtitvādvāprāmāṇye bādhakābhāvādvā prāmāṇye sādhakābhāvādbādhakasadbhāvādvā /
ādyaṃ dūṣayati- keneti //
smṛtiḥ kena prabalena pramāṇenāpodyate bādhyate /
yena yathārthā na syāt /
bādhakābhāvānnāyathārthatvaṃ vācyamiti /
dvitīyaṃ nirākaroti- keneti //
kimanubhūtitvaṃ pramāṇalakṣaṇamiti kṛtvānanubhūtitvātsmṛtirapramāṇamityucyate kiṃ vā ghaṭādidṛṣṭāntāvaṣṭambhena /
ādye 'nyonyāśrayatvam /
tathāca kena smṛtirapodyate /
dvitīye 'pi smṛtireva kenāpodyate /
asmṛtitvenānubhūtiḥ kuto nāpodyate viśeṣābhāvāditi /
tṛtīyamapākaroti- pūrveti //

pūrvānubhūte kiṃ mānamityukte syāt kimuttaram // MAnuv_2,1.58cd //

NYĀYASUDHĀ:
yadi smṛtirapramāṇaṃ syāttadā pūrvānubhūte kiṃ mānamiti praśno niruttaraḥ syāt /
smṛtivyatiriktasya

tatpramāṇasyābhāvāt /
tathāca sākṣyādilokavyavahāro lupyeta /
smṛtireva pramāṇaṃ kintu liṅgatayeti cenna /
tathānubhavābhāvāt /
anyathā sākṣātkāreṇa kāryeṇa karmakārakatayā ghaṭā(dya)numānamityapi syāt /
caturthaṃ pratyāha- pūrveti //
smṛtirityeva hi vaktavyam /
vacanāccānubhavo 'numīyata iti lokavyavahāra evātra pramāṇamityarthaḥ /


*5,552*

nanu yadi smṛtiḥ pramā syāttadā tatkāraṇasya saṃskārasyānupramāṇatvaṃ prasajyeta /
tathācānupramāṇatritvaṃ bhajyeta /
nahi saṃskāraḥ pratyakṣādiṣvantarbhavati /
anindriyasannikarṣatvādajñātakaraṇatvācceti pañcamamapākaroti- mānasamiti //

mānasaṃ taddhi vijñānaṃ ... // MAnuv_2,1.59a //

NYĀYASUDHĀ:
hi yasmāttatsmaraṇaṃ mānasaṃ manaḥpratyakṣajaṃ na saṃskārakaraṇakaṃ tato noktadoṣa iti śeṣaḥ /
asākṣātkārarūpatvānna pratyakṣaphalatvamityata uktam- vijñānamiti //
sākṣātkāra ityarthaḥ /
smaraṇasya mānasatvaṃ sākṣātkāratvaṃ ca kuta ityata āha- tacceti //

... tacca sākṣipramāṇakam // MAnuv_2,1.59b //

NYĀYASUDHĀ:
taditi mānasatvam /
caśabdātsākṣātkāratvaṃ ca /
yadvā dvayamapi tacchabdena parāmṛśyate /
prakṛtānusandhānārthaścaśabdaḥ /


*5,553*

nanvindriyāṇāṃ prāpyakāritvaniyamādatītena ca manasaḥ prāpterayogātkathaṃ smṛtermānasapratyakṣajatvamityata āha- atīteti //

atītānāgataṃ yadvad yogibhirdṛśyate 'ñjasā /
evaṃ pūrvānubhūtaṃ ca manasaivāvagamyate // MAnuv_2,1.59c-f //


NYĀYASUDHĀ:
santi tāvadyogino 'ṇimādisiddhisampannā atītānāgatadarśinaḥ śrutismṛtītihāsapurāṇaprasiddhāḥ /
śrutyādeḥ siddhārthe prāmāṇyasya sādhitatvāt /
karmavidhisamānayogakṣematvācca yogavidhīnām /
naca tajjñānamasākṣātkāraḥ /
śrutyādinā sākṣātkāratvapratīteḥ /
tathāhi śrutiḥ"apaśyamapyaye māyayā viśvakarmaṇyado jagannihitaṃ śubhracakṣuḥ'; iti /
purāṇaṃ ca"nārāyaṇaprasādena'; ityādi /
itihāso 'pi"divyaṃ dadāmi te cakṣuḥ'; ityādi /
tadidamuktam- añjaseti //
sākṣādityarthaḥ /
evañca yathā yogināmindriyeṇaivātītānāgatātharsākṣātkārastathātītamapi manasā smaryata iti ko doṣaḥ /

nanvindriyasyārthaprāptirnāma na saṃyogaḥ samavāyo veti niyamaḥ /
kintu pratyāsattimātram /
asti ca tadyogīndriyāṇām /
tattadupadarśakayogajadharmasahakṛtatvalakṣaṇamiti cet /
evaṃ tarhi manaso 'pi pūrvānubhavajanitasaṃskārasācivyalakṣaṇāstyatītārthena pratyāsattirityāśayavatoktam- pūrvānubhūtaṃ ceti //


*5,554*

etaduktaṃ bhavati /
yadi prāptiḥ saṃyogādilakṣaṇā vivakṣitā tadā tadabhāvo 'naikāntikaḥ /
pratyāsattimātravivakṣāyāṃ tvasiddhiriti /
dṛṣṭāntakathanaṃ tu pratyāsattimātrasya sākṣātkārahetutāṃ sambhāvayitum /
kāryadarśanavaśācceyaṃ kalpanāsau nātiprasaṅga iti darśayituṃ ca /
etena mānasaṃ cetsmaraṇaṃ syānna saṃskārajaṃ tadānanubhūte 'pyu(vyu)tpadyeteti parāstam /
saṃskārasya sannikarṣasthānīyatayāṅgīkṛtatvāt /

*5,557*

yatsmṛtermānasatvaṃ sākṣisiddhamityuktaṃ tadabhinayena darśayati- vijñātamiti //

vijñātaṃ manasā pūrvaṃ mayaitat kṛtamityapi /
sākṣādanubhavāt siddhaṃ ... // MAnuv_2,1.60a-c //


NYĀYASUDHĀ:
etanmayā pūrvaṃ kṛtamityetanmayā manasā vijñātaṃ smṛtamapīti smaraṇasya mānasatvaṃ sākṣādanubhavātsākṣyanubhavena siddhamiti /

yaduktaṃ paraiḥ pūrvānubhavāvacchinnārthagocarā smṛtistadyāthārthyādikamanuvidadhānā na svayaṃ yathārtheti, tadasat, anubhavavacchuddhārthaviṣayatvasyāpi sākṣisiddhatvāditi darśayituṃ mayaitatkṛtamityapītyuktam /

nanu manaso 'pratyakṣatvātkathaṃ smaraṇasya mānasatā sākṣipratyakṣagamyeti cenna /
tasya sākṣivedyatāyā vakṣyamāṇatvāt /
tathāpi kāryakāraṇabhāvo na pratyakṣa iti cedanvayavyatirekasacivasya sākṣiṇastatra prāmāṇyābhyupagamāt /
jñānaṃ nityānumeyamiti cenna /
jñātatāyā nirākariṣyamāṇatvāt /
svaprakāśamiti cenna /
anātvatvāt, ghaṭavat /
mānasavedyatā tu nirasiṣyata ityāśayavānāha- kathameveti //

... kathameva hyapodyate // MAnuv_2,1.60cd //


*5,561*

NYĀYASUDHĀ:
yāthārthyamevetyādinoktasya prakṛtopayogamāha- evamiti //

evaṃ lakṣaṇake mānatraye brahmādivastuṣu /
pramāṇaṃ veda evaikas ... // MAnuv_2,1.61 //


NYĀYASUDHĀ:
yasmānmānatrayamevaṃlakṣaṇakaṃ tasmādbrahmādivastuṣu veda eva pramāṇaṃ na yuktyādestatrāvakāśaḥ /
indriyaṃ hi rūpādimatyeva dravye pravatarte /
naca brahmādikaṃ tathā /
anumānaṃ ca vyāptisāpekṣam /
naca vedanirapekṣasya tasya brahmādau sañcāro 'sti /
upādhipratipakṣayostu sarvatra sambhavena vyāptyaniścayāt /
vedānusaraṇe tu sādhyāvyāpakatvabādhitaviṣayatvayorāvaśyakatvāt /
pauruṣeyāgamastu paratantra eveti /

tataḥ kimityata āha- tatprāmāṇyaṃ ceti //

... tatprāmāṇyaṃ ca sādhitam // MAnuv_2,1.61d //

NYĀYASUDHĀ:
ya(ta)smādvedaviṣaye na yukteravakāśastato virodho 'pi sa evokta ityupapannam /

tathāca vedasya pramāṇavirodhābhāvāttatprāmāṇyaṃ ca sādhitam /
yaduktaṃ prāk"tasmādvedaprāmāṇyamiṣyate'; iti tatsiddhamityarthaḥ /

// iti śrīmannyāyasudhāyāṃ na vilakṣaṇatvādhikaraṇam //
Vyāsa-(15)


___________________________________________________________________________


[======= JNys_2,1.III: abhimānyadhikaraṇam =======]



*6,1*


// atha śrīmannyāyasudhāyāṃ caturtho bhāgaḥ (abhimānyadhikaraṇam) //


// oṃ abhimānivyapadeśastu viśeṣānugatibhyām oṃ //
yuktyantaravirodhaṃ vedasya parihartumidamārabhyate /
syādetat /
yuktivirodhāḥ kiṃ pratyekaṃ pariharaṇīyāḥ'; utopalakṣaṇayā /
nādyaḥ /
nirasanīyayuktyābhāsānantyena śāstrāparyavasānaprasaṅgāt /
sūtratvavyāghātācca /
dvitīye tvanārambha evāsyādhikaraṇasya /
nirantarātītādhikaraṇenaivopalakṣaṇayā sakalayuktivirodhānāṃ parihṛtatvāditi /
maivam /
abhyadhikaśaṅkāsadbhāvena tadupapatterityāśayavānpūrvapakṣaṃ tāvadāha- tathāpīti //

abhimānivyapadeśas tu viśeṣānugatibhyām | BBs_2,1.5 |

tathāpi mṛjjalādīnāṃ buddhivāgādivācakaḥ /
dṛṣṭavyāptiviruddhatvāt tatra mānaṃ kathaṃ bhavet // MAnuv_2,1.62 //


yadyapi phalavyabhicārādivirodho vedasya parihṛtastathāpītyarthaḥ /
mṛjjalādīnāmityādipadena tejaḥprabhṛtīnāṃ grahaṇam /
buddhirjñānaṃ, vāgvaktṛtvajñ /
ādigrahaṇena śrotṛtvādikam /
veda ityanuvartate /
dṛṣṭā pramitā vyāptiryasyā yukteḥ sā tathoktā /
vyāptigrahaṇaṃ pakṣadharmatāyā apyupalakṣaṇam /
kvacittanniyamānabhyupagamātsvaśabdenāsaṅkīrtanam /
tayā viruddhatvāt /
tatra mṛjjalādīnāṃ buddhivāgādau /
kathamityākṣepe /
pratipādyāntaraṃ tu nāstyapratīteriti śeṣaḥ /


*6,3f.*

etaduktaṃ bhavati /
"mṛdabravīt, āpo 'bruvan, tatteja aikṣata, tā āpa aikṣanta, ṛṇota grāvāṇo, viduṣo 'nuprāṇāḥ, ahaṃ śreyasi vyūdire, āpo vā akāmayanta'; ityādivedastāvanna pramāṇam, yuktiviruddhārthābhidhāyitvāt, nīlaṃ nabha itivat /
mṛjjalādīnāṃ buddhivāgādimattvaṃ khalvasyārthaḥ /
sa ca, vimatā mṛnna vaktrī mṛttvātsampratipannamṛdvadityādiyuktiviruddhaḥ /
tathāca vedavākyāntare 'pyaprāmāṇyamanumāsyate /


*6,4*

nanu"na vilakṣaṇatvāt'; ityanenaiva nyāyenāyamapi virodhaḥ pariharaṇīyaḥ /
maivam /
(tannyā)nyāyasañcārāviṣayatvāt /
tatra hi yathoktānuṣṭhāne 'pi phalavyabhicāraśceddhetuḥ tadā'pātatastāvatsandigdhaviśeṣaṇāsiddhiḥ /
kartrādivaiguṇyasyāpi sambhavāt /
nityatvena vedaprāmāṇyasya sthitau tu viśeṣaṇāsiddhiniścaya eva /
phalavyabhicāramātrasya hetutve tu anaikāntikatvamityevaṃ vyāptipakṣadharmatāvirahavyutpādanena yuktivirodhaḥ parihṛtaḥ /
na cāsyā yuktervyāptyādyaṅgavaikalyaṃ sambaddham /
prasiddhamṛdādau tathopalambhāt /
naca tatrāpi buddhayādisadbhāvaḥ, kadāpi tatkāryasyādaśarnāt /
nāpi sambaddhamapi vyabhicīrṇam /
vyabhicārānupalambhāt /
nacānupalambhamānavyabhicāramapi sopādhikam, upādheranirūpaṇāt /
buddhayādimattve ca mṛdādīnāṃ śarīrendriyavattāpi syāt /
akaraṇakakriyādarśanāt /
naca tadyuktamindriyādīnāmapi vaktṛtvādivadadarśanāt /
tato 'nukūlatarkasanāthenopādhivyabhicārānupalambhasahakṛtena sahabhāgagrāhakeṇa pramāṇena siddhā mṛttvādīnāmavaktṛtvādinā vyāptiḥ /
naca mṛdādiṣu mṛdāditvaṃ(mṛttvādikaṃ) nāstīti yuktam /
vyāghātāt /
mṛdabravīdityādiprayogācca /
tataḥ pakṣadharmatāpi siddhaiveti /


*6,8*

nanu ca nityatayā vedasya prāmāṇye vyavasthite tadviruddhāyā yukterevāprāmāṇyamucitamiti /
maivam /
vyāptipakṣadharmatopetāyā yukterapi niravakāśatvāt /
tataśca satpratipakṣatayā niścāyakatvābhāvenāprāmāṇyaṃ vedasya /

nanu prasiddhamṛdādipakṣīkāre siddhasādhanatā /
pakṣasapakṣabhedābhāvaśca /
sapakṣāntarasvīkāre tatra mṛttvādyabhāvaḥ /
jaḍatvasya hetūkaraṇe tvasiddhiḥ syāt /
tasmādādikālīnaṃ mṛdādikaṃ pakṣayitavyam /
naca tat pratyakṣādisiddhamiti veda evopajīvyaḥ /
tathāca dharmigrāhakapramāṇavirodhādaprāmāṇyaṃ yukteriti cenna /
vyāptyādimatyāstadasambhavāt /
ādikālīnamṛdādisvarūpaparavākyāntareṇaparidṛśyamānakāryaliṅgena dharmigrahopapatteḥ /

etena vaidike 'rthe yukteravakāśābhāvānna tadvirodhakatvamityapāstam /

tadevaṃ mṛdabravīdityādivedavākyānāṃ yuktiviruddhatvenāprāmāṇye vedatvāt"yato vā imāni (bhūtāni)'; ityādivākyānāmapyaprāmāṇyānna vedasamanvayena brahmaṇo jagatkāraṇatvasiddhiriti /


*6,13*

siddhāntamāha- tata iti //

tatastannāmakaḥ kaścit pumānanyo bhavediti /
yuktayāgamāvirodhena prāptamatrābhidhīyate // MAnuv_2,1.63 //


vedasya yukteśca niravakāśatvaṃ tata iti parāmṛśati /
tannāmako mṛdādināmakaḥ kaściditi asmadādyatīndriyatvamabhipraiti /
pumāṃścetano 'nyo 'smadādivilakṣaṇo 'ntardhānādiśaktimānbhavet /
asyāṃ śrutau vaktṛtvādinā pratipādyata iti śeṣaḥ /
itiśabdasya prāptamityanenānvayaḥ /
prāptaṃ pramitam /
yuktyāgamavirodhenetyarthāpattiṃ sūcayati /

tataścāyamarthaḥ /
na mṛdabravīdityādivākyānāṃ yuktivirodhenāprāmāṇyaṃ vaktavyam /
atra mṛdādiśabdasya cetanaviṣayatvāt /
tathāca tatpakṣīkāre hetorasiddheḥ /
śabdamātreṇa hetutve atiprasaṅgāt /
acetanamṛdādipakṣīkāre ca prakṛtāvirodhāt /

nanu kathaṃ cetaneṣu mṛdādiśabda(pra)vṛttiḥ /
abhidhānaśaktyeti brūmaḥ /
mṛdādyabhimānitvāt /
pṛthivyādiṣu tadabhimatatvena mṛdādiśabdapravṛttiḥ /
nanvete 'bhimāninaḥ kimabhimatārthavyāpinastadekadeśavṛttayo vā /
ādye('pi) sadehā videhā vā /
ādye tadupalambhaprasaṅgaḥ /
dvitīye teṣāmindriyābhāvena vaktṛtvādyanupapattau punaryuktivirodhatādavasthyam /
tṛtīye tadvaiyarthyam tadanadhiṣṭhitapradeśavat pradeśāntarapravṛttisambhavāditi /
maivam /
vyāpakānāṃ sadehānāmapi piśācādivadantardhānaśaktiyogādadṛśyatvopapatteḥ /


*6,16*

nanvevaṃ sati kalpanāgauravamāpadyeta /
keṣāñciccetanānāṃ mṛdādyabhimānitvaṃ tatastacchabdānāṃ teṣu vṛvirvyāpakatvaṃ sadehatvamantardhānaśaktistatparatā ca śruterityanekasya kalpyamānatvāt /
maivam /
arthāpattitaḥ sarvasyāsya siddhatvāt /
śrutirhi mṛdādīnāṃ vaktṛtvādikaṃ pratipādayati, yuktiśca tadabhāvam /
na(ca)vāstavo virodhaḥ sambhavati /
vastuvikalpāpatteḥ /
nacāyaṃ virodho vinaitatkalpanayā śāmyati /
jaḍasvīkāre yuktivirodhāt /
anabhimānisvīkāre ca pṛthak śabdaśaktau pramāṇābhāvāt /
avyāpakatvādyaṅgīkāre coktānupapatteḥ /
naca śrutiyuktyoranyatarāprāmāṇyenāpyupapadyata etaditi vācyam /
uktarītyā dvayorapi niravakāśatvāt /
nahi pareṇāpi vidveṣeṇaivāgamāprāmāṇyamabhidhātuṃ yuktam /
kinnāmopapattimāśrityaiva /
tathāca kathaṃ vedaprāmāṇye 'pi na dīyate dṛṣṭiḥ /
tadevaṃ yuktyāgamavirodhenāsyārthasya prāptatvānna kiñcitkalpanāgauravamiti /

nanvetadutsūtritaṃ kathamucyata ityata āha- atreti //


*6,16f.*

ityuktametatsarvam atra"abhimānivyapadeśastu viśeṣānugatibhyāmiti'; sūtre 'bhidhīyata ityarthaḥ /
yadvātrābhidhīyata iti siddhāntopakramavākyam /
tasyaivaṃ prāpte sūtrakṛtā samādhānamabhidhīyata ityarthaḥ /
evaṃ sūtramavatārya tata ityādinā vyākhyātamiti /
*6,18*


yaduktaṃ tannāmaka iti mṛdādiśabdavācyatvaṃ devatāyāstadanupapannam /
ayogādanuyogācca /
mṛdādiśabdāḥ khalvacetaneṣveva rūḍhāḥ /
na devatāyām /
lakṣaṇāśrayaṇenāpi śrutiyuktivirodhaśāntirbhaviṣyati /
nāpi vacanavṛttiṃ sūtrakṛdāhetyata āha- bālarūḍhimiti //

bālarūḍhiṃ vinaivāpi vidvadrūḍhisamāśrayāt /
tattannāmāna evaite tattadvastvabhimāninaḥ // MAnuv_2,1.64 //
santi ... // MAnuv_2,1.65a //



*6,19*

ete pṛthivīvaruṇādayastattannāmāna eva santi /
tāni tāni mṛdādīni nāmāni vācakāni yeṣāṃ te tathoktāḥ /
natu tāni lakṣakāṇītyevaśabdārthaḥ /
santi bhavanti /
ayogaparihārāya uktam- bāleti //
avidvadrūḍhyabhāve 'pi vidvadrūḍhisadbhāvāt /
mṛdādiśabdāstāvaddevatāviṣayā ityarthāpattisiddham /
mukhyāsambhava eva ca jaghanyavṛttirāśrayaṇīyā /
nacātra bādhakamastīti vaidikaprayogādeva bādhakābhāvasahitādvidvadrūḍhiravagamyate /
yaccoktaṃ vacanavṛttyaṅgīkāraḥ prakṛtānupayogīti tatparihārāyoktaṃ tattanmṛdādivastvabhimānina iti /

ayamarthaḥ /
mṛdādiśabdānāṃ cetanaviṣayatāmātreṇa prakṛtavirodhaśāntāvapi vastusthitiṃ vijijñāpayiṣatā sūtrakāreṇa vyapadeśastviti tuśabdena mukhyavṛttiḥ sūcitā /
tatropapattijñāpanāyābhimānīti coktam /
anyathā cenanavyapadeśa ityavakṣyat /
abhimānī khalvabhimatasya sattādeḥ prayojakaḥ /
tataśca tadadhīnatvāditi nyāyena sa eva (tanmu)mukhyārtha iti /
tadetat asmābhiḥ sūtraṃ vyākurvadbhirabhihitamiti /

nanvatra tannāmaka ityekavacanaṃ prakramya tattannāmāna iti bahuvacanaprayoge kinnimittam /
tathā bhāṣye 'pi"abhimānidevatā tatra vyapadiśyate /
tāsāṃ ca'; ityādi /
ucyate /
a(trā)bhimānivyapadeśa ityabhimāniśabdo hyekavacanāntaḥ samastaḥ /
vyapadeśaśabdasyaikavacanāntatvāt /
nahi bahūnāmeko vyapadeśa iti sambhavati /
uttarasūtre caikavacanameva /
ato yathāsūtraṃ prathamaṃ vyākhyātam /
athedānīṃ prā(pramā)ṇasaṃvādighaṭanāya jātāvidamekavacanamityāśayavatā bahuvacanaṃ prayuktamiti /


*6,23*

abhimānināṃ prādeśikatvavidehatvayorvaiyarthyavaktṛtvādyanupapattī /
vyāptānāṃ sadehatve 'nupalambhabādha ityetatparihārāya viśeṣānugatibhyāmiti sūtrakhaṇḍaṃ kaścidanya iti tātparyato vyākhyātam /
tatprapañcayati- teṣāmiti //

... teṣāṃ viśeṣeṇa śaktiranyebhya ucyate // MAnuv_2,1.65ab //

viśeṣeṇātiśayena /
anyebhyo 'smadādibhyaḥ /
vyāptiścocyata iti sambandhaḥ /
dehavattvasyāpyupalakṣaṇametat /
yadyapyetatsarvamarthāpattyaiva labdham /
anyathā virodhaśānterevāpayarvasānāt /
tathāpyucyata iti pṛthivyādyabhimāninya ityāgamamapyatra saṃvā(dayati)dinaṃ darśayati /
yadyapyatrākāṅkṣānusāreṇa vyāptimādāvuktvā śaktiviśeṣo 'nantaramabhidhātavyaḥ /
tathāpyalpāctarasya pūrvanipātamanusṛtya pravṛttaṃ sūtramanugacchatā kramo bhagnaḥ /


*6,24*

nanu ca pṛthivyādyabhimāninya iti vākyaṃ kathamupādeyam 'ātmani caivaṃ vicitrāśca hi', utkrāntigatyāgatīnāmityādyāgāmisūtreṇācintyaśakteḥ sarvagatatvasya ca viruddhatvādityata āha uktānusāreṇeti /

vyāptiścoktānusāreṇa ... // MAnuv_2,1.65c //

ātmani caivamityādyuktānusāreṇa śaktirvyāptiścocyata ityanvayaḥ /
syādayaṃ virodho yadi śaktirvyāptiśca niravadhikātrocyate /
na caivam /
pramāṇāntarānusāreṇāntardhānādiśakterabhimatārthavyāpteśca pratipādyatāṅgīkārāditi /


*6,25*

evamasmadādyapekṣayābhimānināmanupalambhamaṅgīkṛtya tadbādhaḥ parihṛtaḥ /
idānīmasiddhaścāsāvityāha- dṛśyante ceti //

... dṛśyante cādhikāribhiḥ // MAnuv_2,1.65d //

adhikāribhirantarhitārthadarśanasamarthairyogibhiḥ /
etacca (bhāṣyodā) udāhṛtasmṛtisiddham /
etena"dṛśyate ca'; iti sūtraṃ vyākhyātaṃ bhavati /


*6,26*

ye tu mīmāṃsakaṃmanyā vigrahavatī devatāṃ na sahante te 'pyanenaiva nirastā bhavanti /
arthāpattyā pratyakṣeṇa ca tatsiddheḥ /
samarthitaṃ cāgamānāṃ siddhārthe prāmāṇyam /
anupalambhaḥ anekatra yugapatsannidhānaṃ ca śaktiviśeṣādupapadyate piśācādivat /
naca piśācādayo 'pi na santi /
mantrauṣadhādināsmadādibhirapyupalabhyamānatvāt /
arthakriyayā saṃvādena ca prāmāṇyopapatteḥ /
vakṣyati ca sūtrakāro"devādivat'; ityuktvā tatrāpi vipratipannaṃ prati"api lokaḥ'; iti /

kiñcendrāgnivaruṇādipadaṃ kasyacidvācakaṃ padatvāt gopadavat /
nacācetanamātre tatprayogo 'sti /
naca cetano muktaḥ pralīno vā tadvācyaḥ /
jagadvayāpārasambandhinyapi prayogāt /
nacāsau vigrahavidhuraḥ sambhavatītyalam /


*6,29*

nanu tathāpi mṛdabravīdityādivedasyābodhakatvalakṣaṇamaprāmāṇyaṃ durnivāram /
tathāhi /
yadyapi vākyatāpannāni padāni vākyārthaṃ padārthānāmanyonyasaṃsargaviśeṣarūpamapūrvamevāvagamayanti, tathāpi padārthairvācyavācakabhāvarūpasambandhapratipattilakṣaṇāṃ vyutpattimapekṣante anvayavyatirekābhyāṃ tathāvadhāraṇāt /
naca mṛdādiśabdānāṃ pṛthivyādiṣu devatāsu vyutpattissambhavati /
sambandha(jñāna)sya sambandhijñānasāpekṣatvāt /
pratisambandhirūpāyāśca devatāyāḥ pratyakṣeṇa duradhigamatvāt /
liṅgābhāvenānumānāyogāt /
naca śabdatastadavagamaḥ /
satyāṃ vyutpattau śabdato devatāgamaḥ, sati ca tasminvyutpattiriti parasparāśrayatvāt /
naca śabdaviśeṣasyāgṛhītasaṅgatikasyaiva bodhakatvam /
adṛṣṭakalpanāprasaṅgāt /
yadyapi dṛśyate cetyuktam /
tathāpyasmadādīnāṃ vyutpatyanupapattireva /
devatādarśanaṃ tu (ca)yogināṃ vedārthajñānottarabhāvanājanyamaṅgīkriyata iti na vyutpattihetuḥ /
lakṣaṇāpi vācyārthadarśanaṃ vinānupapannaivetyata āha- śāstrokteti //

śāstroktavastunaścaiva vyutpattiḥ śāstraliṅgataḥ // MAnuv_2,1.66ab //

caśabdo 'pyarthaḥ /
evaśabdaḥ sāmarthyācchāstraśabdena sambandhanīyaḥ /
śāstraikasamadhigamyavastuna iti /
pratyakṣādyagamyāyā api devatāyā iti yāvat /
vastuno vyutpattirati mṛdādiśabdasya tatsambandhivācakatvapratipattirityarthaḥ /
yujyata iti śeṣaḥ /
anena ca evaśabdasya sambandhaḥ /
śāstraliṅgatastajjñānasambhavāditi śeṣaḥ /


*6,33f.*

yadvā śāstroktavastuno 'pi śāstraliṅgato 'dhigatisambhavāttatra śabdasya vyutpattiryujyata iti yojanā /
devatāyā

iti vaktavye śāstroktavastunaśceti vacanaṃ śaṅkānuvādarūpam /
śāstrameva liṅgaṃ śāstraliṅgam /
mṛdabravīdityādiśāstrādevopapattivirodhasahitānmṛdādiśabdavācyatayaiva devatāsvarūpamavagamyata iti /

*6,34*

yadvā śāstraṃ taistaiḥ praṇītaṃ tatsadbhāve liṅgam /
nahi vedādanyadvākyaṃ vaktāramantareṇopapadyate /
tataśca vacanaliṅgānumite vaktari vṛddhairanyānprati mṛdādiśabdāḥ śakyavyutpādanāḥ /

yadvā śāstraṃ śāsanam /
varṣaṇādyupalakṣaṇametat /
nahi varṣaṇādikriyā vikartṛkā sambhavati /
tathāca tayānumite katarri śakya(ta)nta eva vṛddhaiḥ śa(bdo)bdā vyutpādayitum /

athavā śāstroktaṃ liṅgamavyabhicarito dharmaḥ śāstraliṅgam /
pāśahastatvasahasrākṣatvādiśāstroktatattaddevatālakṣaṇānyupādāya vyutpādanaṃ śakyameva /
yathā khalu loke yathā mudgastathā mudgaparṇī, yathā māṣastathā māṣaparṇī, dīrghagrīvādimānpaśuruṣṣa iti lakṣaṇānyupādāya mudgaparṇītyār(ṇyā)diśabdā vyutpādyante, tathā yaḥ pāśahastatvādimānso 'bādiśabdārtha iti vyutpādanaṃ suvacana(kara)meva /
pāśādiśabdāstu lokata eva gṛhītasaṅgatayaḥ /
samāsasya vākyatvena vyutpattyanapekṣatvamiti na kaścidvirodhaḥ /

na kevalaṃ mṛdādiśabdānāmayaṃ vyutpattiprakāraḥ /
kinnāmātīndriye dharmādāvapi /
tataścaivaṃ vedaprāmāṇyamākṣipato 'tīndriyātharvyavahāramātravilayaprasaṅga iti sūcayituṃ śāstroktavastunaśceti sāmānyenoktam /


*6,36*

evaṃ tarhi kuṭilikeyaṃ vyutpattirdubarlā /
sākṣātkṛte tu mṛdādāveva prabalā tataśca devatānāṃ mukhyapratipādyatvamityayuktam /
kintu mṛdādīnāmeva /
vyutpattyanusāritvātpratipādanasyetyata āha- vyutpattiriti //

vyutpattiḥ sā balavatī mūrkhavyutpattitā hi yat // MAnuv_2,1.66cd //


*6,36f.*

seti /
yā viditaśabdaśaktibhirvṛddhaiḥ śāstraliṅgataḥ sampāditā /
mūrkhairaviditaśaktibhirvyutpāditā /
vyutpattirmūrkhavyutpattiḥ /
hiśabdo hetusūcakaḥ /
nahi vyutpattiviṣayasya parokṣatvamaparokṣatvaṃ ca vyutpatterdairbalye prābalye ca kāraṇam /
api tarhi vyutpādakasya (śabda)śaktitattvajñattvam /
tadanusāreṇa vyutpādanaṃ prābalye, anyattu daurbalye /
anyathaikhaṇḍe sākṣātkṛte candanaśabdasya vyutpattiḥ prabalā /
liṅgato 'pi jñāpite candane dubarleti syāt /
asti cedaṃ kāraṇaṃ prakṛte /
itīyameva prabalā netareti /
yat yasmāde(vaṃ)vaitat tasmāttattannāmāna evaita iti pūrveṇa sambandhaḥ /


*6,38*

nanvetadayuktam /
yadyuktivirodhena vedasya svārthātpracyāvanam /
tasya sakalapramāṇāpekṣayā ca prābalyam /
yatkvacitsvārthātpracyāvanaṃ tadupajīvyavirodha eva /
nacātra tathetyata āha- dṛḍheti //

dṛḍhayuktivirodhe tu sarvatra nyāya īdṛśaḥ // MAnuv_2,1.67ab //

virodhe vedasyeti śeṣaḥ /
ayaṃ bhāvaḥ /
śruterarthapracyāvanasyāyuktatāṃ vadataḥ ko 'bhisandhiḥ /
kiṃ viruddhayorevāprāmāṇyamutāgamaviruddhāyā yukteraprāmāṇyam /
nādyaḥ /
vastuvikalpaprasaṅgāt /
na dvitīyaḥ /
vyāptipakṣadharmatopetāyāstadayogāt /
kathaṃ tarhyupajīvyavirodhe tvityādyuktamiti cet /
upalakṣaṇatveneti brūmaḥ /
upajīvyaṃ khalu nopajīvyamityeva bādhakam /
kintu prabalatvena /
tadyadi yuktyantarasyāpi syāttadā kuto na bādhakateti /
yadvādhikaraṇopādhimanenāha /
na kevalamatrodāharaṇe /
kintu sarvatrāpi vedavākye pramitavyāptipakṣadharmatāvadyaktivirodhe satīdṛśa evānyathārthasvīkāreṇa virodhaparihāro nyāyaḥ prakāro draṣṭavya iti /


___________________________________________________________________________


[======= JNys_2,1.IV: asadadhikaraṇam =======]



*6,40*

// oṃ asaditi cenna pratiṣedhamātratvāt oṃ //
nanu ca(cā)nārambhaṇīyamevedamadhikaraṇam"na vilakṣaṇatvāt'; ityanenaiva vedasya sakalayuktivirodhānāṃ parihṛtatatvāt, dṛḍhayuktivirodhaparihārasya cābhimānyadhikaraṇanyāyasiddhatvāt, ityato gatārthatāṃ pariharannadhikaraṇasyopādhimā(pyā)ha- alpavākyeti //

asad iti cen na pratiṣedhamātratvāt | BBs_2,1.7 |

alpavākyayutā yuktirbahulaiva virodhinī // MAnuv_2,1.67cd //
yatra tatra kathaṃ vastunirṇayaḥ syāditīrite /
virodhiyuktibāhulyāditi nyāyo viniścitaḥ // MAnuv_2,1.68 //



*6,41*

yatra yadā vedasya vākyayutā yuktirvirodhinī syāt, tatra tadā, vastunirṇayaḥ kathaṃ syāt iti pūrvapakṣiṇerite sati tadvirodhiyuktīnāṃ bāhulyāt prābalyāt vastunirṇayo bhavediti siddhāntaḥ /
ityeṣo 'trādhikaraṇe nyāyo viniścitaḥ /

etaduktaṃ bhavati /
pūrvādhikaraṇe pratyakṣādigṛhītavyāptyādimattvena dṛḍhayā yuktyā viruddhatvādvedaikadeśasyāprāmāṇye sati taddṛṣṭāntena brahmaṇo jagatkāraṇatvābhidhāyakasyāpi vedasya vedatvādaprāmāṇye tadasiddhiriti pūrvaḥ pakṣaḥ /

siddhāntastu yuktivadvedasyāpyapauruṣeyatvena dṛḍhatvāt vāstavavirodhasyānupapatteḥ aviruddhātharkalpanopapatteḥ nāprāmāṇyamiti /


*6,42*

iha punarvedavākyāntarasaṃvādena sudṛḍhayā yuktyā viruddhatvādbrahmaṇo jagatkāraṇatvābhidhātrīṇāṃ śrutīnāmeva tatra prāmāṇyānupapattau prathamādhyāyoktavastunirṇayo na bhavediti pūrvaḥ pakṣaḥ /
siddhāntastu /
pūrvapakṣiṇotprekṣitābhyaḥ śrutisahitayuktibhyo 'pi prabalānāṃ tadvirodhiyuktīnāṃ sadbhāvāttadviruddhānāṃ pūrvapakṣaśrutiyuktīnāmaprāmāṇyādupapannataraḥ prāgukto 'rtha iti /

ataḥ pūrvottarapakṣanyāyayoragatatvena yukto 'dhikaraṇārambha iti /
etaccānupadamevodāharaṇena prapañcayiṣyāmaḥ /


*6,43*
nanvevaṃ sati śrutīnāṃ śrutiyuktivirodhaparihāro 'syādhikaraṇasyārtha ityuktaṃ bhavati /
so 'yaṃ caturthapādārtha eveti tatraivāsyādhikaraṇasyopanibandhanamucitam /
nātretyato 'sya tato 'pi vailakṣaṇyaṃ darśayitumuktamalpeti, bahuleti ca /
atrālpatvamupasajarnatvam, bahulatvaṃ (ca) pradhānatvamiti jñātavyam /
evaśabdastu"na guṇapradhānabhāvavyatyāsaścaturthapāda iva'; ityarthe /


*6,44*

nanu śrutiyuktibhyāṃ pūrvapakṣite kathaṃ prabalayuktimātrāśrayeṇa siddhāntaḥ /
kathañcitpratipakṣatāmātrasambhavādityata uktaṃ vivṛṇvannāha- yuktestviti //

yuktestu yuktibāhulyamāgamādāgamasya ca /
kathaṃ na nirṇayaṃ kuryād ... // MAnuv_2,1.69a-c //


pūrvapakṣayuktyapekṣayā virodhiyukterbāhulyam /
tathā pūrvapakṣāgamāpekṣayā virodhyāgamasya ca bāhulyaṃ kathaṃ nirṇayaṃ na kuryāt /
pūrvapakṣyutprekṣitayuktyāgamābhyāṃ prabalau virodhiyuktyāgamau tadbādhayā vastuvyavasthāṃ kuruta ityarthaḥ /
kuryāditi pratyekaṃ sambandhaḥ /
na kevalaṃ siddhānte prabalayuktimātraṃ, kinnāma prabalāgamo 'pyastīti bhāvaḥ /
iti ataḥ, adhikaraṇārambhaḥ sambhavatīti śeṣaḥ /
adhikaraṇopādhivyutpādanasamāptidyotako vā itiśabdaḥ /


*6,47*

tadidamudāharaṇaniṣṭhaṃ vyutpādayituṃ pūrvapakṣamanuvadati sūtrakāraḥ- asaditi cediti //
ayamasyārthaḥ /
na brahmaṇo jagatkartṛtvaṃ yuktam /
pramāṇābhāvāt /
"sadeva somyedamagra āsīttattejo 'sṛjata'; ityādiśrutirastīti cenna /
tasyā yuktiviruddhatvena bhavadabhimatārthe prāmāṇyābhāvāt /
tathāhi /
mahāpralaye tāvadutpatsyamānakāryaprāgabhāvo 'vaśyamaṅgīkaraṇīyaḥ /
anyathā sargādau

kāryotpādāyogāt /
nacāsyānyatra caritārthatopalabhyate /
tataśca sa eva sakalakāryakāraṇaṃ bhaviṣyati /

ayamatra prayogaḥ /
mahāpralayavartī kāryaprāgabhāvo mahadādikāyarkāraṇaṃ bhavitumarhati, anyatrānupakṣīṇatve sati niyamena tatpūrvabhāvitvāt, yo 'nyatrānupakṣīṇatve sati niyamena ya(taḥ)tpūrvabhāvī, sa tasya kāraṇam, yathā kuvindaḥ paṭasyeti /
mahadādikaṃ vā prāgabhāvakāryam ananyathāsiddhaniyatapaścādbhāvitvāt, yat yadananyathāsiddhaniyatapaścādbhāvi tat tatkāyarm /
yathā paṭaḥ kuvindasyeti /

nanvatra jagatprāgabhāvasya jagatkāraṇatvamātraṃ vā sādhyam, anyayogavyavacchedena vā /
ādye 'rthāntaratā, prāgabhāvasya kāraṇatve 'pi brahmakāraṇatāsambhavāt /
dvitīye vyāptyabhāvaḥ /
na hi"yo yadapekṣayā pūrvabhāvī, sa eva tatkāraṇaṃ, nānyaḥ'; iti niyamo 'sti /
tataḥ prāgabhāvasya jagatkāraṇatve 'pi tatsamānanyāyānāmīśvarādīnāmapi tatkāraṇatvamaṅgīkāryamiti /
maivam /
syādetadevam yadīśvarādīnāṃ pralaye sattvameva syāt /
nacaitadasti /
siddhāntinā kāraṇatvenāśāsyamānamīśvarādikaṃ pralaye 'sadbhavitumarhati bhāvatvānmahadādikāryavaditi yuktivi(ruddhatvatāt)rodhaḥ /
evañca(ñcedī) īśvarādīnāṃ pralaye 'sattvasiddhau prāgabhāvasya kāraṇatvamātrasādhane 'pi tasyaiva kāraṇatvamiti siddhayati /
nanu ca yatkāryaṃ tatsakartṛkamiti niyamānmahadādikartṛtveneśvaro 'vaśyamaṅgīkaraṇīyaḥ /
na /
pralaye tatsattā(ttvā)'bhāvasya pramitatvena prāgabhāvasyaiva jagatkartṛtvopapatteḥ /
na caitadanumānajātamudāhṛtaśrutiviruddhatvenāprāmāṇyamiti sāmpratam /
"asadevedamagra āsīt /
tadasadeva sanmano 'kuruta /
asataḥ sadajāyata'; ityādiśrutisaṃvāditvena śrutimātrataḥ prābalyāt /
prabalayuktiviruddhāyāśca śruteḥ svārthaparityāgasyātītādhikaraṇe sthitatvāt /
prāgabhāvasyāpi svarūpasattvādinā sadevetyādiprayogaviṣayatadvopapatteḥ /

*6,47f.*

nanu"etena sarve'; ityasadādiśabdānāṃ brahmārthatvamuktam /
tatkiṃ śabdānāmanyatra śaktireva nāsti, kiṃ vā śrutestatra tātparyābhāvaḥ /
nādyaḥ /
samākarṣāṅgīkārāt /
na dvitīyaḥ /
yuktyupatāyāstatra tātparyopapatteḥ /
tathāpi prāgabhāvasyaiva kāraṇatvaṃ kartṛtvaṃ ca na kvāpyupalabdhamiti cenna /
alaukikārthasya yathāgamaṃ grāhyatvāt /
santatotpattiprasaṅgastu brahmavādino 'pi samānaḥ /
icchādikāraṇānāṃ kādācitkatvena tatsamādhānaṃ mamāpi samānam /
ata eva śrutirāha"tanmano 'kuruta'; iti /
tat tasmāt, tattatprāgabhāvasyaiva tattatkartṛtvāduktamayuktamiti /
tadidamuktam- asaditi //
abhāvaḥ śrutyā jagatkartṛtvenocyate /
anumīyate ca tathā /
tasmātsa eva jagatkarteti /
atrāsacchabdo bhāvasādhanaḥ śrutyanugamārthamabhāve prayuktaḥ /


*6,54*

aparāpi vṛttiḥ /
bhāvatvahetunā kāryavadīśvarādikamapi pralaye 'sadanumīyata iti /
atrāsacchabdaḥ kartṛsādhanaḥ /
iha prathamāṃ vṛttimabhipretya neti siddhāntāṃśaṃ vyācaṣṭe(vyākhyāti)- asaditi //

... ityasat kāraṇaṃ na hi // MAnuv_2,1.69d //
śrutyartho bhavati ... // MAnuv_2,1.70a //


abhāva ityarthaḥ /
kāraṇamiti tadviśeṣaḥ kartocyate /
hītyanenedamāha /
upapattiviruddhastāvanna vedātharḥ sambhavati, tadaviruddhe 'rthe sambhavatītyuktam /
prakṛtaścopapattiviruddhaḥ /
tathāca vakṣyāma iti /
śrutyartho na bhavatītyupalakṣaṇam /
anumānaprameyamapīdaṃ na bhavatyupapattiviruddhatvādityapi draṣṭavyam /

kiñca sambhāvita eva śrutyartho vaktavyo 'numātavyaśca /
nacaivaṃ prakṛtaḥ /
kvāpyabhāvasya kartṛtvānupalambhādityāha- kvāpīti //

... kvāpi ... // MAnuv_2,1.70a //

asatkāraṇaṃ na hyanupalabdhamityanuvartate /


*6,60*

caturthapādasyādhikaraṇasya vailakṣaṇyaṃ darśayitumalpetyādyuktam /
tadaviśadam /
vailakṣaṇyajñānasyobhayasvarūpajñānādhīnatvāt /
ataścaturthapādārthaṃ darśayati- śrutīti //

... śrutiprāyopapattibhiḥ // MAnuv_2,1.70b //

śrutīnāṃ prāyo bāhulyam /
tatsahitābhirupapattibhiḥ /
śrutipradhānakopapattibhiriti yāvat /
avirodho virodhābhāvaḥ /
śrutīnāmiti śeṣaḥ /

yadvā śrutiprāyaśabdena śrutikalpatvamucyate /
śrutigṛhītābhirupapattibhirityarthaḥ /
atra tu svatantrābhiriti sphuṭameva /
athavātroktārthasyaiva tatra prapañcanānna doṣaḥ /
yathā prathamapādārthaprapañcanāt dvitīyapādasya ityāśayenoktaṃ samyagiti /
yadvā kvāpīti atra sambaddhayate /
tena kvāpyadhyātmalakṣaṇe viṣaye, atra tvanyatreti bhedaḥ sūcito bhavati /
yadyapyetatprāgeva vaktavyam tathāpyasatkāryamityādervakṣyamāṇasya, sūtrasya vyākhyānāntaratvadyotanāya vyavadhānenoktam /
anyathā pūrvameva vyākhyānam, idaṃ tu tadupapādanāyopayogīti vijñāyeta /


*6,63*

atha dvitīyāṃ vṛttimabhipretya"asaditi cenna'; ityetāvatsūtraṃ vyācaṣṭe- asaditi //

asat kāryaṃ yathā dṛṣṭaṃ vastutvāt kāraṇaṃ tathā /
iti cenna ... // MAnuv_2,1.71 //


kāryaṃ mahadādikam /
yathā pralaye 'sat pramitaṃ tathā vastutvādbhāvatvātkāraṇaṃ kāraṇatvena siddhāntināṅgīkṛtamīśvarādikamapi(miti)pralaye 'sadbhavitumarhatītyarthaḥ /

kuto neti cet /
na tāvadasmādevānumānādabhāvasya viśvakartṛtvasiddhiḥ /
kintvanena pralayāvasthāyāmīśvarādyabhāvasiddhau kāryasya sakartṛkatvaniyame sthite prāgabhāvasya niyatapūrvabhāvitvena viśvakāraṇatvaṃ siddhayan kartṛtayaiva setsyatīti vaktavyam /
tadidaṃ pratyanumānaparāhatamityāśayavān pratiṣedhamātratvaditi sautraṃ hetuṃ vyākuvarn sādhyamadhyāharati- niṣedheti //

... niṣedhaikasvarūpasya na kartṛtā // MAnuv_2,1.71cd //

niṣedhaikasvarūpasyeti hetugarbhaviśeṣaṇam /
ayamatra prayogaḥ /
vipratipanno 'bhāvo na kartā pratiṣedhamātratvāt niṣedhaikasvarūpatvāt sampratipannaghaṭābhāvavaditi /
kartṛtvamātrasyābhāve viśvakartṛtvaṃ dūrotsāritam /
naca dṛṣṭāntaḥ sādhyavikalaḥ /
anvayavyatirekābhyāṃ kulālādeḥ kartṛtvaniścaye tu abhāvasya tatkalpakābhāvāt /


*6,65*

nanvastu niṣedhaikasvarūpatvaṃ, kartṛtvaṃ ca ko virodhaḥ /
tathāca ghaṭādyabhāvasyākartṛtve 'pi pralayakālīno 'bhāvaḥ kartā bhaviṣyatītyataḥ kartṛtvaniṣedhaikasvarūpatvayovirredhaṃ sphorayituṃ kartṛtvasvarūpamāha- buddhīti //

buddhipūrvapravṛttirhi kartṛtvamiha niścitam // MAnuv_2,1.72ab //

pravṛttiḥ icchāprayatnādikā /
niścitaṃ sarvairapi parīkṣakaiḥ /
vṛkṣeṇa sthīyata ityādau kartṛtvaṃ pāribhāṣikaṃ na tu svābhāvikamiti hi sarve 'pi pratipannāḥ /

atra buddhipūrvapravṛttirityetadbuddhayā vivicya vyākhyeyam /
tathāhi /
syātkartṛniṣedhaikasvarūpatvayoravirodhaḥ, yadi tṛtīyādiviṣayatvameva kartṛtvaṃ syāt /
na caitadasti /
api tarhi icchāprayatnādirūpā pravṛttireva /
sarvairapi parīkṣakaistasyā eva kartṛtvena niścitatvāt /
prakaraṇāccaitadeva niścitam /
atraiva hi vipratipattirnānyatra /
sā ceyaṃ pravṛttirbuddhipūrvā buddhivyāptā /
kāryāyāḥ pravṛtterbuddhikāraṇakatvāt /
akāryāyāśca buddhivyabhicārādyadaśarnāt /
naca kartṛtvāparaparyāyāyāḥ pravṛttervyāpikā buddhirabhāve sambhavati /
tato vyāpyaṃ kartṛtvamapi na sambhavatyeveti kathaṃ kartṛtvaniṣedhaikasvarūpatvayorna virodha iti /

atra kartṛtvānuvādena buddhipūrvapravṛttiriti vyākhyānānniścitamiti napuṃsakopapattiḥ /
bhāve vā ktapratyaya iti /


*6,68*

nanu mā bhūdaprayojakatvaṃ hetoḥ /
tathāpi vaiyarthyamaparihāyarm /
abhāvaparyāyo hi pratiṣedhaśabdaḥ, kartṛtvaṃ ca kāryotpattyanukūlecchādiyoga ityuktam /
naca pratiṣedhatvaṃ kartari vartate, yenākartṛkaṃ vyabhicaret /
tannirāsārthaṃ ca viśeṣaṇaṃ sārthakaṃ syāt /
ataḥ pratiṣedhatvādityetāvatākartṛtvavyabhicārābhāvātsūtre mātragrahaṇaṃ vyākhyāne 'pyekagrahaṇaṃ vyarthamityata āha- pratiṣedheti //

pratiṣedhātmakatvaṃ tu bhāvasya- ... // MAnuv_2,1.72cd //

bhāvasyāpi kulālādeḥ kartuḥ pratiṣedhātmakatvaṃ vidyate /
ataḥ pratiṣedhatvādityu(tyevo)kte kulālādau, akartṛtvena hetoḥ, vyabhicāraḥ syāt /
tatparihārārthaṃ mātragrahaṇam /
tadvayākhyāne (ca) ekagrahaṇaṃ ca sārthakamiti /


*6,70*

nanu kulālāderbhāvasya kathaṃ pratiṣedhātmakatvamityata āha- abhāveti //

... -abhāvadharmataḥ // MAnuv_2,1.72d //

abhāvo 'trānyonyābhāvo vivakṣitaḥ /
sa dharmo 'syetyabhāvadharmā /
tasya bhāvastattvam /
tata iti bhāvapradhāno nirdeśaḥ /
asti khalu kulālāderbhāvasya bhedāparaparyāya(ḥ)pratiṣedhātmakaḥ anyonyābhāvo dharma iti /
Vyāsa-(16)

nanvidamasaṅgatam /
yaḥ kartā dharmī kulālādiḥ na tasya pratiṣedhātmakatvam, yaśca pratiṣedhātmako 'nyonyābhāvo na tasya kartṛtvamittaya āha- dharmeti //

dharmadharmaikyataścaiva ... // MAnuv_2,1.72e //

dharmadharmiṇoḥ kulālānyonyābhāvorekatvataḥ /
caśabdo hetusamuccaye /
abhāvadharmato dharmadharmyaikyataśca pratiṣedhātmakatvaṃ bhāvasyāstītyanvayaḥ /
evaśabdo bhedavyudāsārthaḥ /
anyonyābhāvo hi dharmiṇātyantābhinno 'bhyupeyate /
na tvayāvaddravyabhāvī dharma iva bhinnābhinnaḥ /


*6,71*

astvevaṃ pratiṣedhatvasya kulālādau vyabhicārastathāpi kathaṃ mātragrahaṇasya sārthakyam /
na hyaviśiṣṭavyabhicāra eva viśeṣaṇaṃ prayojayati /
tathātve viśeṣaṇaniyamānupapatteḥ /
kinnāma viśeṣaṇasya vyabhicāranirāsaupayikatve sati /
tadatra kathamityata āha- na tviti //

... natu tanmātratā bhavet // MAnuv_2,1.72f //


*6,72*

kulālādeḥ karturbhāvasya pratiṣedhatve 'pi(dhātmakatve 'pi)tanmātratā pratiṣedhamātratā na bhavet /
ato 'sti mātragrahaṇasya vyabhicāraparihāraupayikatvam /
tuśabdo 'vadhāraṇe sandigdhavyabhicāraparihārārthaḥ /


*6,72f.*

nanvevamekaṃ sandhitsato '(nyat)paraṃ pracyavate /
yato vyarthaviśeṣaṇatāparihāre svarūpāsiddhirāpannā /
tathāhi /
pakṣīkṛte abhāve prameyatvādidharmāḥ santi na vā /
neti pakṣe 'pramitāśrayatvādikaṃ hetoḥ /
ādye na tāvatte 'pyabhāvāḥ vidhipratyayaviṣayatvāt, pratiyogyanirūpyatvācca /
ṣaṭpadārthātiriktatvamabhāvatvamiti cenna /
svecchāparikalpanāyā anupādeyatvāt /
anyathā pañcaiva bhāvāstadatirikto 'bhāva iti kalpanāyāṃ samavāyāderapi bhāvatvaṃ na syāt /
te ca nābhāvāddharmiṇo bhinnāḥ /

anyonyābhāvasamānanyāyatvāt /
tathāca yathā kulālādervipakṣasya vidhiniṣedhātmakatvena pratiṣedhamātratvābhāvastathā pakṣīkṛthābhāvasyāpi (dharmadvārā vidhirūpasya) pratiṣedhamātratvābhāvātsvarūpāsiddho hetuḥ syāt /
dṛṣṭāntaśca sādhanavikalaḥ /
ghaṭābhāvasyāpi dharmadvārā vidhirūpasya pratiṣedhamātratvābhāvādityata āha- abhāvasya ceti //

abhāvasya ca bhāvo 'pi dharmo 'thāpi ... // MAnuv_2,1.73ab //

prathamāpiśabdātpūrvaṃ yadītyadhyāhāryam /
yadyapyabhāvasya pakṣīkṛtasya dṛṣṭāntīkṛtasya ca bhāvaḥ prameyatvādidharmo 'sti /
caśabdāddharmiṇā abhinnaśca /
bhāvasyābhāvadharma iveti vā /
athāpi na svarūpāsiddhayādidoṣa iti śeṣaḥ /


*6,74*

kathamityata āha- hi dharmiṇa iti //

... hi dharmiṇaḥ /
tādṛktavaṃ mātratehoktā ... // MAnuv_2,1.73b-c //



*6,75*

hiśabdo hetau /
tādṛktvaṃ pratiṣedhātmakatvam /
mātratā pratiṣedhamātratā /
iha sūtre /
etaduktaṃ bhavati /
syādayaṃ svarūpāsiddhayādidoṣo yadyatra pratiṣedhamātraśabdena kevalapratiṣedhatvaṃ vivakṣitaṃ syāt /
nacaivam /
kintu dharmadvāramantareṇa dhamirṇa eva pratiṣedhatvam /
tacca pakṣadṛṣṭāntayerastyeva /
tayodharrmadvāreṇa vidhitve 'pi dharmiṇoḥ pratiṣedhatvasyobhayasiddhatvāt /
vyāvṛttaṃ ca vipakṣātkulālādeḥ /
tasya dharmato niṣedhatve 'pi dharmi(ṇo) vidhitvā)ṇo 'niṣedhatvāditi /
nanu kathametallabhyate /
ucyate /
mātraśabdo hi sākalye vartate /
naca tat kvāpi sambhavati /
pratiṣedhe 'pi vidhisadbhāvasya pareṇaivoktatvāt /
tataḥ pratiṣedhamātraśabdo vidheraprādhānyaṃ lakṣayati,

annamātraṃ bhuktamiti yathā /
dharmadharmiṇośca, aprādhānyaṃ dharmasya, prādhānyaṃ dharmiṇaḥ /
tena dharmiṇaḥ pratiṣedhatvaṃ pratiṣedhamātratvamiti siddhayati /

icchāprayatnādirūpāyāḥ pravṛtteḥ kartṛtāparanāmikāyāḥ vyāpikā buddhiḥ abhāvādvayāvṛttā tāmapi vyāvartayatītyuktam /
tatrābhāvādbuddhivyāvṛttireva kuta ityata āha- buddhīti //

... buddhirāhityameva tat // MAnuv_2,1.73d //

tattasmātpratiṣedhamātratvādeva buddhirāhityamabhāvasya ghaṭābhāvavatsiddhayatītyarthaḥ /
dvividhaṃ hi prameyam svatantraṃ paratantraṃ ca /
paratantramapi dvividham bhāvo 'bhāvaśca /
bhāvo 'pi dvedhā cetano 'cetanaśca /
evañca yadā bhāvasyāpi kasyacinna caitanyaṃ, kā vārtā tadābhāve caitanyasya /
kaścidabhāvo buddhimān kinna syāditi cenna /
nirupādhikasambandhamanādṛtya nirnimittāyāḥ śaṅkāyā atiprasaṅgitvāt /
"tanmano 'kuruta'; iti śruteriti cenna /
anyathāsiddhatvāt /
atha pratiṣedhamātratvamapi pakṣe nābhyupeyāt /
tadāsaditi brahmeti ca saṃjñābhedamātram /
anekatvādeḥ pareṇāpi tyājyatvāt /
anekasvātantrye kāryodayāyogāt /

nanvidaṃ tatraiva vaktavyam /
satyam /
pratiṣedha(tva)mātratve vidite tato buddhirāhityapratīteḥ saulabhyādihoktam /
ṭīkākārastu prameyatvādibhāvadharmāṅgīkāre buddhirapi tathā kinna syāditi śaṅkāvakāśādihoktamityāhuḥ /


*6,80*

bhāvasyābhāvo dharmaḥ, abhāvasya ca bhāvo 'pi dharma ityanupapannam (bhāvasyābhāvadharmatā, abhāvasya ca bhāvadharmatetyanupapannam) /
bhāvābhāvayorabhāvabhāvadharmitve pramāṇābhāvāt /
sambandhābhāvācca /
sambaddhayoreva hi śauklayapaṭayordharmadharmibhāvo dṛṣṭo nāsambaddhayormarumandarayoḥ /
naca bhāvābhāvayoḥ sambandho 'sti /
saṃyogasamavāyayorbhāvaniyatatvāt /
viruddhasvabhāvatvācca /
yāvaviruddhasvabhāvau guṇaguṇinau tāveva hi dharmadharmiṇāvupalabdhau /
na viruddhasvabhāvāvaśvamahiṣau /
viruddhasvabhāvau ca bhāvābhāvau /
vidhiniṣedharūpatvāt /
abhedācca /
nahi ghaṭaḥ svayaṃ svasyaiva dharmo bhavati /
uktaṃ ca dharmadharmyaikyamityata āha- viśeṣyataiveti //

viśeṣyataiva dharmitvaṃ ... // MAnuv_2,1.74a //

viśeṣaṇataiva ca dharmatvamityapi draṣṭavyam /
yo hi viśiṣṭate vyavacchidyate sa tasya dharmī /
dharmaścāparaḥ /
prakārāntarasya nirvaktumaśakyatvāt /
pratīyate ca viśeṣyaviśeṣaṇabhāvo bhāvābhāvayoḥ /
anyathā ghaṭaḥ paṭo na bhavatītyabhāvaḥ prameya iti ca vyavahārānupapatteḥ /
tatkathaṃ bhāvābhāvayorna dharmadharmibhāvaḥ /
paṭaśoklayayośca na sambandhaprayukto dharmidharmabhāvaḥ /
nāpi merumandarayostadabhāvaḥ sambandhābhāvaprayuktaḥ /
kintu svabhāvādeva viśeṣyaviśeṣaṇatvātadabhāvarūpaḥ /
sambaddhayorapi ghaṭapaṭayostadabhāvavat, bhūtalaghaṭābhāvayostadbhāvācca /


*6,82*

evameva virodhisvabhāvābhedāvapi parā(nira)stau /
saguṇanirguṇatvena nityānityatvena vā viruddhasvabhāvayorapi guṇaguṇinordharmyāditvasya darśanāt /
adarśanācca paṭatvaśauklayayoḥ /
dṛśyate cābhede 'pi tadbhāvaḥ /
astitvābhidheyatvādīnāṃ dharmāṇāṃ parairdharmyabhedasyāṅgīkṛtatvāt /
bhinnānāmapi tadbhāvo nopalabhyate /
tadevamasambaddhayorapi vilakṣaṇasvabhāvayorapi bhāvābhāvayorabhede 'pi viśeṣaśaktyā viśeṣyaviśeṣaṇatālakṣaṇo dharmidharmabhāvo yukta eveti /


*6,84*

yadyevaṃ bhāvābhāvayorabhāvabhāvadharmitvaṃ dharmadharmiṇoścābhedaḥ syāt, tadā bhāvasyāpyabhāvatvenābhāvasya ca bhāvatvena, ghaṭādīnāṃ bhāvatvameva prākpradhvaṃsātyantābhāvānāmabhāvatvameveti niyamo nirnibandhanaḥ syāt /
nacaivamastviti vācyam /

sakalalokasiddhasya tathābhāvānarhatvāt ityata āha- prathameti //

... prathamapratipattiṣu /
niṣedhavidhirūpatvaṃ bhāvābhāvatvamatra hi // MAnuv_2,1.74b-d //


rūpaśabdo dharmivacanaḥ /
bhāvābhāvatvamiti yathāyogaṃ sambandhaḥ /
atraivaṃ satyapi /
hiśabdaḥ prasiddhau /
ayamarthaḥ /
kiṃ bhāvābhāvanibandhanaṃ prameyarūpamanviṣyate pramāṇaṃ vā /
ādyasyottarārdhamuttaram /
yadyapi bhāvābhāvātmakā ghaṭādayaḥ prāgabhāvādayaśca /
tathāpyatra padārthasārthe yaḥ piṇḍo vidhidharmiko ghaṭādiḥ sa bhāvo, yastu niṣedhadharmikaḥ prāgabhāvādiḥ so 'bhāva iti vyavasthopapadyate /
abhede 'pi dhamardharmibhāvo viśeṣaśaktyā saṅgacchata ityuktameva /
dvitīyasya uttaraṃ prathamapratipattiṣviti /

yaḥ prathamaṃ vidhitayā parapratikṣeparūpatāṃ vinā pratīyate sa ghaṭādirbhāvaḥ /
yastu niṣedhatayā parapratikṣepeṇa pratīyate prāgabhāvādiḥ so 'bhāva ityuttarārdhenaikavākyatayā yojyam /


*6,87*

ghaṭo hi prathamaṃ vidhitvena dharmirūpeṇa pratīto 'nantaraṃ paṭo na bhavatīti paṭaniṣedhātmatayā pratīyate /
prāgabhāvādirapi

prathamaṃ niṣedhatvena dharmisvarūpeṇāvagato 'nantaraṃ prameya iti vidhitayā pratīyata iti sakalapratipattṛsiddhamiti bahuvacanahiśabdābhyāṃ dyotayati /
viṣayiviṣayayorādhārādheyabhāvamabhipretya saptamīprayogaḥ /
kārakeṣu gauṇamukhyatvavivakṣābhāvasya sthitatvāditi /


*6,91*

evaṃ pūrvapakṣyutprekṣitapramāṇasamudāyalabdhasyārthasya pramāṇavirodho darśitaḥ /
idānīmasatkāryaṃ yathā dṛṣṭamityanumānaṃ viśeṣato nirācikīrṣustatprastāvanāya asūtrayatsūtrakāraḥ oṃ apītau tadvatprasaṅgādasamañjasamiti /
asamañjasametadviśvasyābhāvakartṛkatvamatam /
kutaḥ /
abhāvasya (eva) jagatkartṛtvāṅgīkāre 'pītau pralaye tadvatprasaṅgāt abhāvavattvaprasaṅgāt /
īśvarādeḥ sarvasyā(pya)bhāvābhyupagamaprasaṅgāditi yāvat /
na hīśvarādau sati tatparityāgenābhāvasya jagatkartṛtvamavadhārayituṃ śakyamiti /
nanu nedamaniṣyamīśvarādikaṃ pralaye 'sadbhavitumarhati /
bhāvatvāt ghaṭavadityanumāneneśvarādeḥ sarvasya pralaye 'bhāvābhyupagamādityatroktaṃ sūtrakṛtā"na tu dṛṣṭāntabhāvāt'; iti /
naiva pralaye sarvasyāsattvamaṅgīkartumucitam /
kasmāt dṛṣṭāntabhāvāt /
dṛṣṭānta iti tatrāvadhāritavyāptimūlamanumānamucyate /
dṛṣṭāntamātrasya sādhanabādhanānaṅgatvāt /
tathāca pralaye parameśvarādisadbhāva(sya) sādhakānumānasambhavādityarthaḥ /


*6,93*

kiṃ tadanumānamityata āha bhāṣyakāraḥ- sarvanāśeṣvapīti //


*6,94*

apītau tadvatprasaṅgād asamañjasam | BBs_2,1.8 |

sarvanāśeṣvapi sadā śiṣṭatvād yasya kasya nuḥ /
nāśo 'yaṃ vimato 'pi syānnāśatvāt kartṛśeṣavān // MAnuv_2,1.75 //


apirabhivyāptau /
sarvaśabdo vartamānamātravivakṣayāpi syādityataḥ sadetyuktam /
tadidaṃ vyabhicāraparihārāyābhihitam /
naḥ puruṣasya /
ayamityasyaiva vivaraṇaṃ vimata iti /
atra pūrvārdhena vyāptiruktā /
uttarārdhena pratijñāhetū /

etaduktaṃ bhavati /
mahāpralayalakṣaṇo nāśaḥ puruṣaśeṣavānbhavitumarhati nāśatvāt sampratipanna(sammata)nāśavaditi /
atra puruṣāvaśeṣamātraṃ sādhyam /
natu nāśakartuḥ puruṣasyāvaśiṣyatā /
ata evoktaṃ yasya kasyeti /
nāśasya karturakarturvetyarthaḥ /
tathāpi kartṛśeṣavāniti vadatedamabhipretam /
pralaye puruṣasadbhāvamātrasādhane sati bhagnaṃ tāvatparasyānumānam /
yadapi parasyābhāvakartṛkatvaṃ jagato 'bhimatam /
tadapyata evāpāstam /
avaśiṣyasya puruṣa(viśeṣa)syaiva viśvakartṛtvasambhave 'bhāvasya tatkalpanānavakāśāt /
dṛṣṭānusāriṇī hi kalpanā /
nahi loke prāgutpatteḥ kulālābhāvayoḥ satorabhāvo ghaṭasya kartā dṛṣṭaḥ /
kinnāma kulāla eveti /


*6,96*

abhiprāyamajānānaḥ kartṛśeṣavānityuktvā vibhrāntaścodayati"yatra sundopasundanyāyenāśeṣā api puruṣā naṣṭāstatra nāśatvahetoranaikāntikatā'; iti, tatrāha- naceti //

nacāśeṣanṛnāśastu dṛṣṭo dṛśyo 'sti vā kvacit // MAnuv_2,1.76ab //

caśabdo 'vadhāraṇe /
aśeṣanṛnāśastu naiva kvaciddṛṣṭa ityatītaniṣedho, dṛśyo vā naivetyanāgatasya, naivāsti vā dṛśyamāna iti vartamānasya /
idamuktaṃ bhavati /
anaikāntikatvaṃ hi pramite vipakṣe hetuvṛttau satyāṃ(hetuvṛttyā) vaktavyam /
nāpramite /
tathā satyanaminamātrocchedaprasaṅgāt /
nacāśeṣapuruṣanāśaḥ kālatraye 'pi pramitaḥ, yena nāśatvasya tatra vyabhicāraḥ syāt /
pramitatvāṅgīkāre ca pramāturevorvaritatvena vyāghātaśca syāt /
naca nāśakartuḥ puruṣasyāvaśiṣyatā sādhyatveneṣyā /
yena sundopasundādināśaḥ pratyudāhriyeta /
kintu puruṣa(vi)śeṣavattvamātramiti /


*6,97*

anena pralayakālaḥ puruṣavānkālatvādidānīntanakālavadityapyanumānaṃ sūcitam /
naca tadā kālābhāvādāśrayāsiddhiḥ /
tathā sati tadetyeva vaktumaśakyatvāt /
parakīyānumāne ca pralayaviśeṣaṇānupapatteḥ /


*6,99*

yadyapyatra"kālo 'ṅgīkriyate na vā /
ādye tatraiva bhāvatvahetorvyabhicāraḥ /
dvitīye pralayaviśeṣaṇānupapattiḥ /
sakalakāryavināśaviśiṣṭakālasya pralayatvāt /
atha kāryavināśa eva pralayastathāpīśvarābhāvasya tena sambandhābhāvādīśvarādikaṃ pralaye 'saditi pratijñārthānupapattiḥ /
deśādidvārā sambandhābhyupagame tatraiva bhāvatvasya vyabhicāraḥ /
pralayaviśeṣaṇaparityāge tacchiṣyairevohyatāmiti na sūtrabhāṣyakārābhyāmabhihitam /
sūcitaṃ cāpītāviti sūtrakṛtā /
"laye mānaṃ ca kiṃ bhavet'; iti bhāṣyakṛtāpi /


*6,100*

tadidaṃ jīveśvarasādhāraṇamanumānamuktam /
idānīṃ pralaye jīvasadbhāvasādhakamanumānamāha- dharmeti //

dharmādharmāśrayatvena svīkāryo 'pi naro laye // MAnuv_2,1.76cd //


*6,100f.*

na kevalamuktānumānena /
kinnāma dharmādharmaśrayatvenāpīti sambandhaḥ /
naro jīvātmā /
ayamatra prayogaḥ /

pralayakālavartī dharmaḥ sāśrayaḥ dharmatvādidānīntadharmavat /
evamadharmamapi pakṣīkṛtya prayoktavyam /
naca dharmādharmāśrayo jīvātmano 'nyaḥ sambhavati /
evañca pralaye jīvātmasadbhāvādbhāvamātrāsattvasādhanamanupapannamiti /
yatreśvarasadbhāvasādhanamidam /
āśrayaśabdasyādhiṣṭhātṛparatvāt /
tatraivaṃ prayogaḥ /
pralayakālavartinau dharmādharmau kenacidadhiṣṭhitau /
kāraṇatve satyacetanatvāt /
vāśyādivaditi /
nacātīndriyayordharmādharmayoradhiṣṭhātṛtvamīśvarādanyasyopapadyate /
ato dharmādharmādhiṣṭhātṛtvenāpi naraḥ paramapuruṣo laye svīkārya iti /


*6,103*

nanu pralaye bhāvamātrasyāsattvamabhyupagacchato mama tadā dharmādharmāvapi na sta evetyāśrayāsiddhiriti /
idamiha vaktavyam /
kiṃ dharmādharmasaṃjñitamadṛṣṭamasti kāryamātrasya kāraṇaṃ ca bhavatītyabhyupagamya pralaye tadabhāvo 'bhīdhīyate, uta sadapi tadakāraṇamityabhyupetya, atha tadeva nāstītyaṅgīkṛtya /
ādyaṃ dūṣayati- anāditvamiti //

anāditvaṃ vinādṛṣṭaṃ kathaṃ syāt kāraṇaṃ kvacit // MAnuv_2,1.77ab //

anāditvamivānāditvaṃ pralaye sattvamityarthaḥ /
kvaciditi sṛṣṭikāle /
yadyadṛṣṭaṃ pralaye na syāttadā'dikālīnasya kāryasya kāraṇaṃ na syāt /
asataḥ kāraṇatvāyogāt /
tathāca sarvotpattimatāṃ nimittamityabhyupagamo bhagna ityatharḥ /

syādetat /
adhunātanakāryamadṛṣṭakāraṇakaṃ na tvādikālīnamiti mamābhyupagamaḥ /
tatkimadṛṣṭasya pralaye sadbhāvenetyata āha- anāditvamiti //
anāditvaṃ vinā tata evādikālīnakāyarkāraṇatvaṃ ca vinādṛṣṭaṃ kvacidadhunātane 'pi kārye kāraṇaṃ kathaṃ syāt /
na kathañcit /
adhunātanaṃ kāryam adṛṣṭakāraṇakaṃ na, kāryatvādādikālīnakāryavadityanumānasambhavāt /
na cedidamiva tadapyadṛṣṭakāryamevāṅgīkāryamiti /

yadvā mā bhūdādikālīnasya kāryasyādṛṣṭaṃ kāraṇam /
tathāpi pralaye tadbhāvo 'ṅgīkaraṇīyaḥ /
kutaḥ /
anāditvaṃ pralaye sattvaṃ, vinādṛṣṭaṃ kvacididānīntane 'pi kārye kāraṇaṃ kathaṃ syāt /
antarāla evādṛṣṭotpattyayogāditi yojyam /


*6,105*

nanvadṛṣṭasya sarvotpattimannimittatve 'pi na pralaye sadbhāvo 'bhyupagantavyaḥ /
ādikāla evotpannasyāpi mahadādikāraṇatvopapatteriti /
idamatra vaktavyam /
tadādikāle janimadadṛṣṭaṃ tataḥ pūrvādṛṣṭādutpadyate na veti /
ādyamupādatte- pūrveti //

pūrvādṛṣṭāt parādṛṣṭaṃ yadi naivottaraṃ kutaḥ // MAnuv_2,1.77cd //

jāyata iti śeṣaḥ /
pariharati- naiveti //
evaṃ tarhi taduttaramādikāle janimadadṛṣṭaṃ naivāsmābhiḥ pakṣīkriyate /
kintu tatkāraṇaṃ pralayakālīnaṃ pūrvādṛṣṭameveti kuta āśrayāsiddhiriti /

dvitīyamupādatte- pūrveti //
naivotpadyata iti śeṣaḥ /
dūṣayati- uttaramiti //
tarhi taduttaramādikālīnamadṛṣṭaṃ kuto jāyate /
na kutaścit /
sarvotpattimannimittasyādṛṣṭasyābhāvādādikālīnādṛṣṭotpattireva na syādityarthaḥ /


*6,105f.*

na brūmo vayaṃ sarvaṃ kāryamadṛṣṭajanyamiti /
kiṃ tarhyādikāle janimato mahadādikāraṇādadṛṣṭādanyadevāto noktadoṣa ityāśaṅkāmutthāpya dūṣayati- pūrveti //
yadi parādṛṣṭaṃ sṛṣṭayupakrame janimatpūrvādṛṣṭānnaivotpadyate /
api tvadṛṣṭanirapekṣameva /
tarhyuttaramahadādikāyarmapi kuto 'dṛṣṭādutpadyata ityaṅgīkaraṇīyam /
adṛṣṭavattasyāpyadṛṣṭinirapekṣatvasambhavāt /
anyathā kāryatvādadṛṣṭasyāpyadṛṣṭāpekṣāṅgīkāryeti /


*6,107*

astu tarhyadṛṣṭaṃ kāraṇameva na bhavatīti dvitīyaḥ pakṣaḥ, adṛṣṭameva nāstīti tṛtīyo vā, ubhayasyāpyanupalambhāt /
tathācāśrayāsiddhiraparihāryetyāśaṅkayāha- adṛṣṭamiti //

adṛṣṭaṃ kāraṇaṃ no cellaye mānaṃ ca kiṃ bhavet // MAnuv_2,1.78ab //

yadi pratyakṣeṇānupalambhādadṛṣṭaṃ na syāt /
sadapi vā kāraṇaṃ na syāt /
tadā laye ca kiṃ mānaṃ bhavet /
pralayo 'pyaprāmāṇikatvānna syāt /
na hyasāvapi pratyakṣeṇopalabhyate /
tathāceśvarādikaṃ pralaye 'sadbhavitumarhatītyaprasiddhaviśeṣaṇaḥ pakṣaḥ parasyāpi syāt /


*6,108*

atha matam /
kālaviprakarṣādanupalabha(bhya)māno 'pi pralayo 'numānasiddhatvādaṅgīkaraṇīyaḥ /
tathāhi /
viśvasantāno 'yaṃ dṛśyasantānaśūnyaiḥ samavāyi(ntāni)bhirārabdhaḥ santānatvāt āraṇeyasantānavat /
vartamānabrahmāṇḍaparamāṇavaḥ pūrvamutpāditasajātīyasantānāntarāḥ nityatve sati tadārambhakatvāt pradīpaparamāṇuvat /
sarve santānāḥ kadācitsahocchidyante santānatvāt pradīpasantānavat /
sarva eva paramāṇavaḥ kadācitsamagropādeyaprabandhaśūnyāḥ ārambhakatvāt naṣṭapavanārambhakaparamāṇuvat /
bhūgolakasantānaḥ kadācitsākalyenocchidyate santānatvāt dīpasantānavat /
iyaṃ kriyā svānyāvayayikālīnatvānadhikaraṇakiñcitkālīnakriyānyā kriyātvādanyakriyāvaditi /

evaṃ tarhi dharmādharmāvapi svarūpato viprakṛṣṭatvādanupalabhyamānāvapi devadattaśarīrādikaṃ devadattaviśeṣaguṇajanyaṃ kāryatve sati devadattabhogahetutvāt devadattaprayatnajanyasragādivadityādyanumānena vicitrakāryānyathānupapattyā,"jyotiṣyomena svargakāmo yajeta',"yo brāhmaṇāyāvagurettaṃ śatena yātayā(ye)t'; ityādiśrutasādhyasādhanabhāvānyathānupapattyā vā siddhatvādabhyupagantavyāviti samaṃ samādhānam /


*6,117*

atha manyase /
nānumānādinā dharmādisiddhiḥ /
tasyābhāsatvāt /
tathāhi /
devadattaśarīrāderdevadattaviśeṣaguṇajanyatvaṃ kiṃ sākṣātsādhyamuta paramparayā /
nādyaḥ /
dharmādharmayorapyārambhakapreraṇādirūpeṇaivopayogāṅgīkārāt /
devadattaśarīraṃ na sākṣāddevadattaviśeṣaguṇajanyaṃ śarīratvādyajñadattaśarīravaditi satpratipakṣatvācca /
dvitīye tu janmāntarīyaprayatnārādhitadevatādvāreṇopapatterarthāntaratā /
devadattaviśeṣaguṇajanyatayā vināpi ākāśāderiveśvarecchayā devadattasya bhogahetutā sambhavatītyaprayojakatā ca /
kāryavaicitryaṃ ca dṛṣṭakāraṇavaicitryādevopapadyate /
ādikālīnaṃ ca tattatprāgabhāva eva vaicitryāṅgīkāreṇa /
svagaryāgādeḥ sādhyasādhanabhāvaśravaṇaṃ tvasiddhameva yogyatāvirahāt /
anyathākhyātimāśrityābhyupagame 'panyathāsiddham /
yāgādyārādhitāvajñātadevatādvāreṇa svargādyupapatteriti /


*6,118*

evaṃ tarhi pralayasādhakānumānānāma(pya)bhāsatvānna taistatsiddhiriti tulyamuttaram /
tathā hi /
vimataḥ kālo 'vayaviyuktaḥ kālatvādidānīntanakālavat /
vimato brāhmaṇo brāhmaṇapūrvako brāhmaṇatvātsammatavadityādinā satpratipakṣaṃ tāvaduktānumānajātam /
nanu pralayakālapakṣīkṛtāvāśrayāsiddhiḥ /
anyathā siddhasādhanam /
evamādyabrāhmaṇapakṣīkāre 'nyathā ca doṣa iti cenna /
parvato 'gnimānityādāvapyagnimadanagnimatpakṣadūṣaṇasambhavena sarvānumānocchedaprasaṅgāt /
nanvagnimattvadivyarirekeṇāpyasti parvatādeḥ svarūpaṃ, śakyaṃ ca viśeṣāntareṇāvadhārayitum /
tatkathaṃ doṣāvakāśa iti cet /
tatkimavayavisambandhāsambandhau vihāya kālaviśeṣasya svarūpameva nāsti, brāhmaṇavyaktervā'dyatvānādyatve vihāya /
avadhāraṇaṃ ca kālāderhiraṇyagarbhāpavargottarar(gānantara)bhāvitvādinā bhaviṣyati /


*6,126*

kiñca prathamaprayoge viśvaśabdena kiṃ brahmāṇḍamabhipreyate sakalakāryāṇi vā /
nādyaḥ /
aśrayāsiddheḥ /
pralayamanabhyupagacchatā brahmāṇḍasyānaṅgīkṛtatvāt /
brahmāṇḍābhāve 'pi kāryāntarāvasthitisambhavena pralayāsiddheśca /
kapikapolāntargataudumbarodaravartimaśakaśarīrādivatkāryāntarāvasthānamasambhāvitamiti cenna /
kuṇḍabadaravadupapatteḥ /
kālāgnirudrādiprakriyāyā asiddhatvāt /
dvitīye 'pi na pralayasiddhiḥ /
yathā hīdānīntanānāṃ dahanapavanasantānānāṃ krameṇāstamaye 'pi na pralayastathā tarugiriśarīrādisantānānāmapi kramārambhasiddhāvapyavayaviśūnyasamayā siddheḥ /
athaikadaiveti viśeṣaṇamupādīyeta tadā kramārabdhadahanapavanādisantānairvyabhicāraḥ syāt /
ekadarambhakahetusākalye satīti hetuviśeṣaṇe viśeṣaṇāsiddhiḥ /
dvayaṇukādikrameṇārambhasvīkāreṇa bādhādiprasaṅgaśca /

etena dvitīyānumānamapi nirastam /
brahmāṇḍānabhyupagamāt /
abhyupagame 'pyavayavānāmāvāpoddhārābhyāmevotpādavināśayorupapatteḥ /
kāryāntarāvasthānopapatteśca /
tṛtīye 'pyapasiddhāntaḥ /
krameṇocchedasyābhyupagamā(tatvā)t /
caturthe 'pi paṭādibhyaḥ pūrvavinaṣṭaistantvādibhivyarbhicāraḥ /
paramāṇutvena hetuviśeṣaṇe 'pi dvayaṇukādyavasthānasambhavena dṛṣṭāntasya sandigdhasādhyatā /
pañcame 'pi kiṃ bhūgolakā eva santānaśabdenocyante tadatirikto vā kaścit /
ādye siddhasādhanam /
avayavānāmāvāpoddhārābhyāṃ santatotpattivināśasiddheḥ /
dvitīye tvāśrayāsiddhiḥ /
ṣaṣṭhaṃ tvābhāsasamānayogakṣematvādupekṣaṇīyamiti /


*6,133f.*

atha mā bhūdanumānaiḥ pralayasiddhiḥ, tathāpyāgamairbhaviṣyati, teṣāṃ siddhārthe 'pi prāmāṇyasya sādhitatvāt, tato nāprasiddhaviśeṣaṇateti brūṣe, tarhyasmākamapi dharmādisiddhirāgamādbhaviṣyatīti kathamāśrayāsiddhiriti /
evaṃ pralaye jīveśvarasadbhāvaṃ sādhayatā dharmādisattvamapi sādhitamiti na pralaye bhāvamātrāsattvasādhanaṃ yuktam /
evam ādikāryaṃ pakṣīkṛtya sopādānatvasādhane prakṛtyādisiddhirapi draṣṭavyeti /


*6,135*

prathamasūtre 'bhāvasya kartṛtvanirāsāyānumānamuktam /
idānīmito 'pi nābhāvakartṛkaṃ jagat, cetanakartṛkatve"dṛṣṭāntabhāvāt'; iti sūtrasya vṛttyantaramabhipretya cetanakartṛkatve anumānamāha- utpattīti //

utpattināśakārī hi buddhimān dṛśyate kvacit // MAnuv_2,1.78cd //
taddṛṣṭāntena sarvatra kartā kiṃ nānumīyate // MAnuv_2,1.79ab //


buddhimānutpattināśakārīti buddhipūrvaṃ tatkartetyarthaḥ /
kvacitpaṭādau /
sarvatra vipratipanne kārye /
mahadādikārya ityevokte 'ṅkurādau vyabhicāraḥ śaṅkayeta, tadarthaṃ tasyāpi pakṣanikṣepārthaṃ sarvatretyuktam /
kartā buddhimāniti śeṣaḥ /
anyathābhāvakartṛtvavādinaṃ

prati siddhasādhanatāprasaṅgāt /
kimākṣepe /
ananumāne na kimapi kāraṇam /
dṛṣṭāntābhāvena pratipakṣāsambhavādityarthaḥ /

etena"svapakṣadoṣācca'; iti sūtramapi vyākhyātaṃ bhavati /
ayamatra prayogakramaḥ /
vimataṃ kāryaṃ cetanotpādyaṃ kāryatvādghaṭavat /
cetanavināśyaṃ ca tata eva tadvadeva /
vimatotpattiścetanakartṛkā utpattitvātpaṭotpattivat /
vimato vināśaścetanakartṛko vināśatvātsammatavaditi /
atra vināśasya cetanakartṛkatvasādhanaṃ prāsaṅgikam /
yadvā kecitkāraṇasya bījādeḥ pradhvaṃsenāṅkurādeḥ janmadarśanāttantvādināśena paṭādināśadaśarnācca pradhvaṃsābhāvasyaiva jagajjanmavināśakartṛtvamāsthitāḥ /
yathoktam /
nānupamṛdya prādurbhāvāditi /
tanmataṃ vātrāsadityādisūtrairnirākṛtamiti jñāpanārtham /
dṛṣṭāntābhāvastu svayamūhanīyaḥ /


*6,138*

nanvidamanumāneneśvarasya jagatkartṛtvasādhanaṃ sūtrakārasya uktaviruddham /
śāstrayonitvāditīśvare 'numānaprāmāṇyasya svayameva nirākṛtatvādityata āha- āgameti //

āgamānugṛhītā tu mānam ... // MAnuv_2,1.79cd //

anumeti vakṣyamāṇamatrāpi sambaddhayate /
na sarvathāpīśvare 'numānasya prāmāṇyaṃ sūtrakṛtā nirākṛtam /
kinnāmāgamānanugṛhītasya /
āgamānugṛhītā tvanumā īśvare mānamevābhimatā /
anyathā vedavākyārthe yuktyanusandhānarūpajijñāsā nārabheteti /

kimato yadyevamityata āha- eṣeti //

... eṣānumāpitu // MAnuv_2,1.79d //

āgamānugṛhītetyanuvartate /
mānamiti ca /
eṣā sampratyupanyastāpyanumā"yato vā imāni bhūtāni'; ityāgamānugṛhītā /
tato bhavatīśvare mānamiti na kaścidvirodha iti /


*6,140*

evamanumānenābhāvakartṛkatvaṃ viśvasyāśaṅkayānumānenaiveśvarakartṛkatvaṃ samarthitam /
tadetanmatāntareṇākṣipya samādadhatsūtram oṃ tarkāpratiṣṭhānādapyanyathānumeyamiti cedevamapyanirmokṣaprasaṅgaḥ oṃ iti //
tatrākṣepasyāyamarthaḥ /
nāyamanumānāvaṣṭambhena pūvarpakṣaḥ pramāṇena ca siddhānto bhavati /
na cānumānaṃ nāma pramāṇamasti /
(kutaḥ) /
anyathāpyanumeyam /
asatpratipakṣatvaṃ hyanumānaprāmāṇyavādibhiranumānāṅgamaṅgīkaraṇīyam /
pratiruddhasya karaṇasya kvāpi kriyāniṣpādakatvādarśanāt /
anumānapratipannaṃ cānyathāpyanumeyam anumātuṃ śakyam /
kasmāt /
tarkāpratiṣṭhānām /
"evamevānumātavyam, na punaranyathā'; iti tarkasya vyavasthābhāvāt /
tathā coktam /
"upādhipratipakṣau tu kva nāmātīva durvacau'; iti /

nanvidaṃ vyadhikaraṇaṃ, tarkasyāpratiṣṭhitatvādanyathānumeyamiti /
maivam /
etadanena jñāpayati sūtrakāraḥ,"na tarko 'numānādbhidyate'; iti /
athavā tarkasyānumānasyāpratiṣṭhānādapramāṇatvānnānumānena pūrvottarapakṣau yuktau /
kathamapramāṇatvāt /
yato 'nyathānumeyamiti yojanā /

tatra samādhānasūtraṃ saṅgamayitumutsūtrameva bhāṣyakārastāvaduttaramāha- āgameti //

tarkāpratiṣṭhānād apy anyathānumeyam iti ced evam apy anirmokṣaprasaṅgaḥ | BBs_2,1.11 |

āgamānugrahābhāve na tarkaḥ syāt pratiṣṭhitaḥ // MAnuv_2,1.80ab //
āgamagrahaṇaṃ pramāṇamātropalakṣaṇam /
ata evottarārdhe 'kṣajamapi saṅgṛhītam /
pramāṇānugrahapramāṇamūlatvaśabdābhyāṃ pratiṣṭhitaprāmāṇyapramāṇāntarāvadhṛtapakṣaliṅgavyāptimattvaṃ tatsaṃvāditvaṃ cocyate /


*6,142*

tatrādyayojanāyāmasyāyamarthaḥ /
yaduktamanumānasyāvyavasthitatvena sarvatra pratyanumānasambhava iti tadanupapannam /
yataḥ pramāṇānugrahābhāve tarko na pratiṣṭhitaḥ syāt /
kintu pramāṇamūlasyaivāsya pratiṣṭhitiḥ syāt /
etaduktaṃ bhavati /
pratyanumānaṃ bhavatkiṃ pramāṇānugraharahitaṃ syāt, uta tanmūlam /
ādyaṃ tu kathaṃ svayamadṛḍhabhūmikaṃ paraṃ pratirundhyāt /
nahi bhavati tarakṣoḥ pratipakṣo hariṇaśāvaḥ /
kintvādyenaiva pramāṇamūlena bādhyate /
dvitīyaṃ tu syādeva pramāṇam /

ādyaṃ cāpabādheta /
ubhayathāpi na sarvānumānāprāmāṇyam /
yada tūbhayoḥ api pramāṇamūlatvasandehaḥ tadāstu pratirodhaḥ /
kintu naivaṃ sarvatra /
avadhāraṇāyāṃ tu pūrvaiva gatiriti /


*6,144*

dvitīyayojanāyāṃ tu praṣṭavyam /
kiṃ pramāṇānugraharahitamanumānaṃ pratyanumānaparāhatatvādapramāṇam, uta tanmūlam /
ādye sampratipattimuttaramāha- āgameti //
(tathāpi) naivaṃ sarvatreti bhāvaḥ /
pratiṣṭhitaḥ pramāṇabhūtaḥ /
dvitīye tvāha- akṣajeti //

akṣajāgamamūlasya syādevāsya pratiṣṭhitiḥ // MAnuv_2,1.80cd //

pratiṣṭhitaḥ prāmāṇyam /
tenaiva pratiprayogasya bādhitatvāt /
ubhayorvāstavapramāṇamūlatvāsambhavāditi bhāvaḥ /

yastvetāṃ vyavasthāmanabhyupagamya sarvatrāpi pratipakṣasyāstyavakāśa iti sarvamanumānamapramāṇamiti ca manyate tasya sūtrārūḍhamuttaramāha- anyatheti //

anyathāsyāpratiṣṭhā ca svavācā vyāhataiva hi // MAnuv_2,1.80ef //

etenaivamupapādite 'pi yo naivaṃ manyate tasya svavacanavyāghātādanirmokṣaprasaṅga iti sūtrayojanā sūcitā /
tathāhi /
sarvamanumānapramāṇaṃ pratipakṣapratihatatvāditi tvadīyamanumānaṃ pratipakṣaparāhataṃ cāpramāṇaṃ ca bhavati na vā /
ādye nānena sarvasyāprāmāṇyasiddhiḥ /
dvitīye tvatraiva bādhāditi /
anyathā uktavyavasthāṃ vihāya, asya sarvasyāpyanumānasya apratiṣṭhā apramāṇatā, svavācaiva vyāhatā hīti /


*6,145*

apare tu"na vilakṣaṇatvāt'; ityādīni sūtrāṇi brahmaṇo jagadupādānatvākṣepasamādhānārthatayā vyācakṣate /
tatprakṛtyadhikaraṇa eva nirākṛtam /


*6,149*

yaccātra sūtre tarkāpratiṣṭhānāditi vākyaṃ bhittvā siddhāntatayaiva varṇayanti, tadvā anena sārdhena ślokena nirācaṣṭe /
tathāhi tarkasyāpratiṣṭhāṃ vadanvaktavyaḥ /
kiṃ pramāṇānugraharahitasyota tanmūlasya /

ādye gūḍhābhisandhiruttaramāha- āgameti //
ayamāśayaḥ /
satyametat /
tathāpi na sāṅkhayaḥ svatarkasyāgamādyanugrahābhāvaṃ manyate /
svamatenedamucyate cetpaunaruktyam /
śāstrayonitvāt, īkṣaternāśabdam, ānumānikamityadināsyārthasyoktatvāditi /


*6,149f.*

dvitīyaṃ dūṣayati- akṣajeti //
nahi jñānakaraṇasya pramāṇagṛhītavyāptyādimattvenāprāmāṇyakāraṇavyabhicārādiśaṅkākalaṅkavikalasya prāmāṇyaṃ nāstīti yuktamiti bhāvaḥ /
vipakṣe bādhakaṃ cāha- anyatheti //
anyathoktānabhyupagamenāsya pramāṇamūlasyāpyanumānasyāpratiṣṭhā svavācā vyāhataiva sūtrakṛtaḥ syāt /
svayameva hi yuktyanusandhānarūpāṃ brahmamīmāṃsāmārabhya pramāṇamūlasyāpi tarkasyāprāmāṇyamabhidadhānaḥ sūtrakāro na vyāhatabhāṣī kathaṃ syāt /
yadapi vṛttikārairuktam"ekena tārkikeṇotprekṣitaṃ tarkamaparo dūṣayati, tenotprekṣitamapyaparaḥ, ityataḥ puruṣamativaiśvarūpyajanmā tarkaḥ syādapratiṣṭhitaḥ'; iti /
taccāyuktam /
yato 'syāpi tarkasya prāmāṇye 'prāmāṇye vā asyāpratiṣṭhā ca sva(vācā)vyāhataiveti nāyaṃ vākyabhedo yukta ityukta eva sūtrārthaḥ /
Vyāsa-(17)


*6,152*

atra sūtram oṃ etena śiṣyā aparigrahā api vyākhyātā iti /
tatkecidvayācakṣate /
etena"navilakṣaṇatvāt'; ityādinā prakṛtena śiṣyaiḥ kenacidaṃśena parigṛhītasya pradhānakāraṇavādasya nirākaraṇena śiṣyairmanuvyāsaprabhṛtibhiḥ kenacidapyaṃśenāparigṛhītā ye 'ṇvādikāraṇavādāste 'pi vyākhyātā draṣṭavyā iti /
tadidaṃ dūṣayati- naceti //

etena śiṣṭāparigrahā api vyākhyātāḥ | BBs_2,1.12 |

na ca śiṣyāgṛhītatvaṃ nirīśādīśavādinaḥ // MAnuv_2,1.81ab //


*6,152f.*

āstāṃ tāvadabhyadhikāśaṅkāprakāraḥ, parihārātideśaprakāraśca /
yattāvaduktam"sāṅkhayādapi vaiśeṣikāderatiśayena śiṣyāgṛhītatvam'; tadati(tīva)viruddham /
sāṅkhayasya nirīśvaratvāt /
vaiśeṣikādestu seśvaratvāt /
vaiparītyasyaivocitatvāt /
iha hi brahmaṇo jagatkāraṇatve vipratipattayo nirasyante /
tatra sāṅkhayo brahmaiva nābhyupaiti /
kutastadīyaṃ jagatkāraṇatvamityatiśayena vedāntavādavirodhitvācchiṣyāparigṛhītaḥ /
vaiśeṣikādistu, brahma tasya jagannimittatvaṃ cāṅgīkṛtyopādānatāmātraṃ nāṅgīkuruta itīṣadvirodhitvāt īṣacchiṣyāparigṛhīta iti yuktam /
satkāryavāditvādikaṃ tu prakṛtāsaṅgatameva /
anyathā yāgīyahiṃsāniṣedhādinā viparivartaḥ syāt /
atha vedasaṃvādabāhulyābāhulyaprayuktamidam /
maivam /
(tanna /
tattvānāṃ) pratipādyānāmaparisaṅkhayātatvāditi /


*6,153*

kiṃ tarhyasya sūtrasyābhidheyamityata āha- ata iti //

arthāvaśiṣṭajīvādikartṛtātra niṣidhyate // MAnuv_2,1.81cd //

arthāntarasya nirākṛtatvādityarthaḥ /
apavyākhyānanirākaraṇasya svavyākhyānadārḍhyāthartvānnāsaṅgatamiti sūcayitumata ityuktam /
avaśiṣyā nirākṛtāyā abhāvakartṛtāyāḥ, jīvādikartṛtā, jagata iti śeṣaḥ /
anena nirākṛtādavaśiṣyā vedāparigṛhītā jīvapradhānāsatkālasvabhāvādivādā nirākṛtā iti vyākhyātaṃ bhavati /
tatra śiṣyā ityevokte brahmakāraṇavādo 'pi prāpnoti /
tadarthamaparigrahā ityuktam /
tanmātre tūkte abhāvakartṛtvavādo 'pi gṛhyeta /
tathāca punaruktiratideśānupapattiśca syāt /
ataḥ śiṣyā ityuktam /
abhyadhikāśaṅkāsadbhāvasūcanena sūtrārambhopapādanārthaṃ ca śiṣyāḥ śiṣyatayā pratītāḥ, natu tata eva nirākṛtatayeti /


*6,158*

nanu jīvādītyāsidagrahaṇenāsatkartṛkatvaṃ gṛhītam /
tasya"asaditi cet'; ityādinā nirastatvena paunaruktyādiprasaṅgādityata āha- tanmana iti //

tanmano 'kurutetyāderasato manaso janiḥ /
nivāritā tu pūrvatra hyakasmāditi tadvinā // MAnuv_2,1.82 //
asato viśvajananamāśaṅkayātra niṣiddhayate // MAnuv_2,1.83ab //



*6,159*

ityādeḥ pramāṇāt /
āśaṅkiteti śeṣaḥ /
ādipadenoktayuktirgṛhyate /
asataḥ abhāvasya /
manasa iti /
jñānecchāprayatnebhyaḥ janiḥ /
jagata iti śeṣaḥ /
pūrvatra tviti sambandhaḥ /
tacca pratiṣedhamātratvādityādinā sphuṭamavagamyata iti hiśabdaḥ /
akasmāddhīdamāvirāsīdityādiśrutyā /
tat mano, vinā /
asataḥ śūnyāt /

etaduktaṃ bhavati /
pūvarmabhāvasya jagatkāraṇatvaṃ nirākṛtamidānīṃ tu śūnyasya /
kiñca pūrvaṃ kartṛtvenādhunā kartṛtāṃ vinaiveti na paunaruktyādīti /
yadvā bhāṣyadiśā niṣkāraṇaivātra jagajjanirāśaṅkiteti na paunaruktyādikam /
atra śaṅkāprāpakapramāṇopanyāsastu asyaiva prameyabhedasyopapādanārtham /

etenābhyadhikā śaṅkāpi sūcitā /
tathāhi /
mā bhūdabhāvakartṛkaṃ jagat, tathāpi jīvādibhyo janimadbhaviṣyati /
"jīvādbhavanti bhūtāni',"pradhānādidamutpannam',"akasmāddhīdamāvirāsīd'; ityādiśrutyanugṛhītebhyo ghaṭadadhikaṇṭataikṣṇādidṛṣṭāntebhyaḥ /
nahi jīvādīnāṃ pratiṣedhamātratvamasti, yenoktayuktivirodhaḥ syāt /
asattvācetanatvāderupalakṣaṇametaditi cet /
kimatrāsadādeḥ kāraṇatvamātraṃ netyucyate, kiṃvā kartṛtvam /
nādyaḥ /
uktadṛṣṭānteṣu vyabhicārāt /
na dvitīyaḥ /
kartṛtvasyāsmābhiranaṅgīkṛtatvāditi /
ata evātra sarvatra kartṛśabdaḥ kāraṇatvamātraparo draṣṭavyaḥ /


*6,165*

nanvatra jīvāderviśvakāraṇatvamātraṃ śaṅkayate, tasyaiva vā /
ādye na siddhāntavirodhaḥ /
jīvasya hyadṛṣṭādhāratayā nimittatvaṃ pradhānasya copādānatvamaṅgīkṛtameva /
na dvitīyaḥ /
prāpakābhāvāt /
kāryasya sakartṛkatvaniyamadarśanāccetyata āha- prāpakamiti //

prāpakaṃ vākyamātraṃ tu ... // MAnuv_2,1.83c //

dvitīya evāśaṅkayate /
tasya ca prāpakaṃ"na jīvātkāraṇaṃ param',"na hyanyatkāraṇaṃ matam'; ityādivākyam /
naca lokavirodhaḥ /
vākyamātrasiddhe 'rthe tatpratipannameva gṛhyate natu loko 'nugamyata iti pūrvapakṣī manyata iti /

nanu ca pradhānakāraṇatvādimatāni dvitīyapāde nirākariṣyate /
teṣāmatrāpi nirākaraṇe punaruktidoṣaḥ syādityato vā'ha- prāpakamiti //
atra śaṅkāprāpakaṃ vākyamātraṃ natu samaya ityarthaḥ /
idamuktaṃ bhavati /
atra śrutyanugṛhītābhiryuktibhiḥ prāptaṃ pradhānādikāraṇatvaṃ nirākriyate /
uttaraṃ(ratra) tu tu sāṅkhayādisamayaprāptam /
ato 'pi noktadoṣa iti /

nanvevaṃ tarhyetenetyatideśaḥ katham /
uktaparihārasya pūrvapakṣiṇā parihṛtatvādityata āha- parihāra iti //

... parihāro viśeṣitaḥ // MAnuv_2,1.83d //

yadyapi pratiṣedhamātratvaṃ pradhānādiṣvasiddham /
acetanatvādikaṃ ca kāraṇatvamātravāde anaikāntikam /
tathāpi pūrvapakṣāṇāṃ yuktiviruddhatvaṃ yatpratiṣedhamātratvāt dṛṣṭāntabhāvāditi sāmānyataḥ sūcitam, yacca svapakṣadoṣāccetyaprāmāṇikatvaṃ, sa parihāro 'trāpyaviśeṣitaḥ samānaḥ, ityatideśo yujyata ityarthaḥ /


*6,167*

nanu kathaṃ jagato jīvakartṛtvādivādasya yuktiviruddhatvamityata āha- kvaciditi //

kvacijjīvākṛtaṃ dṛṣṭvā cetanādeva cākṛtam /
tadvadevānumānyatra vastutvāt kriyate śruteḥ // MAnuv_2,1.84 //


kvacit deśādau /
yadvā kvacit jīvādau /
akṛtamiti ca bhāvapradhāno nirdeśaḥ /
kāraṇatvamātramatra pūrvapakṣo na kartṛtvamityato 'cetanāditi pañcamīprayogaḥ /
acetanādakṛtaṃ ca dṛṣṭvā /
evaśabdena dṛṣṭāntānāmasandigdhasādhyatāmāha /
anumā anumitiḥ /
anyathā vastutvasyaivānumānatvātpañcamī na syāt /
jīvākṛtatvāderiti śeṣaḥ /
anyatra mahadādau /

atraite prayogāḥ /
mahadādikāryaṃ na jīvakṛtaṃ vastutvājjīvavat, vimataṃ na pradhānakāryaṃ vastutvātpradhānavat, vimataṃ nāsatkāryaṃ vastutvādghaṭavaditi /
yadyapi jīvasya nimittatvena pradhānasyopādānatvena jagatkāraṇatvamaṅgīkṛtameva tathāpi svātantryābhāvābhiprāyeṇedaṃ vacanamiti na virodhaḥ /


*6,168*

nanvevaṃ satyatiprasaṅgaḥ syāt /
vimatamaśvarakṛtaṃ na bhavati vastutvādīśvaravat ityapi prayoktuṃ śakyatvādityata āha- śruteriti //
"sa idaṃ sarvamasṛjata'; ityādiśrutermahadāderīśvarakṛtatvāvadhāraṇādatiprasaṅgānumānasya bādhitatvenāprāmāṇyamiti /
samaṃ tarhīdaṃ bhavadanumāneṣu /
jīvādbhavanti bhūtānītyādiśruterityata āha- śruteriti //
bhāvapradhāno nirdeśaḥ /
jīvādiśabdānāṃ brahmaśrutitvādbrahmanāmatvānna śrutivirodha ityarthaḥ /
tatkuta ityata āha- śruteriti //
"nāmāni sarvāṇi yamāviśanti'; ityādiśruteḥ /
śeṣaṃ bhāṣye /

nanu jīvādikāraṇa(ka)tve 'pi ghaṭādidṛṣṭāntāvaṣṭambhenānumānasambhavātkathamaprāmāṇikatvamityata āha- śruteriti //
"nānyo 'to 'sti kartā'; ityādiśruterbādhitaviṣayatvāt dṛṣṭāntānāṃ sādhyavaikalyācca nānumānānāṃ prāmāṇyam /

etenāsmadanumāne 'kāryatvamupādhirityapi nirastaḥ(m) /
(svātantryeṇa) jīvādyakṛte 'pi ghaṭādāvakāryatvābhāvāt /
pratipakṣe bādhādidoṣānuṣaṅgācceti sarvaṃ sustham /

// iti śrīmannyāyasudhāyāṃ asadadhikaraṇam //


___________________________________________________________________________


[======= JNys_2,1.V: bhoktradhikaraṇam =======]


*6,170*


// atha śrīmannyāyasudhāyāṃ bhoktradhikaraṇam /

// oṃ bhoktrāpatteravibhāgaścetsyāllokavat oṃ //
atītādhikaraṇe brahmaṇo jagajjanmādikāraṇatve śrutisaṃvāditvena prabalayā yuktyā virodhaḥ parihṛtaḥ /
idānīṃ tu śrutisiddha(liṅga)tvena prabalayā yuktyā virodhaḥ parihriyate /

tathāhi /
na brahmaṇo jagatkāraṇatvaṃ vāstavaṃ sambhavati /
asarvakāraṇena mukte(ktajīve)nātyantābhinnatvāt /
nahi yo yenātyantābhinnaḥ sa tadviruddhasvabhāvo vastuta iti kvacidupalabdham /
naca muktasyāsarvakāraṇatvamasiddham, (sarvakāraṇatvasya) saṃsāre 'nupalambhāt /
saṃsāre pratīyamānasya kasyacidākārasyaivāpagamo hi mokṣo natu apūrvākārotpādaḥ, anityatvaprasaṅgāt /

nacānandāderiva vidyamānasyaivāvidyayā tirohitatvātsarvakāraṇatvasyānupalambha iti vācyam /
pramāṇābhāvāt /
ānandādeḥ paramapremāspadatvādinā īṣadupalabdheśca /
naca brahmaṇo jagatkāraṇatvaśravaṇātsavarthānupalabhyamānamapi jagatkāraṇatvaṃ saṃsāre kalpyamiti yuktam /
śruteḥ kālpanikajagatkāraṇatvānuvāditvenāpi sāvakāśatvāt /
naca tathābhūtameva lakṣaṇamastviti vācyam /
anaṅgīkārāt /
kālpanikasya jagatkāraṇatvasya pradhānādiṣvapi sambhavenātiprasaṅgācca /
syādetat /
muktasya brahmaṇaikyamevāsiddhamiti /
maivam /
"karmāṇi vijñānamayaśca ātmā pare 'vyaye sarva ekībhavanti'; ityādiśrutisiddhatvāditi /
tadidamuktaṃ sūtrakṛtā bhokturjīvasya mokṣe brahmatvāpattiśravaṇāttayoravibhāgo bhedābhāvaḥ /
tataśca na brahmaṇo jagatkāraṇatvaṃ vāstavaṃ yuktamiti /

*6,171*

evaṃ prāpte siddhāntitam /
bhavedetadakhilaṃ yadi muktasya brahmaṇābheda eva prāmāṇikaḥ syāt /
nacaitadasti /
śrautastvekībhāvaprayogaḥ syāllokavat /
yathā loke udake udakasyaikībhāvavyavahāraḥ sthānaikyanibandhanaḥ /
yathā vā prāgvibhinnā brāhmaṇāḥ sāmpratamekībhūtā iti matyaikyanibandhanaḥ /
tathā prāgvibhinnasthānā bhinnamatayaśca jīvā muktau brahmaṇā ekībhavanti /
ekasthānā ekamatayaśca bhavantītyupapadyate /
tasmādasiddhenāsiddhasādhanametaditi /

tadetadayuktam /
mukhyārthe bādhakābhāvāt /
vinā bādhakena jaghanyavṛttyāśrayaṇe cātiprasaṅgāt /
ityato mukhyārthe bādhakayuktivyutpādanaparatvenāpi syāllokavaditi sūtrakhaṇḍaṃ vyācaṣṭe- nānyaditi //

bhoktrāpatter avibhāgaś cet syāl lokavat | BBs_2,1.13 |

nānyadanyatvamāpannaṃ kvacid dṛṣṭaṃ kathañcana /
ato jīvasya na brahmabhāvaḥ syāddhi kadācana // MAnuv_2,1.85 //



*6,176*

atra mukhyamevārthamaṅgīkurvāṇaḥ praṣṭavyaḥ /
kiṃ prāgabhinnasyaiva jīvasya muktau brahmaṇaikyamanenocyate, uta bhinnasya, atha(vā) bhinnābhinnasya /
nādyaḥ, abhūtatadbhāvārthasyaikībhavantīti cvipratyayasyaiva anupapatteḥ /
ata eva na tṛtīyaḥ /
aikyasya prāk siddhatvāt /
bhedanivṛttyarthatve tu gauṇārthatvāpatteḥ /
dvitīyanirākaraṇena nirastatvāt (ca) /
dvitīye tvidamupatiṣṭhate, nānyaditi /
hiśabdo hetau /
yato loke anyat vastu, anyatvaṃ vastvantareṇābhedamāpannam, kvacitkāle, kathañcanopāyena, na dṛṣṭam /
atastaddṛṣṭāntena jīvasyāpi kadācana muktāvapi brahmabhāvo brahmatvaṃ na syāt /

ayamatra prayogaḥ /
jīvo na kālāntare 'pi brahmaṇaikyamāpatsyate /
prāk tato 'tyantabhinnatvāt /
yaḥ kadācidyato 'tyantaṃ bhidyate nāsau kadācittadaikyamāpadyate /
yathā ghaṭaḥ paṭeneti /
athavā jīvabrahmaṇoḥ bhedaḥ, satorbhedinorna nivṛttimān, bhedatvātstambhakumbhādibhedavaditi /
āgamabādhitametaditi cenna /
āgamānāṃ mukhyārthatāsambhave 'numānabādhakatvaṃ, bādhite cānumāne teṣāṃ mukhyārthateti parasparāśrayatvaprasaṅgāt /
satpratipakṣatvācca /
tathāhi śrutiḥ /
yathodakamityādikā /
pralhādo 'pi"paramātmātmanoryogaḥ paramārtha itīṣyate(tām) /
mithyaitadanyaddravyaṃ hi naiti taddravyatāṃ yataḥ'; iti /


*6,182*

atha matam /
nāyamasti yuktivirodhaḥ /
prāgapyabhinna eva brahmaṇā jīva ityaṅgīkārāt /
naca cvipratyayānupapattiḥ /
pratītyapekṣayā tadupapatteḥ /
prāgvibhinnatayā dṛṣṭo 'yaṃ jīvo brahmaṇaḥ /
athedānīṃ muktāvabhinnatayā dṛśyate, ityata ekībhavantītyucyata iti /
atredaṃ vaktavyam /
kiṃ prāktanī jīvabrahmaṇorbhedadṛṣṭirbhrāntiruta prameti /
nādyaḥ /
bādhakābhāvāt /
śrutayastvadyāpyavyavasthitārthā na bādhakatāmaśnuvate /
dvitīye tvāha- kvaciditi /

kvacid bhinnatayā dṛṣṭaṃ tadabhinnatayā katham /
dṛśyenno dṛṣṭapūrvaṃ hi tādṛśaṃ na ca dṛśyate // MAnuv_2,1.86 //


kvacitkāle yadvastu yato bhinnatayā pramitaṃ tat kālāntare 'pi kathaṃ tadabhinnatayā pratī(mī)yeta, na kathañcidityarthaḥ /
kuta ityata āha- no dṛṣṭapūrvaṃ hīti //
tādṛśaṃ prāgbhinnatayā pramitaṃ kālāntare 'bhinnatayā pramīyamāṇam /

ayamiha prayogaḥ /
jīvo na kadācidbrahmābhinnatayā pramāviṣayaḥ /
tato 'tyantabhinnatayā pramitatvāt /
yadevaṃ tadevaṃ yathā ghaṭaḥ paṭādbhinnatayeti /
yastu kvacidapi bhedapramāṃ na manyate, taṃ pratyāropitabhedamekaṃ vastu vyatirekodāharaṇaṃ vācyam /
evañca pratītimupādāyāpi na cvipratyayopapattiḥ /
etadarthatvenāpi syāllokavaditi yojyam /
tadevaṃ grāvaplavanādiśrutivat upapattiviruddhatvena śrutermukhyārthāsambhavādamukhyārtha eva svīkaraṇīye parakīyahetorasiddhatvānna brahmaṇo jagatkāraṇatve yuktivirodha iti siddham /


*6,184*

kecididaṃ sūtramanyathā vyācakṣate /
pūrvaṃ kila cetanācetanātmakasya prapañcasya brahmopādanatvena brahmānanyatvamuktam /
tadākṣipya samādhātumidaṃ sūtram /
tathāhi /
yadi cetanācetanātmakasya jagato brahmānanyatvaṃ syāttadā cetano bhoktā bhogyaścācetanā viṣayā ityayaṃ vibhāgo na syāt /
kutaḥ /
bhogyasyāpi bhoktṛtvāpatteḥ /
bhokturapi bhogyatvāpatteḥ /
bhavitavyaṃ cānena vibhāgena /
pratyakṣādisiddhatvāditi cet /
syāllokavat /
yathā loke samudrātmanāmapi phenataraṅgādīnāṃ netaretarabhāvāpattyā vibhāgabhaṅgaḥ, yathā vā mahākāśātmanāmapi ghaṭamaṭhādyākāśānāṃ, tathā prakṛte 'pi syāditi /
tadidaṃ dūṣayati- bhoktṛtveti //

bhoktṛtvāpattita iti yanmataṃ tat kuto hariḥ /
bhoktrāpatteriti prāha ... // MAnuv_2,1.87a-c //


yat yadi bhoktrāpatterityatra bhoktratvāpatteriti vyākhyānaṃ sūtrakārasyāpi(bhi)mataṃ syāt tat tarhi kuto hariḥ sūtrakṛt bhoktrāpatteriti (pra)āha /
bhoktṛtvāpatterityeva brūyāt /
nacaivamabravīt /
tato nāyamabhiprāyaḥ sūtrakārasyeti /

yadyapyatra pareṣāmasmākaṃ cādhyāhārasāmyam /
tathāpi bhāvapratyayābhāvaḥ parasyādhikaḥ /


*6,186*

ye tu vyācakṣate"cidacidvastuśarīratve brahmaṇo jīvavatsukhaduḥkhādibhoktṛtvāpatterjīvabrahmasvabhāvavibhāgo na syāditi cenna /
yathā kāntāre nipatitasya(syāpi) nṛpasya na daṃśamaśakādyupadravastathātrāpi syāt'; iti /
teṣāmapyayaṃ śabdadoṣaḥ samānaḥ /

nanu bhāvapradhānā nirdeśāstatra tatra bahulamupalabhyante /
tatkathamayaṃ doṣo 'bhidhīyate /
ayamabhisandhirbhāṣyakārasya /
pratipādye vyavasthite tadbalācchābdī gauṇatā kathañcidanusartavyā /
nacāsya sūtrasyedaṃ pratipādyaṃ vyavasthitam /
jagadupādānatvasya prāganuktatvenānuktopālambhaprasaṅgāt /
jagaccharīratvasyāntaryāmyadhikaraṇe prasakte 'pi sambhogaprāptirityanenaiva parihṛtatvāt /
tatra jīvaśarīragatatvena (prasa(ktaṃ)katabhoktṛtvamapāstam /
atra tu jagaccharīratveneti cenna /
pūrvottarapakṣayornyāyāviśeṣe sūtrārambhānupapatteḥ /
ato nirnimittaḥ śābdadoṣo 'pi nānusaraṇārha iti /
yadvaitadarthapratipādanāya kathaṃ cetyādyuttaravākyamatrāpi saṃyojya vyākhyeyamityukta eva sūtrārtha iti /

// iti śrīmannyāyasudhāyāṃ bhoktradhikaraṇam //

___________________________________________________________________________


[======= JNys_2,1.VI: ārambhaṇādhikaraṇam =======]



atha śrīmannyāyasudhāyāṃ ārambhaṇādhikaraṇam /


*6,188*

// oṃ tadananyatvamārambhaṇaśabdādibhyaḥ oṃ //
prāk pramāṇamūlatvatatsaṃvāditvābhyāṃ prabalayā yuktyā ukte(ktār)the

virodho nirā(staḥ)kṛtaḥ /
bāhulyalakṣaṇabalavadyuktivirodhaparihārāya idamadhikaraṇamārabhyate /

tadidaṃ brahmapariṇāmavādī vyācaṣṭe"anantarādhikaraṇe bhogyavargasya pariṇāmataḥsiddhaprātisvikarūpabhedānapahnavena lokasiddha(ddhaṃ)kāraṇābhedamaṅgīkṛtya sāṅkhayasiddhāntena śāstrato bhoktṛvargasya svābhāvikarūpabrahmāvibhāge bhogyasyāpi brahmaikyavadbhoktṛtvāpattimāśaṅkaya anaikāntikatvena nirāso(vi)'bhihitaḥ /
samprati vaiśeṣikādimatena svarūpakāryavyapadeśādibhedena kāryasya kāraṇātma(ka)tvāsiddhayā prapañcasya brahmādvaitam ākṣipya samādhīyate /
tathāhi /
tadananyatvaṃ tena brahmaṇā ananyatvaṃ, kāryasya /
kutaḥ? ārambhaṇaśabdādibhyaḥ"yathā somyaikena mṛtpiṇḍena vijñātena sarvaṃ mṛṇmayaṃ vijñātaṃ syāt /
vācārambhaṇaṃ vikāro nāmadheyaṃ mṛttiketyeva satyam'; ityadiśabdāt /
"ādi'grahaṇāt"aitadātmyamidaṃ sarvam',"yadayamātmā',"sarvaṃ khalvidaṃ brahma'; ityāditādātmyāvedakaśrutiparigrahaḥ'; iti /

vivartavādī tu vyākhyāti"abhyupagamya cemaṃ vyāvahārikaṃ bhoktṛbhogyalakṣaṇaṃ vibhāgam,"syāllokavat'; iti parihāro 'bhihitaḥ /
na tvayaṃ vibhāgaḥ pāramārthiko 'sti /
yasmāt tadananyatvaṃ kāraṇādbrahmaṇaḥ kāryasyākāśādeḥ paramārthato 'nanyatvaṃ vyatirekeṇābhāvaḥ, avagamyate /
kutaḥ? ārambhaṇaśabdādibhyaḥ'; iti /


*6,193*

tatrādyaṃ vyākhyānaṃ tāvannirākaroti- kathaṃ ceti //

tadananyatvam ārambhaṇaśabdādibhyaḥ | BBs_2,1.14 |

... kathaṃ ca tadananyatā // MAnuv_2,1.87 //

kathamityākṣepe /
caśabdaḥ pūrvasūtrāpavyākhyānākṣepeṇāsya samuccayārthaḥ /
jagata iti vakṣyamāṇamatrāpi sambaddhayate /
"atra pratipādyā syāt'; iti śeṣaḥ /

*6,194*

ayamāśayaḥ /
yo hi brahmopādānatāṃ jagato 'bhyupagamyāpi tadanyatāṃ manyate so 'tra pūrvapakṣīkaraṇīyaḥ /
naca vaiśeṣikādistatheti prāptyabhāvānna tadananyatvokteravasaro 'sti /
brahmopādānatāmanaṅgīkurvāṇaṃ prati tu saiva samarthanīyā /
natu tadananyatā /
tadadhīnasiddhitvādasyāḥ /
atha brahmopādānatāpyatra samarthyata iti cet /
na /
tathā sati prakṛtyadhikaraṇavaiyarthyāpatteḥ /
prakṛtyadhikaraṇanyāyeno(yo)papādi(taṃ)tamabhyupetyāpi tadanyatāṃ manyamāno 'tra pūrvapakṣīti cet /
na /
kimidaṃ brahmopādānatvaṃ brahmasamavāyitvaṃ vā, brahmapariṇāmatvaṃ vā, yatpareṇāṅgīkāritam /
nādyaḥ (kalpaḥ) tasyānanyatvavirodhāt /
samavāyasya nirākariṣyamāṇatvācca /
dvitīye prayatnavaiyarthyameva /
nahi ko 'pi pariṇāmavādamaṅgīkṛtya kāyarkāraṇayoratyantabhedamaṅgīkurute, yaṃ pratīdamārabhyeta iti /


*6,195f.*

yadvā kathaṃ ca tadananyatā jagato vaktuṃ śakyate /
ananyatvaṃ hi bhedābhāvaḥ /
atyantābheda iti yāvat /
bhedābhedau ca pareṇāṅgīkṛtau /
atastādātmyamiti vaktavyaṃ syāt /
naiṣa doṣaḥ, yāvatā kāryasya kāraṇenābheda eva, kāraṇasya tu kāryādbheda eva, ityevaṃ bhedābhedāvaṅgīkṛtāviti cenna /
yadi brahma jagato 'nyadeva tadā kathaṃ ca tadananyatvaṃ(tā) jagataḥ syāt /
nahi yadyato 'tyantabhinnaṃ tattenātyantābhinnamiti sambhavati, atiprasaṅgāditi /


*6,196*

athavā kathaṃ ca tadananyatā pratijñātuṃ yuktā /
pramāṇābhāvāditi śeṣaḥ /
nanu cārambhaṇaśabdādibhya ityuktatvātkathaṃ pramāṇābhāva iti cet /
atra vaktavyam /
ārambhaṇaśabdastāvatkiṃ sākṣājjagato brahmānanyatvamācakṣīta, uta vikārasya vikāryananyatvam /
ādye kathaṃ ca tadananyatā jagatosyārthaḥ syāt /
yathā somyeti mṛtpiṇḍādeḥ prakṛtatvādityuttaram /
dvitīye bhavatu nāma vikārasya vikāryananyatvam, jagatastu kathaṃ tadananyateti /


*6,197*

(nanu) vikārasya vikāryananyatve tenokte 'pi jagato brahmānanyatvaṃ siddhayatyeva /
tasyāpi tadvikāratvādityata āha- jagatastviti //

jagatastvavikāratva uktanyāyena sādhite // MAnuv_2,1.88ab //

avikāratve brahmavikāratvābhāve /
uktanyāyena"naca prakṛtiḥ'; ityādineti śeṣaḥ /
sādhite sati kathaṃ ca tadananyatetyanvayaḥ /
yadvā jagata iti pūrveṇaiva sambaddhayate /
avikāratve brahmaṇa iti śeṣaḥ /
na vidyate vikāro yasyetyavikāram /
tasya bhāvastattvaṃ, tasmin /

*6,198*

nanvatrārambhaṇaśa(bdaśa)bdena"uta tamādeśamaprākṣya(kṣaḥ)'; ityādyā śrutirupalakṣyate, tattātparyaparyālocanāyāṃ ca jagato brahmavikāratvaṃ tadanantyavaṃ cāvagamyate iti cenna /
mahāvākyāvāntaravākyopakramatvapradhānavācitvādyabhāvenāsya śrutyupalakṣaṇayopādāne nimittābhāvāt /
abhyupetyāpyupalakṣaṇatvamāha- avikāratva iti //
vikarātvādanyasminsādṛśyādau śrutyarthatayoktanyāyena sādhite sati śrutitātparyaparyālocanayā ca kathaṃ tadananyatā siddhayediti /


*6,201*

yadapyuktamādipadagṛhītādaitadātmyamidaṃ sarvamityādivākyāttadananyatvasiddhiriti tadapyasat /
ādipadena vākyāntaragrahaṇasyānupapatteḥ /
tathā satyeteṣāmapi śabdatvenārambhaṇādiśabdebhya iti prayogaprasaṅgāt /

astu vā kathañcidādipadopāttatā(tvaṃ)teṣāṃ vākyānām /
tathāpi naitebhyastadananyatā siddhayati /
upapattiviruddhatvādityāśayena pṛcchati- kathaṃ ceti //
yā sūtrakṛtā pratijñātā śrutibhiśca pratipāditā sā jagatastadananyatā kathaṃ kiṃprakārā /
"kiṃ pikaḥ kokilaḥ'; itivadekatvalakṣaṇā kiṃvā mṛdghaṭa itivadvikāra(ri)vikāri(ra)tvalakṣaṇeti praśnārthaḥ /

ādyamākṣipati- kathaṃ ceti //
ekatvalakṣaṇā jagatastadananyatā tu kathaṃ sūtrakṛtā pratijñāyeta /
kathaṃ ca śrutibhiḥ pratipādyeta na kathañcidityarthaḥ /
atra hetumāha- avikāratva iti //
brahmaṇo 'vikāratva uktanyāyena sādhite sati jagatastu vikārātmakatve pratyakṣādipramite sati viruddhadharmādhikaraṇatvāditi bhāvaḥ /
dvitīyamākṣipati- kathaṃ ceti //
vikārivikāratvarūpa iti śeṣaḥ /
ākṣepe yuktimāha- jagatastviti //
vyākhyānaṃ pūrvavat /


*6,203*

nanvevamupapattiviruddhāpi jagato brahmānanyatāṅgīkaraṇīyā /
anyathaitadātmyamidaṃ sarvamityādiśrutīnāmaprāmāṇyaprasaṅgādityata āha- kathaṃ ceti //
avikāritve 'pi vikāratvādanyasmiṃstadadhīnatvādau śrutyarthe"svātantrye ca viśiṣṭatve'; ityuktanyāyena sādhite sati kathaṃ tadananyatāṅgīkartumucitā /
sāvakāśaśrutipratīto 'pyartho niravakāśopapattivirodhāttyājya eva /
yathoktamabhimānyadhikaraṇa iti bhāvaḥ /


*6,203f.*

aparamapi vyākhyānaṃ dūṣayati- kathaṃ ceti //
(iti) prāhetyanuvartate /
yadyatra kāryamātraprapañcasyānṛtatvaṃ sūtrakṛto 'bhimataṃ syāt /
tadānṛtatvamityeva brūyāt /
tadananyatvamiti kathaṃ prāha /
nahi brahmānanyatvaśabdo 'nṛtatvāvācī /
tathā sati brahmaṇo 'pyanṛtatvaprasaṅgāt /


*6,204*

nanu ca tadananyatvaṃ tadvayatirekeṇābhāva iti vyākhyātam /
satyam /
na tathāpyanṛtatvalābhaḥ /
tadvayatirekeṇa nāstītyukte tadātmanāstīti labhyate /
na punaḥ sarvathāpyanṛtatvam /
anyathā brahmātirekeṇāsato jīvacaitanyasyāpi sarvathānṛtatvaṃ syāt /
prasiddhaṃ caitat /
yadviśiṣṭa(viṣayaḥ)pratiṣedho viśeṣaṇamupasaṅkrāmatīti /

satyam /
tathāpi brahmavivartatājñāpanāyaivamuktamiti cet(na) /
tathā sati tatrāropita(tva)miti vaktavyatvāt /
nahi śuktikāśakale kaladhautamāropitamiti vaktavye tatonanyaditi prayuñja(jya)te /

atha brahmasattayaivedaṃ sat, nāparā sattāsyāstīti jñāpanametasya prayojanamiti cet /
tarhi paramārthasadevedamityāyātamiti kathamanṛtatvam /

atha yeyaṃ prapañce sattāvagamyate sādhiṣṭhānabrahmagataivāropitetyanena jñāpyata iti cet /
tatminyathākhyātivādivadanirvacanīyakhyātivādino 'pyāropitākārasyānyatra pāramārthyamāvaśyakam /
tathātve cākāśatvādikamapi brahmaṇi pāramārthikamaṅgīkāryaṃ(raṇīyaṃ) syāt /
rajatatvādikaṃ ca śuktikāyāmiti /


*6,206*

yadvā syāllokavaditi bhoktṛbhogyaprapañcasya satyatāmabhidhāyedānīṃ kathaṃ ca tadananyateti tadviruddhamanṛtatvaṃ prāheti yojanā /
nanu sūtrakāraḥ paramārthābhiprāyeṇa tadananyatvamityāha /
vyavahārābhiprāyeṇa tu syāllokavaditi /
tatkuto virodha sati cenna /
pratārakatvaprasaṅgāt /
anyathā pratyācakṣīta /
apratyākhyāyaiva kāryaprapañcaṃ, pariṇāmaprakriyāmāśrayati, saguṇeṣūpāsaneṣūpayokṣyata i(tī)ti cet /
kiṃ saguṇopāsanaviṣayaprayojane prakṛtaviṣayaprayojanānukūle, uta tadviruddhe, athodāsīne /
nādyaḥ /
bhedaviṣayatvāt, sāṃsārikaphalatvācca /
bhedavāsanā hi sudṛḍhā tāmevopodbalayet /
ata eva na tṛtīyo 'pi /
na dvitīyaḥ

anāptatvāparihārāditi /


*6,208*

athavā'stāṃ tāvadiyaṃ granthārjavacintā /
kathaṃ ca tadananyatānṛtatvalakṣaṇā jagato yuktā syāt /
na kathañciditi yojyam /
atra hetumāha- jagata iti //
avikāritva brahmavivartatvābhāve /
yaccāvikṛtamityādyuktanyāyena /
evaṃ pramāṇābhāvaparatvenāpi pūrvavadvayākhyeyamiti /


*6,209*

evaṃ tarhi ko 'syārtha ityata āha- svatantreti //

svatantrakāraṇānyatvaṃ tena hyatra niṣiddhayate // MAnuv_2,1.88cd //


*6,209f.*

yata evaṃ jagato brahmānanyatvamanekavidhamapi nātra pratipādyaṃ, tenetyarthaḥ /
anenāpavyākhyānanirākaraṇaṃ svavyākhyānadṛḍhīkaraṇārthatvānnāsaṅgatamiti smārayati /
kartranadhīnasattāśaktyādimatkāraṇāntaratavyapekṣā khalu ghaṭādisṛṣṭirdṛṣṭā /
tato, mahadādisṛṣṭirapi kartṛvyatiriktasvatantrakāraṇasavyapekṣā sṛṣṭitvādghaṭasṛṣṭivat, mahadādikaṃ vā kartṛvyatiriktasvatantrakāraṇāyatto sāpekṣotpattikaṃ kāyartvādghaṭavat, prakṛtyādikaṃ vā svatantraṃ kāraṇatvānmṛdādivat, īśvaro vā svatantrakāraṇasavya(ṇāntarasā)pekṣaḥ kartṛtvātkulāla(lādi)vaditi yuktiviruddhatvājjanmādisūtre 'bhipretaṃ yatparasyaiva brahmaṇaḥ svātantryaṃ tannopapadyate /
naca śrutivirodhaḥ /
śrutīnāṃ brahmaṇo jagatkāraṇatvamātraparatvāt /
svatantrakāraṇāntaranirāse śruterabhāvāt /
bhāve 'pyapauruṣeyatayā śrutiprābalyavadbāhulyena yuktiprābalyasyāpi sambhavāt, satpratipakṣatayā śru(tya)tyābhipretāvadhāraṇānupapatterityevaṃ prāptam /
svatantrakāraṇānyatvaṃ brahmaṇo 'nyasya svatantrakāraṇatvamiti yāvat /
atra adhikaraṇe /
tadananyatvamityanena niṣiddhayate /
mahadādisṛṣṭau yatsvatantrakāraṇaṃ tasya tadananyatvamiti /

*6,210*

yadyatra svatantrakāraṇābhāva ityeva brūyāt, tadā brahmaṇo 'pi svātantryaṃ pratiṣiddhaṃ syāt /
tadananyatvaṃ svatantrakāraṇasyetyukte hi svatantrakāraṇaṃ tadeva nānyaditi labhyate /
tadupapādanāya yat"ārambhaṇaśabdādibhyaḥ'; iti svapakṣe pramāṇamuktam, yaśca"bhāve copalabdheḥ'; iti vipakṣe pramāṇābhāvastadubhayaṃ hiśabdena sūcayati /


*6,212f.*

nanvārambhaṇādyākṣepaśabdādibhya iti vaktavyam /
satyam /
lakṣitalakṣaṇayaiṣa evārthaḥ pratipādyata ityadoṣaḥ /
tathāpi"kiṃsvidāsīdadhiṣṭhānam'; iti (ṛ.saṃ.10-81-2) śrautanirdeśānusāreṇādhiṣṭhānasyopādānamucitamiti cenna /
śābdādapyarthaprādhānyasya balavattvāt /
sādhakatamaṃ karaṇamiti vacanā(smaraṇā)t /
nanu ca svatantrakāraṇasya brahmānanyatvaṃ pratijñāya kāraṇāntarābhāve pramāṇopanyāso 'saṅgataḥ /
maivam /
astyatrābhiprāyaḥ /
vakṣyate (hi) ca brahmātiriktaprakṛtyādikāraṇasadbhāvaḥ /
ārambhaṇaśabdādibhyastadabhāvo 'vagamyate /
tatorthātsvatantrakāraṇāntarabhāve ca pramāṇairupalabdheḥ prasaṅga iti vadanpramāṇābhāvamāha /
evaṃ manyate /
śuṣkābhyo bahuyuktibhyo 'pi śrutyanugṛhītānāṃ bahvīnāṃ yuktīnāṃ prābalyāttadviruddhānāṃ pūrvapakṣayuktīnāmaprāmāṇyamiti /


*6,215*

syādetat /
adbhayaḥ sambhūta ityādivacanātkathaṃ brahmātiriktasya svatantrakāraṇasyānupalabdhiḥ /
nacātra na svātantryaṃ śrūyata iti vācyam /
pāratantryānuktau svātantryasya lokānurodhādeva siddheriti /
etatparihārāya sūtram oṃ sattvāccāvarasyeti oṃ //
tasyā(yamar)thaḥ /
syādayaṃ doṣo yadi vayaṃ brahmātiriktaṃ kāraṇameva nāstīti vadāmaḥ /
na caivam /
avarasya tadadhīnasya prakṛtyādeḥ kāraṇasya sattvāditi /
tadidaṃ parihārāya na paryāptam /
yāvatā pūrvapakṣiṇā pāratantryānuktau svātantryameva setyasyatītyuktam /
anyathā pūrvapakṣasya nirdalatvāpatteḥ, ityataḥ prakṛtyādeḥ kāraṇajātasyeśvarādhīnasattākatva pramāṇaṃ darśayansūtraṃ vyācaṣṭe- dravyamiti //

sattvāc cāparasya | BBs_2,1.16 |
asadvyapadeśān neti cen na dharmāntareṇa vākyaśeṣāt | BBs_2,1.17 |


dravyaṃ karma ca kālaśca svabhāvaścetanā dhṛtiḥ /
yatprasādādime santi na santi yadupekṣayā /
iti śrutestadvaśasya bhāvo ... // MAnuv_2,1.89a-f //


cetanāḥ jīvāḥ /
dhṛtiḥ citprakṛtiḥ,"dhārakatvāt'; iti śruteḥ /
prakṛtyādestadvaśasya bhāvaḥ aṅgīkriyate /
ato 'dbhayaḥ sambhūta ityatrāpi svātantryāsiddhernānupalabdhiryuktetyarthaḥ /
yadyapi ārambhaṇaśabdāderadbhayaḥ sambhūta iti śruteśca parasparaviredhādarthāpattyaivaiṣo 'rtho labhyate /
tathāpi mandāpekṣayā spaṣṭaśrutyudāharaṇam /


*6,217*

yadvā svatantrakāraṇānyatvaṃ niṣiddhayata ityanena paratantrakāṇāntarasadbhāvaḥ sūcitaḥ /
anyathā kāraṇānyatvamityeva syā(brūyā)t /
(sa) paratantrakāraṇasadbhāvaḥ kṛta ityata āha- dravyamiti //
bhāvo gamyata iti śeṣaḥ /
atra tadvaśatvaṃ vidheyam /
kārarasadbhāvasya pareṇāpyaṅgīkṛtatvāt /

// oṃ asadvayapadeśānneti cenna dharmāntareṇa vākyaśeṣāt oṃ //
iti sūtram /
tatra ākṣepasyāyamarthaḥ /
"nāsadāsīnnosadāsīttadānīm'; iti mahāpralaye mūrtāmūrtāderaśeṣasyāsattvavyapadeśātkāraṇopalabdhiparicodanā, tasyeśvaravaśasyāṅgīkāreṇa samādhānaṃ ca nopapadyate /
nacāyaṃ pakṣaḥ"asaditi cet'; ityādinaiva nirākṛtaḥ /
tatreśvarasyāpyanaṅgīkārāt /
iha punarīśvaramaṅgīkṛtya kāraṇāntaranirākaraṇāt /
naca"adbhayaḥ sambhūtaḥ'; ityādivirodhaḥ /

atra mahāpralaye kāraṇāntarasadbhāvasyāśravaṇāt /
īśvarātiriktakartṛkāsu sṛṣṭiṣvabādikāraṇasadbhāvaparatvācca /
evañcārambhaṇaśabdādayo 'pi samañjasā bhavantīti /
(atra) neti siddhāntāṃśaṃ vyācaṣṭe- dravyamiti //
na mahāpralaye kāraṇāntarasyābhāvo vācyaḥ /
kintu tadvaśasya bhāva eva /
tasya tadvaśatvaṃ kuta iti cet /
dravyamiti

śruteriti /

Vyāsa-(18)


*6,219*

nanu"nāsadāsīt'; iti sarvasyāsattvavyapadeśātkathaṃ netyata uktaṃ"dharmāntareṇa'; iti /
tadvayācaṣṭe- tadvaśasyeti //
sāvadhāraṇaṃ cedam /
tadvaśasyaiva bhāvaḥ pralaye, na svatantrasya /
tataḥ svātantryalakṣaṇadharmaviśeṣābhiprāyeṇāsattvavyapadeśo yujyate /
upalakṣaṇametat /
yathoktaṃ bhāṣye /
yatkhalu paratantramavyaktaṃ kāryānabhimukhaṃ tadasaditi vyapadiśyate /


*6,221*

kutaḥ śruteḥ mukhyārthaparityāgenāmukhyārtho 'ṅgīkriyate /
"tama āsīt'; ityādivākyaśeṣāt /
naca tamo brahma,"ānīdavātam'; iti tasya pṛthagavasthānokteḥ /
nacānantaprakāśasya tamastvamupapadyate /
kintu prakṛtereva, ācchādakatvāderiti /


*6,222f.*

nanu ca pralaye 'vasthitaṃ cetprakṛtyādi tasya svātantryādidharmābhāvaḥ kutaḥ, yenaivaṃ vyākhyāyata iti cet /
vākyopakramataccheṣayorvirodhādarthāpattyaiveti brūmaḥ /
śrūyate ca spaṣṭamityāśayavānvākyaśeṣādityetatprakārāntareṇa vyācaṣṭe- na para iti //

*6,223*

... na para ityataḥ // MAnuv_2,1.89f //

"tasmāddhānyatra paraḥ kiñca nāsa'; ityato vākyaśeṣātprakṛtyādīnāṃ pralaye svātantryādyabhāvo 'vagamyata ityarthaḥ /
iha hi tasmādbrahmaṇo 'nyatprakṛtyādikaṃ paraḥ paraṃ svātantryādidharmopetaṃ nāseti tatsadbhāvābhyupagamena paratvaṃ niṣiddhayate /
anyathā paraśabdavaiyarthyāditi /


*6,224*

syādetat /
kāraṇāntarasadbhāvamabhyupagamya tasyeśvarādhīnatāṃ vadatā siddhāntinedaṃ vaktavyam /
kimīśvaraḥ prakṛtyādibhirvināpi kadācitsṛṣṭayādikaṃ karotyuta taireveti niyamaḥ /
ādye teṣāṃ kathaṃ kāraṇatvamaniyatatvāt /
anyathā rāsabhasyāpi gha(pa)ṭakāraṇatāpatteḥ /
dvitīye tu kathaṃ tatparityāgena kadāpyakurvāṇasyeśvarasya svātantryam /
kathaṃ ca niyamenāpekṣaṇīyānāṃ teṣāṃ pāratantryam /
evaṃ pṛkṛtyaiva mahāntaṃ mahataivāhaṅkāramityādiniyamaṃ kadācidapahāya sṛjati utānena niyamenaiva /
ādye tvaniyatatvenākāraṇatvaprasaṅgaḥ /
dvitīye punarīśvarādeḥ svātantryādyanupapattiḥ /
tathā prakṛtyādikamupādānīkṛtya kālādikaṃ nimittīkṛtya sṛjatīti niyame vyatyāse coktadoṣānuṣaṅgaḥ /
*6,225*

ato yuktibādhitatvādasyārthasya kāraṇāntaranirapekṣa eva bhagavantsṛṣṭayādikaṃ karātītyeva jyāyaḥ /
evañca nirargalamaiśvaryamasya samarthitaṃ syāt /
naca pramāṇabādhaḥ /
adbhayaḥ sambhūtaḥ pṛthivyai rasāccetyāderanīśvarakartṛkāvāntarasṛṣṭiviṣayatvasyoktatvāt /
tama āsīdityādau tamaḥprabhṛtīnāṃ pralaye sattvaśravaṇe 'pīśvarakartṛkāyāṃ sṛṣṭau kāraṇatvāśravaṇādityāśaṅkāpanodanārthaṃ sūtram- //
oṃ yukteḥ śabdāntarācca oṃ //
iti /
asyāyamarthaḥ /
noktayuktivirodhena bhagavataḥ kāraṇāntaravidhuratvamurarīkartavyam /
kāraṇāntarasadbhāvābhyupagame 'pi prakṛtyādeḥ kāraṇatvasyeśvarādisvātantryādikasya ca yukteḥ /
nacaivaṃ tarhi vinigamane kāraṇābhāva iti vācyam /
adbhayaḥ sambhūto hiraṇyagarbha ityādiśabdāntarāt /
pūrvodāhṛtaśabdavilakṣaṇaśabdaḥ śabdāntaram /
tenedamuktaṃ bhavati /
yadyapi prāgudāhṛtāḥ śabdāḥ kathañcidanyathā netu śakyante /
tathāpyayaṃ na tathā /
atreśvarakartṛkāyāmeva sṛṣṭau kāraṇāntarasadbhāvaśravaṇāt /
nahi hiraṇyagarbhasṛṣṭiranīśvarakartṛkā /
tasyaiva prathamajatvāditi /


*6,227*

atra yukteriti yā svapakṣe kāraṇatvāderghaṭanoktā sā kathamityapekṣāyāmāha śakto 'pīti /

yukteḥ śabdāntarāc ca | BBs_2,1.18 |

śakto 'pi hyanyathākartuṃ svecchāniyamato hariḥ /
kāraṇairniyataireva karotīdaṃ jagat sadā // MAnuv_2,1.90 //


anyathā, kāraṇairvinā, kartuṃ śakto 'pi hariḥ kāraṇāntarāṇyupādāyaiva kariṣyāmīti svecchāniyamataḥ kāraṇairevedaṃ jagatsadā sṛjati /
evamanyathā, prakṛtyāhaṅkāramahaṅkāreṇa mahāntamiti evam tathā prakṛtiṃ nimittīkṛtya kālādikaṃ copādānīkṛtya kartuṃ śakto 'pyetenaivedametadupādānīkṛtyaivedaṃ srakṣyāmīti svecchāniyamato niyataiḥ kḷptaireva, tathā niyataiḥ svaniyatasattāśaktyādimadbhireva kāraṇairidaṃ jagatsadā karotīti yojanā /


*6,228*

idamuktaṃ bhavati /
yaduktamīśvarasya kāraṇopādānādiniyamo 'sti na veti /
tatrāstīti brūmaḥ /
tathāca prakṛtyādīnāṃ kāraṇatvaṃ yuktam /
saca niyamo na kulālāderiva tānyapahāya vyatyasya vā akaraṇe śaktyabhāvanibandhanaḥ /
yena tasya svātantryam teṣāṃ ca pāratantryaṃ na syāt /
kinnāma svecchāyatta eva /
tataḥ svātantryādikamapi yuktam /
naca tāni svādhīnasattāśaktyādimanti, yenaiśvaryaṃ nirargalaṃ na syāt /
kintu bhagavatyeva tadīyaṃ sattādikamāyatate /
tatastatsācivyamatiśayenaiśvaryasya dyotakameva /
yathoktam"sādhanānāṃ sādhanatvaṃ yadā'tmādhīnamiṣyate /
tadā sādhanasampattiraiśvaryadyotikā bhavet'; iti /

nanu śaktasyāpīśvarasya tanniyamānusaraṇecchā kuta iti cet /
kiṃ kāraṇaṃ pṛcchasyuta jñāpakam /
ādye svabhāvo 'yamiti brūmaḥ (vadāmaḥ) /
dvitīye tu śrutiprasiddheriti /
tadidamuktaṃ hiśabdena /
śrutiṃ codāhariṣyati /

anena śabdāntarācceti sūtraṃ prakārāntareṇa vyākhyātaṃ jñātavyam /
śabdāntaraṃ ca śabdaviśeṣo, vivakṣitārthapratipādakaḥ śabda iti yāvat /
"paṭavacca',"yathā prāṇādiḥ'; iti sūtre, bhāṣya eva vyakte /


*6,229*

anye punaranyathaitāni sūtrāṇi varṇayanti /
tathāhi /

bhāve copalabdheḥ /
mṛdādeḥ kāraṇasya bhāva eva ghaṭādeḥ kāryasyopalabdheścānanyatvaṃ kāraṇātkāyarsya /
nahi yadyato bhinnaṃ tattadbhāva evopalabhyate /
na hyaśvo goto 'nyo gorbhāva evopalabhyate /
kiñca, bhāve tilādau kāraṇe, tailādyupalabhyate /
kārye ca bhāve kuṇḍalādau suvarṇādikam /
ataśca tadabhedasiddhiḥ /

satvāccāvarasya /
avarakālīnasya kāyarsya prāgutpatteḥ"sadeva somyedamagra āsīt'; iti sattvāvadhārarāccānanyatvaṃ kāraṇātkāryasya /


*6,230*

asadvayapadeśānneti cenna dharmāntareṇa vākyaśeṣāt /
"asadevedamagra āsīt',"asadvā idamagra āsīt'; iti prāgutpatteḥ kāryasyāsattvavyapadeśānneti cenna /
bhavedetadyadi kāryasvarūpābhiprāyeṇāyaṃ vyapadeśaḥ syātkintu vyaktatvalakṣaṇadharmāntarābhiprāyeṇa /
kutaḥ /
vākyaśeṣāt /
asadevedamagra āsīt ityasacchabdenopakrame nirdiṣyaṃ punastatsadāsīditi vākyaśeṣe nirdiśati /
asadvetyatrāpi"tadātmānaṃ svayamakuruta'; iti /
tena jñāyate nāsatkāryaṃ dharmāntareṇaivāsattvavyapadeśa iti /

yukteḥ śabdāntarācca /
yukteśca kāyarsya prāgutpatteḥ sattvaṃ kāraṇādananyatvaṃ ca gamyate /
śabdāntarācca /
yuktistāvadasadakāraṇādityādikā sāṅkhayoktā /
vṛttivikalpānupapattyādikā ca saugatoktā /
śabdāntaraṃ cāsadvayapadeśādanyaḥ"sadeva somyedamagra āsīt'; ityādisadvayapadeśaḥ /

paṭavacca /
saṃveṣyitaprasāritapaṭanyāyenedaṃ kāraṇātkāryasyānanyatvaṃ prāgutpatteḥ sattvaṃ ca pratipattavyam /


*6,238*

atra sūtrākṣarāṇāmārjavānārjavādicintā śiṣyaireva kriyatāmityāśayavān yaduktaṃ kāraṇātkāryasyānanyatvaṃ tattāvannirākariṣyan kimanena prabandhena nimittakāraṇānanyatvaṃ kāryasyopapāditam, utopādānakāraṇānanyatvamiti vikalpaṃ cetasi nidhāyādyaṃ nirākaroti- nityabheda iti //

nityabhedo nimittena hy ... // MAnuv_2,1.91a //

nityaśabdo niyamārthaḥ /
bheda eveti /
kāryasyeti śeṣaḥ /
hīti sarvapramāṇaprasiddhiṃ sūcayati /
tathāca sarvamidaṃ bādhitaviṣayamiti /
na dvitīyaḥ /
prakṛtānupayogāt /


*6,240*

viyadādiprapañcasya brahmānanyatvamupapādayituṃ khalvasyopanyāsaḥ /
tadyadi nāma upādānānanyatvaṃ kāryasya tadā kimāyātaṃ prakṛte /
nahi brahma prapañcopādānamityetaduktaprāyamiti manvāno dūṣaṇāntaramāha- upādāneneti //

... upādānena tu dvayam // MAnuv_2,1.91b //

hītyanuvartyate /
upādānena kāryasya dvayaṃ bhedābhedau pramitau /
tato 'sminnapi pakṣe bādhitaviṣayatvamiti /


*6,241*

kathaṃ kāryaṃ kāraṇena bhinnābhinnaṃ pramitamityata āha- asaditi //

asad yat kāryarūpeṇa kāraṇātmatayāsti hi // MAnuv_2,1.91cd //

yat ghaṭādikaṃ mṛdādikāraṇātmatayā prāgutpatterastīti pramitaṃ pareṇāṅgīkṛtaṃ ca tadeva pṛthubudhnodarākārādinā kāryarūpera prāgutpatterasat hi yasmāttasmādupādānena bhinnābhinnamiti niścīyate /

etaduktaṃ bhavati /
paro hi ghaṭādeḥ kāryasya prāgutpatteḥ sattvamabhyupagacchati /
tatkiṃ pṛthagevota mṛdādikāraṇātmatayeti vaktavyam /
nādyaḥ /
anabhyupagamāt /
anupalabdheśca /
dvitīye tu kāryasyopādānābhedastāvadaṅgīkṛtaḥ /
na cātyantābhedaḥ /
ghaṭādeḥ kāryākāreṇa prāgutpatterasattvāt /
yadā hi ghaṭādikaṃ mṛdādinātyantābhinnaṃ syāt /
tadā prāgutpatterghaṭādirūpeṇa satsyāt /
mṛdādestadā sattvāt /
na caivam /
tena jānīmo ghaṭādikaṃ mṛdādinā bhinnābhinnamiti /
atyantāsatkāryavādinaṃ prati bhedābhedasamarthanaṃ virodhaparihāraścottaratra vidhāsyata iti /


*6,243*

yacca kāryasya prāgutpatteḥ sattvamuktaṃ tadapi nopapannamityāha- asaditi //


yat ghaṭādikaṃ prāgutpatterastītyāvayoḥ sammatam /
tadeva tadāsacca yasmāttasmātsadeveti satkāryavādo 'nupapanna eva /
tasyaiva tadaiva tatraiva sattvamasattvaṃ ca viruddhamiti cenna /
rūpabhedena avirodhāt ityāśayenoktaṃ kāraṇātmatayā kāryarūpeṇeti /
nanvevaṃ sati kiñcitsadeva kiñcit asadeva sadasattu na kimapi syāt /
na syāt /
tayorapi rūpayoratyantabhedābhāvāditi /


*6,244*

syādetaduktaṃ yadyasattvaṃ prāgutpatteḥ kāryasya syāttadeva kutaḥ /
tathā cātyantābhinnaṃ kāryamupādānenetyato vipakṣe bādhakapradarśanena kāryasya prāgutpatterasattvamupādānādbhedaṃ copapādayati- anavastheti //

anavasthānyathā hi syāt sarvatrotpattināśayoḥ // MAnuv_2,1.92ab //

anyathā kāryasya prāgutpatterātyantike sattve kāraṇenātyantābhede cāṅgīkṛte sarvatrotpattināśayoranavasthā avyavasthā syāt /
yathā hi /
paṭastantvātmakaḥ prāgapi sanneva /
tathā tantavo 'pi svakāraṇātmakāḥ santa evetyanena krameṇa sarvasya mūlakāraṇātmakatvenātyantikaṃ sattvaṃ syāt /
naca mūlakāraṇamutpadyate vinaśyati ceti paṭādīnāmapyutpattivināśau na syātām /
tathāca paṭādaya utpattivināśavanta ātmādayastadrahitā iti lokavedaprasiddhotpavināśavyavasthā na syāditi /
upalakṣaṇaṃ caitat /
paṭādīnāmutpattivināśābhāve tatkārakavyāpāravaikalyaṃ syādityapi draṣṭavyam /


*6,246*

yadvotpattināśaśabdābhyāṃ sattvamasattvaṃ copalakṣyate /
tataścāyamarthaḥ /
yadi paṭastantvātmakaḥ prāgutpatterapi sanneva tadā(tadā)'pyupalabhyeta tantuvat /
yadi cānupalabhyamāno 'pi sannabhyupeyate, tadā sarvatrotpattināśayossadasattvayoranavasthā syāt /
upalabhyamānaṃ ghaṭādikamastyanupalabhyamānaṃ kharaviṣāṇādikaṃ nāstīti sarvajanasammatā vyavasthā na syāt /


*6,247*

athavotpattivināśaśabdābhyāṃ tadupapādanasyopalakṣaṇam /
tathā caivaṃ yojanā āstāṃ tāvadanyat /
satkāryavāde sarvatra śiṣyaṃ prativādinaṃ vā prati utpattināśayornāsadutpadyate na sadvinaśyatītyevaṃrūpopapādanasyāpyanavasthāvasthānābhāvaḥ syāt /
tathāhi /
idamupapādanaṃ kimarthamiti vācyam /
śiṣyādervidyotpattaye 'vidyānāśāya vāda jalpādau tu khyātyādyutpādāyeti cet /
tadvidyādikaṃ saccennotpādyam, sattvādātmavat /
asaccennotpādayituṃ śakyam, anyathā satkāryavādabhaṅgaprasaṅgāt /
evamavidyā satī cenna vināśyā /
anyathāpasiddhāntāpatteḥ /
asatī cet(nitarāṃ) na tāram /
nityanivṛttatvāt /
tataḥ sarvathā pratipādanāsambhava eveti /


*6,248*

yadi votpattivināśayoriti viruddhadharmopalakṣaṇam /
tathāhi /
yadi kāryamupādānātmakameva sadeva ca prāgutpatteḥ syāt /
tadotpattivināśādidharmāṇāmanavasthā syāt /
tantavaḥ prāgeva santo nedānīmutpadyante /
paṭastūtpadyate /
tantuṣvavinaṣṭeṣveva paṭo vinaśyati /
tantavo bahavaḥ paṭastvekaḥ /
evamākārābhidhānabuddhikāryabhedo 'pi draṣṭavyaḥ /
saiṣā vyavasthā na syāditi /


*6,249*

nanvetatsakalamapi paṭavacca, yathā prāṇādiriti vyaktyavyaktyavaṣṭambhena parihṛtam /
tathāhi /
vyaktyapekṣayotpattiḥ paṭādīnāmavyaktyapekṣayā ca vināśo yujyate /
vyaktyavyaktyarthameva ca kārakāṇyupayujyante /
vyaktyavyaktibhyāmevopalabdhyanupalabdhī bhavataḥ /
ata eva pratipādanaṃ saṅgacchate /
vyaktāvyaktarūpeṇaiva viruddhadharmā vyavatiṣṭhante /
yathā hi saṃveṣyitaḥ paṭo na sphuṭaṃ paṭa iti pratīyate /
na prāvriyate na śītamapanudati /
na bahudeśavyāpī bhavati /
prasāritastu sphuṭapratītyādimān /
na caitāvatā bhedaḥ /
nāpi prasāritaḥ prāgasat /
yathā ca prāṇāyāmena niruddhaḥ śārīro vāyurjīvanamātraṃ karoti notkṣepaṇādi /
nirodhāpagame tvāsāditavyaktistadapi karoti /
na tāvanmātreṇa bhidyate /
prāgasanvā /
tathaivaitadapi vyaktyavyaktibhyāṃ samañjasamiti /

atra brūmaḥ /
keyaṃ paṭasya prāgutpatterūrdhvaṃ ca vināśādavyaktirmadhye ca vyaktiḥ /
anupalabdhiravyaktirupalabdhirvyaktiriti cettatrāha- anavastheti //


yadyupalabdhyanupalabdhī evotpattivināśau /
tadā sarvatrotpattināśayoranavasthā syāt /
yadyadopalabdhaṃ tattadaivotpannam anupalabdhaṃ ca vinaṣṭamiti syāditi yāvat /
kiñca prāgutpattessattve paṭasya kasmānnopalabdhiḥ kathaṃ cordhvamupalabdhiriti praśnasya upalabdhyanupalabdhi(anupalabdhyupalabdhi)bhyāmeveti parihāraṃ vadandevānāṃpriyaḥ ślāghanīyaprajñaḥ syāt /
api ca prāgūrdhvaṃ ca tantūpalabdhau kathaṃ tanmātrasya sataḥ paṭasyānupalabdhiḥ /
anyathā tantūnāmapi sā syāt /


*6,251*

atha paṭadharmāveva vyaktyavyaktī /
tadā tāvapi tantūnāṃ vidyete na vā /
na cenna kāryakāraṇayeratyantābhedaḥ /
vidyete cettatrāha- anavastheti //
utpattināśavyavahārahetūvyaktyavyaktī yadi tantuṣvapi vidyete tadā sarvatrotpattināśayoranavasthā syāt /
tantavo notpannā na naṣṭāḥ /
kintu paṭa evetyutpattivināśavyavasthā na syāditi /


*6,252*

kiñceyamabhivyaktirutpattyādivyavahārakāraṇatayopādīyate /
sā kiṃ cakracīvarādibhiḥ prāgasatyevotpadyate mudgarābhighātādinā ca naśyati, uta prāgapi satyevāvināśinī ca /
evamavyaktirapi kiṃ prāgasatī mudgarābhighātādinotpadyate /
kiṃvā prāgapi satī /
ubhayatrādyau dūṣayati- anavastheti //
vyaktyavyaktyorutpattināśavattve sarvatrotpattināśayoranavasthā vyavasthābhāvaḥ syāt /
na kiñcidasadutpadyate na kiñcitsadvinaśyatīti siddhāntavirodhaḥ(hāniḥ) syādityarthaḥ /
dvitīyau dūṣayati- anavastheti //
vyaktyavyaktyoḥ sadā sattve sarvatrotpattināśayoranavasthāvyavasthitiḥ syāt /
tathāhi /
etāvantaṃ kālamanutpanno ghaṭa idānīmutpanna iti tāvanna syāt /
utpattivyavahārahetorabhivyakteḥ prāgapi sattvāt /
tathā mudgarābhighātādyuttarakālamapi ghaṭasattvavyavahāraḥ syāt /
taddhetorabhivyakteravinaṣṭatvāt /
tathedānīmeva naṣṭo ghaṭa ityapi na syāt /

vināśavyavahārakāraṇānabhivyakteḥ prāgapi sattvāditi /
kārakavyāpāravaiphalyatādavasthyaṃ sphuṭameva /


*6,253*

athaitaddoṣaparihārāya vyaktyavyaktyorapi vyaktyavyaktī svīkriyete, tadā tayorapyuktavikalpadoṣānuṣaṅgaḥ syāt /
atha tatrāpi vyaktyavyaktyantarāṅgīkārastadānavasthā syādityāha- anavastheti //
utpattināśayoriti viṣayasaptamī /
santvanantā vyaktayo 'vyaktayaśca /
mūlakṣayābhāvānnānavasthā doṣa ityata āha- anavastheti //
anyathānavacchinnavyaktyavyaktiparamparāṅgīkāre savartra ghaṭādāvutpattināśayoranavasthānavakḷptiḥ syāt /
uttarottaravyaktyavyaktisiddhau hi pūrvapūrvavyaktyavyaktīnāmutpattināśavyavahāranidānatvam /
tataḥ prayojanaparikṣayahetutvādanavasthā dūṣaṇameva /


*6,255*

nanvidaṃ bhavatāmapi samānam /
prāgasataḥ sattāsamavāyo hi janiriṣyate /
sattāsamavāyāha ca sadā santāviti prāgvināśottaramapi janiḥ syāt /
vināśaśca na syādityata āha- anavastheti //
iyaṃ sarvatrotpattivināśayoranavasthāvyavasthitiḥ anyathā samavāyasya janitvāṅgīkṛtāveva hi syāt /
nāsmanmate /
prakārāntareṇa janervakṣyamāṇatvāditi /

nanu janiḥ kiṃ prāk satī uta kārakavyāpārajanyā /
ādye prāgukta eva doṣaḥ /
dvitīye janerjanirapi tathetyanavasthā /
evaṃ vināśopītyata āha- anavastheti //
sarvatrotpattināśayoriyamuktānavasthā /
anyathā ghaṭajaneranyā janerjanirityaṅgīkāra eva syāt /
na tvevamaṅgīkriyate /
api tarhi ghaṭajanmaiva janmano janmeti /
yathā'huḥ"yathā janerjanirnānyā tasyā vastujanirjaniḥ'; iti /
ghaṭo jāyate ghaṭajanma jāyata ityanayorekārthataiva hi laukikaparīkṣakasammatā /
naca vyaktyavyaktyorapyevamaṅgīkartumucitam /
janmavināśāvupalabdhyanupalabdhī vā vihāya vyaktyavyaktyorevāprāmāṇikatvāditi /


*6,257*

nanu yadyasadutpadyeta sacca vinaśyeta tadā sarvatrotpattināśayoranavasthaiva syāt /
evaṃ sati hi (khara)śaśaviṣāṇamapyutpadyeta /
ātmā ca naśyedityata āha- anavastheti //
anyathā kāraṇaśaktyanādaraṇe hīmutpattivināśayoranavasthā syāt /
nacaivaṃ kintu yasyotpattikāraṇamasti tadasadapyutpadyate /
yasya ca vināśakāraṇaṃ vidyate tatsadapi niruddhayate /
naca kharaviṣāṇajanmanyātmavināśe vā kāraṇamastīti tayorjananavināśābhāvaḥ /
kāraṇasvabhāvānanugame tu satkāryavādino 'pyatiprasaṅga eveti /

athavā syādiyamanavasthā yadyatyantāsadevotpadyate sanmātraṃ vinaśyatīti brūmaḥ /
sadasadevotpadyata iti coktaṃ vināśakāraṇavadeva ca vinaśyatīti /


*6,258*

yaccoktaṃ bhāve copalabdheriti sūtrārthatvena, tadvayāpyavyāpakabhāvenaivopapannaṃ nātyantābhedasādhakam /
atha kāraṇoparaktabuddhiḥ sāmānādhikaraṇyabuddhirvātrābhimateti matam /
sāpi abhedamātreṇa caritārthā nātyantābhedasādhanāyālam /
kiñcaitadyukteścetyanenaiva śakyasaṅgrahaṃ na punarabhidhātavyam /
athānena pratyakṣamupanyasyate tadapi nātyantābhedasādhakam /
ata eva bhāvāccopalabdheriti sūtravipariṇāmo 'pi nirastaḥ /
sattvāccāvasyeti yuktiścedyukteścetyetenaiva gatārthatā /
śrutiścecchabdāntarāccetyanena /
asadvayapadeśāditi tu paricodanaivāsaṅgatā /
paramārthato brahmakāraṇatāparatvenāpātatastu śūnyasyābhāvasya vā kāraṇabhāvapratipādakatāpratibhāsena kāryāsattvasya śrutāvapratīteḥ /
yukterityuktayuktiṃ tūttaratrāpākariṣyāmaḥ /
śabdāntaraṃ tvācāryeṇaivānyatrānyathaiva vyākhyātam /
paṭe prāṇādau ca nātyantānupasañjātaviśeṣatvamityanudāharaṇamevetyalaṃ prapañcena /


*6,264*

yaduktaṃ śakto 'pi hīti yacca nityabheda itrata tadubhayaṃ śrutyāpi sādhayati- śakto 'pīti //

śakto 'pi bhagavān viṣṇurakartuṃ kartumanyathā // MAnuv_2,1.92cd //
svabhinnaṃ kāraṇābhinnabhinnaṃ viśvaṃ karotyajaḥ /
iti śruteravasita uktārtho 'yamaśeṣataḥ // MAnuv_2,1.93 //


akartuṃ śakto 'pi karoti /
anyathā vinā kāraṇaistadvayatyāsena ca kartuṃ śakto 'pi niyataiḥ kāraṇaiḥ karotīcchayeti yojyam /
svasmānnimittakāraṇādbhinnam /
upādānakāraṇenābhinnaṃ bhinnaṃ ca /
saṃsāriṇo hi viṣyigṛhītā iveśvarapreritā aniṣyamapi dhārakaprayatnenākṛtvā na sthātumīśate /
naca bhagavāṃstathetyakartuṃ śakto 'pītyuktam /
aśeṣataḥ prāgidānīṃ cokto na tu sannihita evetyarthaḥ /

// iti śrīmannyāyasudhāyāṃ ārambhaṇādhikaraṇam //



___________________________________________________________________________


[======= JNys_2,1.VII: itaravyapadeśādhikaraṇam =======]


*6,265*


// atha śrīmannyāyasudhāyāṃ itaravyapadeśādhikaraṇam //


// oṃ itaravyapadeśāddhitākaraṇādidoṣaprasaktiḥ oṃ //
asminnadhikaraṇe jīvakartṛtvapakṣaḥ śrutiprāpto vistarānnirākriyata iti bhāṣyam /
atra vaktavyam /
kimatra jīvasya sarvathā kartṛtvaṃ nirākriyate /
uteśvarādhīnaṃ tadaṅgīkṛtya svātantryamātram /
nādyaḥ /
tathā sati kartā śāstrātharvattvādityādivakṣyamāṇavirodhāpatteḥ /
svataḥkartṛtvānupapattirityādiviśeṣaṇavaiyarthyaprasaṅgācca /
na dvitīyaḥ /
hitakaraṇādidoṣaprasaktirityādisūtrāṇāṃ svātantryanirākaraṇaparatvena śakyayojanatve 'pi

kṛtsnaprasaktirniravayavatvaśabdakoṣo vetyasya sūtrasyāśakyavyākhyānatvāt /
idaṃ hi sūtraṃ sarvathā kartṛtvaṃ nirākurvadupalabhyate /

tathāhi /
kartṛtvaṃ kṛtsnaikadeśābhyāṃ vyāptam /
tatra kṛtsnaprasaktāvanubhavavirodhaḥ /
ekadeśāṅgīkāre ca"atha yaḥ sa jīvaḥ sa nityo niravayavaḥ'; ityanaṃśatvaśrutivyākopaḥ syāt /
nahi sāmarthyāparaparyāyaṃ prayatnādirūpaṃ kartṛtvamasmākaṃ jīvādbhinnam /
yena tasya vicitratve 'pi jīvasya niraṃśatvaṃ na vyāhanyeta /
tato vyāpakanivṛttyā vyāpyaṃ kartṛtvamapi vicitratve 'pi jīvasya niraṃśatvaṃ na vyāhanyeta /
tato vyāpakanivṛttyā vyāpyaṃ kartṛtvamapi nivartata iti khalvasya(tra) tātparyaṃ pratīyate /
prasaṅgasya viparyaye paryavasānāvaśyambhāvāt /
atha jīvakartṛtvasyeśvarādhīnatānaṅgīkāra evaito prasaṅgāvuktau na kartṛtvamātre /
tathā ceśvarādhīnatvameva viparyayavaryavasānalabhyaṃ bhaviṣyatīti cenna /
syādapyevaṃ yadi jīvakartṛtvasyeśvarādhīnatvāṅgīkāreṇemau prasaṅgau śakyasamādhānau syātām /
nacaivaṃ parādhīnenāpi khalvanena kṛtsnena vā kartavyamekadeśena vā /
tṛtīyaprakārābhāvāt /
bhāve vā tenaivāparādhīnatve 'pi kartṛtvopapatteḥ /

*6,265f.*

ato viparyayāparyavasānānnaivaṃ vyākhyānaṃ yuktamiti kartṛtvābhāva eva tātparyam /
tathāca vakṣyamāṇavirodhaḥ /
atha vastuto nāstyeva jīvasya kartṛtvam, ābhimānikaṃ tu tadityavirodhaḥ /
maivam /
vihāropadeśādityādinā vāstavasyaiva tasya sādhayiṣyamāṇatvāt /


*6,266*

ato durghaṭametadadhikaraṇamityato dvitīyapakṣamaṅgīkṛtya prasaṅgau jīvakartṛtvasyeśvarādhīnatānaṅgīkāraviṣayau vyākariṣyannādau tāvadīśvarādhīnatāṅgīkāre prasaṅganivṛttiprakāramāgamavākyodāharaṇena darśayati- anaṃśasyāpīti //

itaravyapadeśād dhitākaraṇādidoṣaprasaktiḥ | BBs_2,1.21 |

anaṃśasyāpi jīvasya kiñcit sāmarthyayojanām /
kāryeṣu yaḥ karotyaddhā namastasmai svayambhuve // MAnuv_2,1.94 //


kiñcitsāmarthyayojanāṃ kāryānurūpasāmarthyaprayogāt /
svayambhuve svatantrāya /
iti vacanādavasito 'yamabhipretaḥ artha ityanuvartate /
tataścaitaduktaṃ bhavati /
yadi jīvaḥ parameśvarādhīnatayā kartāṅgīkriyate /
tadopapadyate eva tasya kartṛtvam /
prasaṅgayoḥ samādhātuṃ śakyatvāt /
anaṃśatvasyābhyupagamena hi na niravayavatvaśabdakoṣaḥ /
anaṃśasyāpi parameśvarācintyaśaktivaśena kāryānurūpasāmarthyaprayogasambhavānna kṛtsnaprasaktiriti /
etacacānupadaṃ sphuṭībhaviṣyati /


*6,271*

evamupodghātaprakriyayā viparyayaparyavasānopapattimuktvedānīṃ vivakṣitārthe sūtraṃ yojayati- yadīti //

yadi bhāgena kāryeṣu jīvaśaktiṃ na yojayet /
haristadā hi sarvatra kṛtsnayatnoṃ'śitāpi vā // MAnuv_2,1.95 //


bhāgena kāryānuguṇāṃśena /
atra yadīśvarādhīnatayā kartā na syāditi vaktavye yadi bhāgenetyādivacanaṃ prasaṅgasphuṭīkaraṇārtham /
īśvarādhīnatvaprakāraprapañcanārthaṃ ca /
sarvatra tṛṇādānādāvapi kṛtsnayatnoṃ'śitāpi vā prasajyeta /
tathā cānubhavaśrutivirodhaḥ /
tasmātparameśvarādhīna eva jīvaḥ karteti śeṣaḥ /
na copādhikṛtāṃśakalpanayā kartṛtvasyāvidyakatvena (vo)copapattiḥ /
anaṃśasyāpītyādipramāṇasiddhopapannopapādakaparityāgenāprāmāṇikānupapannasvīkārasyāyuktatvāt /


*6,272f.*

nanu jīvaśaktyaivedaṃ ghaṭatām /
maivam /
tasyāghaṭitaghaṭakācintyaśaktyabhāvāt /
bhāve vā hitākaraṇādidoṣaprasaktiḥ /
na hyatrādhikaraṇe pūrvapakṣiṇā mahadādisakalakāryakartṛtvaṃ jīvasyāśaṅkitam /
kintu ghaṭādikartṛtvam /
tattāvadanubhavasiddhatvātkulālādīnāṃ na tyaktuṃ śakyam /
tatreśvarasyāpi kartṛtvāṅgīkāre kalpāgauravaṃ syādityato neśvarasya sarvakartṛtvamiti /
tathāca kathamacintyaśaktiprasaktiḥ /


*6,276f.*

nanu ca vyatireko gandhavaditi jīvānāmanekarūpatāṃ sūtrakāra eva vakṣyati /
utkrāntigatyāgatīnāmityaṇutvaṃ ca /
na cāṇoryugapadanekarūpatvaṃ vinā sāṃśatayopapadyata iti sāṃśatāpi tata eva siddhā /
tatkathamatra niravayavatvaśabdakopo vetyavādīditi gūḍhābhisandherāśaṅkāmaviditābhiprāyaiva pariharati- aṃśino hītyādinā //
sārdhena ślokadvayena /


*6,277*

aṃśino hi paṭādyā ye bhinnaireva parasparam /
aṃśairaṃśina ucyante naivameva hi cetanāḥ // MAnuv_2,1.96 //
ato 'naṃśina ityeva śrutireteṣu vartate /
apyanekasvarūpeṣu viśeṣādeva kevalam // MAnuv_2,1.97 //
bahusvarūpatākhyā tu teṣvastyeva hi sāṃśatā // MAnuv_2,1.98ab //


tatra bahusvarūpatākhyetyanena vakṣyamāṇamabhyupaiti /
bahvityanekatvopalakṣaṇam /
bahusvarūpatayā khyāyata iti bahusvarūpatākhyā /
tuśabdaḥ śrutiniṣedhyāyā vaiśiṣyayadyotakaḥ /
teṣu cetaneṣu /
hiśabdaḥ pramāṇaprasiddhiṃ dyotayati /
ata evāstyevetyavadhāraṇam /

tataścāyamarthaḥ /
astyeva vakṣyamāṇānekasvarūpatāṇutvaṃ ca tadanyathānupapattisiddhā sāṃśatā ca /
prāmāṇikasya tyaktumaśakyatvāditi /
tarhi kathamatra tadviruddhamuktamityata uktam- aṃśina ityādi //
ādyo hiśabdaḥ pramāṇaprasiddhau dvitīyo yasmādityarthe /
ye paṭādyā aṃśinaḥ prasiddhāste parasparaṃ bhinnairevāṃśairaṃśinā ca vakṣyamāṇaprakāreṇa bhinnābhinnaireva na tvatyantābhinnaiḥ tantvādibhiraṃśairaṃśina ucyante /
cetanāstvevameva paṭādivaduktarūpairaṃśairaṃśino na bhavanti /
kintu parasparamaṃśinā cātyantābhinnaiḥ /
yasmādevamataḥ prasiddhāṃśivaidharmyādevānekasvarūpeṣu tata eva sāṃśeṣvapyeteṣu cetaneṣvanaṃśina iti śrutirvartate /
natu sarvathāṃśarāhityābhiprāyeṇa /
ato na virodha iti /

nanu yadi bhedo nāsti kathaṃ tarhyanekatvaṃ tasyābhedavyāptatvāt /
kathaṃ cāṃśitvam /
matvarthasya bhedena vinānupapatterityata uktaṃ viśeṣādeveti /
bhedābhāve 'pi kevalaṃ tatpratinidherviśeṣādevānekasvarūpeṣviti yojanā /
yadvā"apyanekasvarūpeṣu'; ityanenaiva vakṣyamāṇamaṅgīkṛtyāṃśina ityādinā virodhaḥ parihṛtaḥ /
tatra bhedābhāve kathamanekatvamaṃśitvaṃ cetyāśaṅkāṃ

viśeṣādevetyādipādatrayeṇa pariharati /
kevalameva bhedena vinaiva teṣu bahusvarūpatā tayā khyāyamānā sāṃśatā cāsti /
katham /
viśeṣādeveti /
kuta etatkalpyate /
śrutidvayavirodhādeveti hiśabdenāha /
atra jīvasyeti prakṛte 'pi yaccetanā iti sāmānyenoktam /
tena cetanamātre 'pyayaṃ nyāya iti sūcayati /
athavā yadyaṃśino jīvāstarhi paṭādivadeva syurityasyācetanatvamupādhimanena dyotayati /


*6,281*

nanvevaṃ tarhi kiṃ jīvakartṛtvasyeśvarādhīnatvakalpanayā /
tadabhāve 'pi svato bahurūpatvasadbhāvenaikadeśataḥ kriyopapattau kṛtsnaprasakterabhāvāt /
vibhinnāṃśābhāvena niravayavatvaśabdakopasyāpi parihārāt /
etadatiriktasya ceśvarakṛtyasyādarśanāditi pūrvapakṣiṇā svābhisandhāvudghāṭite satyāha- bahutveneti //

bahutvenāvinābhāvād bhinnatā niyamād bhavet // MAnuv_2,1.98cd //
yadi naivaṃ niyamakṛd bhagavān puruṣottamaḥ // MAnuv_2,1.99ab //


yadi bhagavānpuruṣottama evaṃ na niyamakṛdbahutve 'pi bhedo jīveṣu mā bhūditi vyavasthāyāḥ kartā na syāt /
tadā bahutvena hetunā jīveṣvapi bhinnatā bhavet /
bahutvasaṅkhayāyā bhinnatvenāvinābhāvalakṣaṇānniyamāt /
yathoktam- tadanuvidhānātpṛthaktvam'; iti /

etaduktaṃ bhavati /
parameśvarānapekṣasya jīvasya kartṛtvāṅgīkāre na sarvathoktaprasaṅgadvayaparihāraḥ /
tathāhi /
kṛtsnaprasaktistāvatkathaṃ pariharaṇīyā /
bahutvasadbhāveneti cet /
tarhi bahutvasya loke bhedāvinābhūtatvena jīvasya bahutve bhinnatvamapyāpadyeta /
tathāca durātmā niravayavatvaśabdakopo duṣparihāraḥ /
atha tatparihārārthaṃ bhedo neṣyate /
tadā vyāpakanivṛttyā vyāpyanivṛtterāvaśyakatvādbahutvasaṅkhayāpi tyājyā syāt /
tathā ca punaḥ saiva kṛtyā kṛtsnaprasaktirāskandeta /
atha jaḍeṣveva yatra bahutvaṃ tatra bheda iti niyamo na cetaneṣviti cet /
kuta etat /
tatha darśanāditi cenna /
yataḥ kārakapraśno 'yaṃ na pramāṇapraśnaḥ /
svabhāvo 'yaṃ padārthānāmiti cenna /
anīśvaravādapādaprasārikāpātāt /
kiñca viruddhaśca svabhāvaśceti katham /
nahi svayameva svena sadvitīya iti yuktam /
pramitatvānna virodha iti tu pratyuktam /
caitanyasāmarthyādidaṃ ghaṭata iti cet /
dhūmavānapi kaścinniragniko ghaṭatām /
atha viśeṣaśaktyedamupapadyata iti cet /
ghaṭe 'pyupapadyatām /
nahi tatra viśeṣo nāsti /
viśeṣavaicitryānneti cet /
tadeva kutaḥ /
tasmādbhagavāneva svarūpasvabhāvaviśeṣāṇāṃ niyāmakaścaitanyamavacchedakaṃ vidhāya viśeṣaṃ nimittīkṛtya viruddhe apyabhedabahutve samāveśyābhedena niravayavatvaśabdakopamapāsya bahutvena kṛtsnaprasaktiṃ nyakkṛtya kāryānurūpaṃ sāmarthyāviśeṣaṃ (ni)yojayañjīvena kārayatītyaṅgīkartavyamiti /

nanvetatsarvaṃ jīvasāmarthyādināśakyasampādanaṃ kathaṃ bhagavānapi sampādayedityata āha- tasya tviti //


*6,282*

tasya tvaśeṣaśaktitvād yujyate savarmeva ca // MAnuv_2,1.99cd //

tadevamasya sūtrasyaivaṃ tātparyavyākhyāne na kaścidvirodha iti sthitam //


// iti śrīmannyāyasudhāyāṃ itaravyapadeśādhikaraṇam //
Vyāsa-(19)


___________________________________________________________________________



[======= JNys_2,1.VIII: śabdamūlatvādhikaraṇam =======]


*6,287*

// atha śrīmannyāyasudhāyāṃ śabdamūlatvādhikaraṇam //


// oṃ śrutestu śabdamūlatvāt oṃ //
nanvīśvarasyāpi kartṛtvaṃ na yujyate /
jīvavatkṛtsnaprasakteḥ /
nahi brahmāṇḍapipīlikā(ṇḍa)nirmāṇe samaṃ sāmarthyaṃ prayuñjānaḥ prekṣāvānbhavati /
gatyantarābhāvānna doṣa iti cenna /
īśvaratvavyāghātāt /
athaitatparihārātharmekadeśena pravṛttiraṅgīkriyate tadā"neha nānā'; ityādiniravayavatvaśabdakāṣaḥ syāt /
śarīrendriyādivikalatvācca na kartṛtvam /
nahi kaściccharīrādivikalaḥ kartopalabdhaḥ /
bhūmyādyādhāravidhuratvācca /
evaṃ daurghaṭye 'pi yadi kartṛtvamīśvarasya syāttadā jīvasyāpi kinna syāt /
viśeṣādarśanāt /
evañca sarvakartṛtvaṃ dūranirastamityayaṃ pūrvapakṣo 'trādhikaraṇe nirasyate /
tasya tātparyamāha- tasya tviti //

śrutes tu śabdamūlatvāt | BBs_2,1.27 |

tasya tvaśeṣaśaktitvād yujyate savarmeva ca // MAnuv_2,1.99cd //


*6,288f.*

tuśabdo jīvādviśeṣaṃ dyotayati /
caśabdo hetusamuccaye /
īśvarasyalaukikatvaśruterāgamaikāgamyatvena yuktivirodhānavakāśāt /
vicitraśaktiḥ puruṣaḥ',"sarvairyuktā śaktibhirdevatā sā'; ityādiśrutibhirvicitrāśeṣaśaktitvāvagamācca /
sarvaṃ bhinnāṃśarahitasyāpi kāryeṣu kṛtsnaprasaktyabhāvaḥ, svarūpāṃśabāhulye 'pi bhedābhāvaḥ, aṃśataḥ kāryakaraṇe 'pi niravayavatvaśabdakopābhāvaḥ, dehādirahitasyāpi kartṛtvanirvāha ityādi yujyata iti /

nanu durghaṭamapi jīvakartṛtvamīśvaraśaktyā ghaṭata ityatītādhikaraṇe 'bhihitam /
tathāca kathamatra pūrvapakṣāvakāśaḥ /
yo hi paratra pramitaṃ ghaṭayitumīṣye saḥ svasminna īṣye ityasambhāvitam /
ucyate /
naiṣorthaḥ sūtrakṛtātītādhikaraṇe 'bhihitaḥ /
kintvāgāminamarthaṃ manasi nidhāya jīvakartṛtvavādanirāsa eva vihitaḥ /
bhāṣyakāreṇa tu śiṣyahitaiṣiṇā vakṣyamāṇamapyarthamākṛṣṭa pūrvottaravirodhaḥ parihṛta iti /


*6,290*

pariṇāmavādino vivartavādinaśca brahmaṇo jagadupādānatvaṃ kṛtsnaprasaktirityanenākṣipya śrutestvityādinā samādhīyata iti vyācakṣate /
tathāhi /
na brahma jagadupādānam /
yatastathātve kṛtsnasyāpi brahmaṇaḥ kāryākāratāprasaktiḥ syāt /
sthitau ca brahmābhāve taddarśanopadeśānarthakyādi syāt /
athaitaddoṣaparijihīrṣayā brahma ekadeśena pariṇamate ekadeśena cāvatiṣṭhata ityucyate tadā"niṣkalaṃ śāntam'; ityādiniravayavatvaśabdakopaḥ syāditi /
atrocyate /
nāyaṃ doṣaḥ /
"tadātmānaṃ svayamakuruta'; ityādiśruterbrahmaṇo jagadupādānatvasya kṛtsnapariṇāmābhāvasya cāvagamāt /
śabdamūlatvena yuktivirodhānavakāśācca /
api ca sarvaśaktyupetā ca paradevatā śrūyate /
"sarvakarmā sarvakāmaḥ'; ityādi /
tato niravayavasyāpi brahmaṇaḥ kṛtsnaprasaktyabhāvenaiva jagadupādānatvamupapannamityādi /
tadetadvayākhyānamanupapannam /
evaṃ sati eṣāṃ sūtrāṇāmetadadhyāyāntarbhāvalakṣaṇasaṅgatyabhāvaprasaṅgāt /
tatkathamityata āha- virodha iti //


*6,291*

virodhaḥ sarvavaiśiṣṭaye yo dvitīye nirasyate /
nārāyaṇasya tvadhyāye ... // MAnuv_2,1.100a-c //


tuśabdo 'vadhāraṇe /
parabrahmaṇā nārāyaṇasya sarvasmāccetanādacetanācca vaiśiṣyaye vailakṣaṇye

paramotkṛṣṭatve 'tyantavyāvṛttatve ca yo yuktyādivirodhaḥ sa evātra dvitīye 'dhyāye nirasyate /
sakalajagadupādanatvena sarvātmakatvaṃ tu na sarvavaiśiṣyayam /
nāpi tadupayuktam /
pratyuta viruddhameva /
tatkathaṃ tatra virodhaparihāro 'trāntarbhāvamāsādayet /
nanu jagadupādānatvādeva sarvavaiśiṣyayaṃ brahmaṇaḥ /
nahi jagajjagadupādānamiti cet /
tatkimupādānopādeyayorbhedaṃ manyase /
tathāca tadananyatvamityuktavirodhaḥ /
jagat brahmaṇo na bhidyate brahma tu jagato bhidyata iti cet /
na /
uktottaratvāt /


*6,293*

prāgbrahmopādānatvasyānuktatvātkṛtsnaprasaktyādiparicodanaivānavakāśā /
pariṇāmapratipādakaśruterabhāvena gaganādiprapañcātmakasya tadasambhaviśabdamūlatvasarvaśaktitvādyasambhavena ca samādhānamapyayuktam /
vivartavāde tu sarvathāpi naiṣā śaṅkāvakāśamaśnute /
śuktyādikamiva rajatādyāropasya brahmāvidyakaprapañcāropasyādhiṣṭhānamiti spaṣṭamārambhaṇādhikaraṇe 'bhihitam /
tatra kathaṃ kṛtsnaikadeśavicāraḥ /
uktānavachānācchaṅgeti cet /
tarhyuktaṃ smareti vaktavyam /
spaṣṭaṃ cāropitatvaṃ prapañcasya brahmaṇyupapādanīyam /
śrutestvityādestu kā saṅgatiḥ /


*6,295*

kaścitparihārādarśanasambhrāntacitta āha /
avidyāsaṃvalitaṃ khalu brahma jagadupādānam /
tatrāvidyopādānatvasyāyamākṣepaḥ parihāraśceti /
tadatīva mandam /
na hyavidyāyā upādānatvamapi vāstavam /
tasyāvicāritaramaṇīyatayaiva śaṅkāviṣayatvāt /
kiñca kṛtsnaprasaktiḥ sāvayavatvaṃ cāvidyāyāṃ kiṃ kariṣyati /
samādhānaṃ tu sarvathāpyasaṅgatameva /
etena vikaraṇatvādityākṣepaparihārāvapyasaṅgatau veditavyau /
nahi bhramādhiṣṭhānatā śarīrādikamapekṣate /
īśvaraviṣayaṃ taditi cenna /
tasya kiraṇatvābhāvenākṣepānudayādityādikaṃ svayameva śiṣyairavagantavyamityasaṅgatirevācāryeṇoktā /


*6,296*

syādevamasaṅgatiryadi brahmaṇaḥ sarvavaiśiṣyaye virodhaparihāro 'dhyāhāyarḥ syāttadeva kuta ityata āha- tadanya iti /

... tadanye tatratatragāḥ // MAnuv_2,1.100c //


*6,296f.*

tasmātsarvavaiśiṣyayaviṣayādanye virodhāstatra tatraivādhikaraṇeṣu gatāḥ parihṛtāḥ /
etaduktaṃ bhavati /
avirodhalakṣaṇo dvitīyo 'dhyāya iti tāvatsammatam /
na cānukte 'rthe virodhaparihāraḥ saṅgata iti prathamādhyāyārthe 'virodho dvitīyasyārthaḥ /
prathame cādisūtreṇa śāstrīyaviṣayaprayojanapradarśanamukhena brahmajijñāsāyāḥ katarvyatvamuktam /
taccaturadhyāyīparisamāpyaṃ naikatra paryavasyati /
tataḥ kiṃ tadbrahma /
kiṃ jīvo 'tha jaḍamiti svarūpajijñāsāyāṃ śṛṅgagrāhikayā pradarśayitumaśakyatvāt /
dvitīyasūtre sarvato vailakṣaṇyapradarśanena sarvotkṛṣṭaṃ sarvasmādvayāvṛttaṃ ceti pratipāditam /
sajātīyavijātīyāsambhāvitadharmasya lakṣaṇatvāt /
sakaletaravyāvṛtteśca tatprayojanatvāt /
tṛtīyasūtre śāstraṃ tatra pramāṇamabhidhāya tasyottaraprabandhena sāmānyato viśeṣataśca sakalajīvajaḍavyāvṛttavastuviṣayatā samarthitā /
evaṃca dvaye virodhaḥ pariharaṇīyā bhavanti /
dvitīyasūtrasiddhasarvavaiśiṣyayaviṣayāḥ śāstrasamanvayaviṣayāśca /
tatra dvitīyā vikāraśabdādityādinā tatra tatraivādhikaraṇe parihṛtā iti pariśeṣātsarvavaiśiṣyayaviṣayavirodhaparihāra eva dvitīyārtha iti jñāyata iti /


*6,299*

nanu ca śrutīnāṃ parasparavirodho 'pi dvitīye 'dhyāye na viyadaśruterityādinā parihṛtaḥ /
tatkathamucyate brahmaṇaḥ sarvavaiśiṣyaye virodho dvitīye nirasyata iti tatrāha- sṛṣṭīti //

sṛṣṭisaṃhāravākyānāṃ jīvarūpābhidhāyinām /
apyanyonyāvirodhastu dvitīyādhyāyagocaraḥ // MAnuv_2,1.101 //


jīvarūpābhidhāyināṃ vākyānām /
upalakṣaṇametat /
prāṇādiviṣayāṇāṃ cetyapi draṣṭavyam /
sṛṣṭayādiviśeṣaṇamupapattisūcanārtham /
tuśabdo viśeṣārthaḥ /
yo dvitīyādhyāyagocaro vākyānāmanyonyavirodhaḥ so 'pi pārameśvarasarvavaiśiṣyayavirodhaparihāra eva /
kintu prathamadvitīyapādayoḥ sākṣattṛtīyacaturthayostu vyavadhāneneti viśeṣaḥ /
tathāhi /
śrutīnāṃ parasparavirodhaparihāraḥ kiṃ tatprāmāṇyanirṇayamātraphalaḥ kiṃ vā prameyanirṇayaphalaḥ /
nādyaḥ /
mīmāṃsāyā nyāyaśāstratvāpatteḥ /
kiñcaivaṃ sati viyadādisṛṣṭayādiviṣayavākyavirodhaparihāra eva kasmātkriyate /
uditahomādivākyānāmapi nyāyadarśana ivopādānopapatteḥ /

ākāśavāyvādikramaścātra nātyantamupayujyate /
dvitīye 'pi kiṃ sṛṣṭayādikameva prameyamuta tadaṅgibhūtamanyat /
nādyaḥ /
tasya svarūpato 'prayojanatvāt /
prathamāpratipādyatvam /
anyathā punaruditahomādivākyavirodhaparihāro 'pi kāryaḥ syāt /

*6,300*

sṛṣṭayādiviṣayaniṣkarṣo 'pi nirhetukaḥ /
ato dvitīya eva pariśiṣyate /
nacānyadasti sṛṣṭayādiprameyasyāṅgi prathamoktaṃ dvitīyasūtrābhihitādbrahmaṇaḥ sarvavaiśiṣyayāt /
ato yuktamuktam /
tadevaṃ paroktasūtrārthasya dvitīyādhyāyāntarbhāvalakṣaṇasaṅgatyabhāvādvirodhāccokta eva sūtrārtha iti siddham /


*6,302*

atreśvarasya śarīrendriyādikaraṇarahitatvātkartṛtvaṃ nopapadyate ityākṣepasamādhānārthaṃ sūtram //
oṃ vikaraṇatvānneti cettaduktam oṃ //
iti /
etadanārambhaṇīyam /
punaruktatvāt /
śrutestu śabdamūlatvāt, tātmani caivaṃ vicitrāśca hi, sarvopetā ca taddarśanāditi sūtrairevālaukikatvaśabdaikasamadhigamyatvavicitrānantaśaktitvādiyuktibhiḥ sarvasyāpi daurghaṭyasya parihṛtatvāt /
yo hi sākṣātkārakādhiṣṭhānasya neṣye sa śarīravyavadhānamapekṣate /
yasya cāgantukaṃ jñānaṃ sa tadarthamindriyāṇi /
yaśca guruśarīro nāvasthātuṃ śaknoti sa kṣityādikamādhāram /
bhagavāṃstu sarvaśaktiḥ sarvajñaḥ kimarthapapekṣateti /
naca kācidabhyadhikā śaṅkāsti yena punarārambhaḥ syādityata āha- māneti //

vikaraṇatvān neti cet tad uktam | BBs_2,1.31 |

mānameyaviśeṣeṇa punaruktirna jāyate // MAnuv_2,1.102ab //

yathā ata eva prāṇa ityādau mānaikye 'pi meyaviśeṣaṇa na punaruktidoṣastathātra meyaikye 'pi mānaviśeṣaṇa na punaruktidoṣaḥ /
etaduktaṃ bhavati /
kimuktārthoktimātraṃ doṣaḥ /
kiṃ voktānatiriktoktiḥ /
nādyaḥ /
uktaparihārātideśokterapi doṣatvānuṣaṅgāt /
dvitīyastu prakṛte na siddhaḥ /
prameyaikye 'pi pramāṇabhedasya sattvāt /
iha hi cidānandādyātmakadivyamaṅgalavigrahavato mahāpuruṣasya prākṛtaśarīrādyabhāve 'pi sakalakāryakartṛtvamapāṇipāda ityādiśrutimāśrityoktamiti /
yadvā mānameyayorviśeṣeṇeti yojyam /
tathā cāyamatharḥ /
pūrvasūtraiḥ sāmānyaviṣayapramāṇānyāśritya sāmānyata eva sarvānupapattiparihāro vihitaḥ /
iha tu viśeṣaviṣayeṇaiva pramāṇena viśeṣānupapattiparihāraḥ kriyata iti kathaṃ punaruktidoṣāvakāśa iti /
tathāpyākṣepo nopapadyata iti cenna /
viśeṣajijñāsayopapatteriti /

// iti śrīmannyāyasudhāyāṃ śabdamūlatvādhikaraṇam //


___________________________________________________________________________



[======= JNys_2,1.IX: naprayojanādhikaraṇam =======]


*6,304*


// atha śrīmannyāyasudhāyāṃ naprayojanādhikaraṇam //



*6,304f.*

// oṃ na prayojanavattvāt oṃ //
oṃ lokavattu līlākaivalyam oṃ /
yatprayojanārthaṃ sṛṣṭayādistadūnatvādapūrṇatetyākṣepaparihārāyedamadhikaraṇamārabhyate /
tadetadanupapannamityābhāti /
tathāhi /
yadyatra kartṛtvena prayojanavattvaṃ prasādhyāpūrṇatvasādhanaṃ pūrvapakṣiṇo vivakṣitaṃ syāttadā prathamasūtramayuktaṃ syāt /
apūrṇatāsādhakaṃ prati prayojanavattvahetorasiddhatvāt /
atha kartā cetprayojanavānsyāt tathā cāpūrṇaḥ syādityāpādanaṃ vivakṣitam /
tadā vyarthamevedaṃ sūtram /
na cāpūrṇastato na prayojanavāniti pareṇaivāṅgīkṛtatvāt /
anyathā viparyayāparyavasānāt /
lokavattu līlākaivalyamiti dvitīyasūtraṃ tu pakṣadvaye 'pyayuktam /
sādhanāpādanadūṣaṇasyānudbhāvanāditi /
maivam /
īśvarasya sṛṣṭayādinā prayojanamasti na vā /
ādye 'pūrṇatvaṃ prasajyeta /
dvitīye tu kartṛtvānupapattiḥ tasya prayojanavyāptatvādityubhayathāpīśvarasya jagatsṛṣṭayādikartṛtvānupapattirityatra pūrvapakṣiṇo vivakṣitam /
tatra prathamasūtreṇa prayojanābhāvapakṣaṃ sayuktikamupādatte /
tatroktadoṣaparihārārthaṃ dvitīyaṃ sūtram /
yadvā kartṛtvena prayojanasya tena cāpūrṇatvasya idaṃ sa dhanaṃ vivakṣitamutāpādanamiti siddhāntī vikalpyādyamādyena nirācaṣṭe /
na kartṛtvena prayojanavattvaṃ sādhyam /
kṛtakṛtyatvena prayojanābhāvasyaiva niścitatvāt /
nacāsiddho hetuḥ /
athaiṣa eva parama ānando niraniṣyo niravadya iti śruteḥ /
prayojanavattvenāpūrṇatānumānaṃ tu garbhasrāveṇaiva ga(li)tamiti /
ādyasya dūṣaṇāntaraṃ vadandvitīyaṃ dvitīyena nirākarotīti /


*6,308*

nanūktamatra lokavaditi sūtreṇa sādhanasyāpādanasya vā na kiñciddūṣaṇamudbhāvyata iti /
maivam /
bādhāderudbhāvanādityāśayavāndvitīyasūtrasya tātparyamāha- sadeti //

na prayojanavattvāt | BBs_2,1.32 |
lokavat tu līlākaivalyam | BBs_2,1.33 |


sadā pravṛttirīśasya svabhāvādeva kevalam // MAnuv_2,1.102cd //


*6,309*

yathā loke jvalanapavanādīnāṃ tatheśasyāpi sadā sṛṣṭayādau kevalaṃ prayojanena vinā svabhāvādeva pravṛttiḥ pramiteti śeṣaḥ /
tadaneneśvarasya pravṛttyā prayojanasādhanamanaikāntikaṃ bādhitaviṣayaṃ ca /
prasaṅgastu vyaptivikalo viparyayāparyavasāyī cetyuktaṃ bhavati /
atha manyeta /
cetanapravṛttiḥ na prayojanena vinā dṛṣṭā /
ato nānaikāntyādīti /
tadapi nāsti /
mattasya sukhodrekādeva nṛttagānādipravṛttidarśanāt /


*6,310*

nanu ca prekṣāvatpravṛttirna prayojanoddeśena vinopalabdhā iyaṃ ca prekṣāvatpravṛttiḥ /
ataḥ prayojanoddeśavatī syāditi sādhyamāpādyaṃ cetyata āha- aṅgeti //

aṅgaceṣyā yathā puṃsaḥ kāściduddeśavarjitāḥ // MAnuv_2,1.103ab //

kāścidvayākhyānādāvaṅgulicālanādikāḥ /
uddeśavarjitāḥ prayojanoddeśavarjitāḥ /
tathā īśasyāpi pravṛttiriti pūrveṇānvayaḥ /
tathāpyanaikāntyādyanistāra iti bhāvaḥ /


*6,311*

yaduktamīśvarasya pravṛttiḥ prayojanena vinā svabhāvādeva pramiteti /
tatpramāṇamidānīmāha- devasyeti //

devasyaiṣa svabhāvo 'yamityāha śrutirañjasā // MAnuv_2,1.103cd //

"devasyaiṣa svabhāvo 'yamāptakāmasya kā spṛhā'; iti śrutirañjasā sphuṭamuktamarthamāha /
devasyāyaṃ sṛṣṭayādiviṣaya eṣaḥ icchā /
tatpūrvikā pravṛttiriti yāvat /
svabhāva eva /
na prayojanāya /
kutaḥ āptakāmasya prayojanaspṛhāsambhavādityarthaḥ /


*6,312*

kecididaṃ sūtramanyathā vyācakṣate /
yathā loke saptadvīpāṃ medinīmadhitiṣṭhataḥ sampūṇarśauryavīryaparākramasyāpi mahārājasya kevalalīlaikaprayojanāḥ kandukādyārambhā dṛśyante /
tathaiva parasyāpi brahmaṇaḥ svasaṅkalpamātrāvakḷptajagajjanmasthitidhvaṃsāderlīlaiva prayojanamiti tadetannirākaroti- krīḍāmiti //

krīḍāṃ prayojanaṃ kṛtvā sṛṣṭiḥ śrutivirodhinī // MAnuv_2,1.104ab //

"bhogārthaṃ sṛṣṭirityanye krīḍātharmiti cāpare'; iti krīḍāprayojanāṃ bhagavataḥ sṛṣṭayādipravṛttiṃ vadataḥ pūrvapakṣīkṛtya devasyaiva svabhāvo 'yamiti sayuktikaṃ prayojanaleśābhāvaḥ śrutyā siddhāntitaḥ /
ataḥ śrutiviruddhatvādapavyākhyānamevaitat /

sūtrākṣarānanuguṇaṃ caitadvayākhyānamityāha- itīti //

iti kevalalīlaiva nirṇītā prabhuṇā svayam // MAnuv_2,1.104cd //


*6,312f.*

yata evaṃ"krīḍāṃ prayojanaṃ kṛtvā sṛṣṭiḥ śrutivirodhinī'; iti tasmāt śrutyanusāriṇā prabhuṇā svayaṃ sākṣātsṛṣṭaṃ kevalalīlaiva sṛṣṭayādipravṛttirnirṇītā līlākaivalyamiti /
natu līlārtheti tato 'pyayuktamidaṃ vyākhyānamiti /
yadvā pūrvavākyokto hetuḥ, ayaṃ sādhyanirdeśaḥ /
yasmāllīlāṃ prayojanaṃ kṛtvā sṛṣṭiḥ śrutivirodhinī tasmādetatsūtre kevalalīlaiva sūtrakṛtā nirṇītā vyākhyātā na punarlīlārtheti /


*6,313*

kiñca kartṛtvena prayojanavattāṃ sādhayannāpādayanvā praṣṭavyaḥ /
kiṃ prayojanaṃ svasambandhi vivakṣitam, uta parasambandhi, atha sādhāraṇam /
ādye sādhane 'naikāntyam /
āpādane vyāptyabhāvaḥ /
viparyayaparyavasāne vyabhicāra eva /
dṛśyante hi kṛpālavaḥ svaprayojanamanuddiśya paraprayojanārthameva pravartamānāḥ /
nacādṛṣṭārthamiti vācyam /
paśūnāṃ paśuprāyāṇāṃ cāpatyapālanādau pravṛttidarśanāt /
naca prayojanoddeśitā kṛpālutā ceti sambhavati /
dvitīye 'pyanaikāntyādikameva /
svaprayojanārthaṃ pravṛtterbahulamupalambhāt /
bhagavato 'pi svaprayojanābhāve 'pi paraprayojanoddeśitāṅgīkāreṇa krameṇa siddhasādhaneṣyāpādanāsiddhatvaprasaṅga(ṅgā)śca /
ata eva na tṛtīyo 'pi /
ata eva (yena) kenacitkartṛtva(tve)viśeṣaṇaṃ, pravṛttisvabhāvatve sadā pravartetetyatiprasañjanaṃ ca pratyuktam /


*6,314*

syādetadevam /
yadīśvarapravṛttau paraprayojanoddeśaḥ syānna cāsāvaṅgīkartumucitaḥ /
kā spṛhā na kāpīti śrutyā neti sūtrakāreṇa ca sarvathā prayojanoddeśasya nivāritatvādityata āha- ātmeti //

ātmaprayojanārthāya spṛhāṃ śrutiravārayat // MAnuv_2,1.105ab //

śrutiriti sūtrakṛto 'pyupalakṣaṇam /
paraprayojanārthatāṃ tvaṅgīkuruta eveti śeṣaḥ /


*6,324*

kuta etadavagamyata ityata āha- neti //


*6,325*

na prayojanavattvenetyata āha jagadguruḥ // MAnuv_2,1.105cd //

yataḥ paraprayojanamaṅgīkṛtyātmaprayojanārthatāmeva neti nyavārayat /
ata eva hi prayojanavattvāditi tatra hetumāha- anyathā naitaṃ brūyāt /

etaduktaṃ bhavati /
yadi neti sautrīpratijñā svaparaprayojanaviṣayā syāt tadā prayojanavattvāditi heturanaikāntikaḥ syāt /
svayaṃ vyāpārasādhyaprayojanavato 'pi paraprayojanoddeśena vyāpāradarśanāt /
svaprayojanamātraviṣayatve tu nāyaṃ doṣaḥ /
yo 'vāptayatprayojanaḥ sa svārthaṃ na taduddiśatīti vyāpteranavadyatvāt /
ataḥ prayojanavattvāditi hetuṃ brahmaṇaḥ sūtrakṛdātmaprayojanoddeśameva neti nivāritavān /
na paraprayojanoddeśamapi /
tathātve tadvayāptameva kamapi hetuṃ brūyāt /
svaprayojananiṣedhaṃ kurvāṇo viśeṣaniṣedhasya śeṣābhyanujñājñāpakatvātparaprayojanaspṛhāmabhyupaitīti (manujānātītyapi) jñāyata iti /
upalakṣaṇametat /
śrutirapyāptakāmasyeti hetugarbhaviśeṣaṇaṃ prayuñjānā'tmaprayojanaspṛhāmevākṣipati paraprayojanaspṛhāmabhyupaitīti jñāyata ityapi draṣṭavyam /


*6,326*

iha hi buddhireveśvarasyāvyāhatā kriyāśaktiḥ, tathaiva sarvasyopapattau kimicchāprayatnakalpanayā /
yadvā prayatnaḥ kartatvam /
tasyaivākhyātārthatayā nirṇītatvāt /
sa ca dvedhā buddhimapekṣate /
utpattyarthaṃ viṣayaniyamārthaṃ ca /
tatreśvaraprayatno yadyapi nityatvānnotpattāvapekṣate buddhim /
tathāpi viṣayaniyamārthaṃ tāmapekṣata eva /
na hi nirviṣaya evāsau /
vyarthatvaprasaṅgāt /
naca svabhāvata evārthapravaṇaḥ /
buddhitvaprasaṅgāt /
buddhireva hi svabhāvato 'rthapravaṇā /
ato jñānaprayatnābhyāmeva sarvanirvāhānneśvarasyecchāsti /
na cecchayā prayatnasya viṣayaniyamaḥ /
tasyā api svato viṣayapravaṇatābhāvāt /
tadarthaṃ buddhayaṅgīkāre tayaiva prayatnasya viṣayaniyamopapatteḥ kimantargaḍunecchayeti manvā(nyamā)nāḥ kecit,"kā spṛhā'; itrata śrutirneśvarasya prayojanecchāmātraniṣedhaparā, kintvicchālakṣaṇaṃ guṇameva niṣedhatīti vyācakṣate /
tannirākaroti- icchāmātramiti //


*6,327*

icchāmātraṃ prabhoḥ sṛṣṭiriti sṛṣṭau viniścitāḥ /
iti praśaṃsayā ... // MAnuv_2,1.106a-c //


kā spṛheti śrutyā neśvarasyecchāmātraṃ niṣi(ṣe)dhyate /
kutaḥ /
icchāvattvasya pramāṇataḥ siddhatvāt /
tathāhi /
"vibhūtiṃ prasavaṃ tvanye manyante sṛṣṭicintakāḥ /
svapnamāyāsarūpeti sṛṣṭiranyairvikalpitā /
kālātprasūtiṃ bhūtānāṃ manyante kālacintakāḥ'; iti pariṇāmavādaṃ vivartavādaṃ kālādinimittavādaṃ cānyamatatvenoktvecchāmātramiti śrutyā svamatamucyate /
ye sṛṣṭiviṣaye viśiṣṭaniścayavantaste, prabhoricchāmātrādhīnā sṛṣṭirna brahmapariṇāmo naca tadvivarto nāpi kālādinimitteti manyanta iti /
anayā prabhoricchāmātrāyattatāṃ sṛṣṭermanyamānānāṃ viniścitā iti praśaṃsayā tasyecchāvattvamavagamyate /
yadīśvarasyecchā na syāt tadā tadāyattatāṃ sṛṣṭermanyamānā vipayarstāḥ syuḥ /
viśiṣṭaniścayavanta ityeṣā praśaṃsānupapannā syāt /
naca praśaṃsātvādevārthāsiddhiḥ /
pūrvottarapakṣāvadhāraṇaprasaṅge praśaṃsānupapannā syāt /
naca praśaṃsātvādevārthāsiddhiḥ /
pūrvottarapakṣāvadhāraṇaprasaṅge praśaṃsāyā api yāthārthyāvaśyambhāvāt /
anyathā pariṇāmādivādā api praśaṃsyeran /


*6,330*

... kāmaśrutibhyaścaiva ... // MAnuv_2,1.106cd //

na kevalaṃ śrutārthānupapattyā /
api tarhi"kāmastadagre samarvatādhi',"so 'kāmayata'; ityādibhyo bhagavataḥ kāmapratipādakaśrutibhyaścecchāvagamyate /
evaśabdaḥ śrutīnāmarthāpattitaḥ prābalyasūcakaḥ /
icchākāmaśabdayorjñānaprayatnopalakṣaṇatvasya sambhavānnārthāpattiśrutibhyāmicchāsiddhiriti cenna /
mukhye bādhakābhāvāt /


*6,331*

... yuktitaḥ // MAnuv_2,1.106d //

mā vā saitsīdicchā 'rthāpattiśrutibhyāṃ yuktitastāvatsetsyati /
tathāhi /
īśvara icchāvān ātmatvāt yajñadattavat /
naca muktādau vyabhicāraḥ /
tatrāpi tasyāḥ sādhayiṣyamāṇatvāt /
jñānavattvāt, prayatnavattvāt, kartṛtvādvā /
īśvarajñānaṃ vecchāsamānāśrayaṃ jñānatvādasmadādijñānavat /
evaṃ tatprayatnamapi pakṣīkṛtya prayoktavyam /
yadvā kṣityādikamicchāvajjanyaṃ kāryatvādghaṭavat /
nanvevaṃ duḥkhādikamapi sādhayituṃ śakyamiti cettatkimatiprasaṅgabhīruṇā kṣityāderbuddhimatkāraṇakatvānumānamapi tyakṣyate /
duḥkhādisādhane bādho 'sti na buddhisādhana iti cet /
samaṃ prakṛte 'pi /

*6,333*


mahātātparyayukteśca ... // MAnuv_2,1.106c //


nanvīśvarasya icchābhāve bādhakābhāvādaprayojakatvamanumānānāmiti /
maivam /
mahātātparyayukteśca /
yadīśvarasya icchā na syāt tadā tasminsarvavedānāṃ (vedāntānāṃ) mahātātparyaṃ na syāditi bādhakasadbhāvāt /
icchā niṣprayojaneti cet /
syādevaṃ yadi prayojanamanurudhya kalpyate /
anyataḥ siddhe 'rthe kiṃ prayojanagaveṣaṇayā /

... necchāmātraṃ niṣiddhayate // MAnuv_2,1.106d //


*6,333f.*

kiñcaivaṃ sati buddhirapi nāṅgīkaraṇīyā /
svarūpasāmarthyenaiveśvarasya kartṛtvopapatteḥ /
lokavairūpyamiti cet /
tatkimudāsīnasya boddhuḥ kartṛtvamupalabdhaṃ loke, yenānicchato 'pi tadīśvarasyāṅgīkriyate /
prayatnavata eva vā kartṛtvaṃ bhaviṣyati /
tasya viṣayaniyamārthaṃ buddhireṣyavyeti cenna /
buddhivatsvato viṣayapravaṇatopapatteḥ /
tathātve buddhito bhedo na syāditi cenna buddhitvādinaiva tadupapatteḥ /
anyathā paropādhikaviṣayapravaṇatvayoricchāprayatnayorapi bhedā na syāt /
viṣayaniyamārthamiti ca ko 'rthaḥ /
kiṃ viṣayaviśeṣasambaddhatayotpādā(nār)tham, utotpannasya sthitasyaiva vā tatsambandhārtham, atha tajjñānārtham /
nādyaḥ /
anāditvāt /
sāditve 'pi ka(kā)raṇasāpekṣa(ta)yā buddherapi parato viṣayapravaṇatāpatteḥ /
na dvitīyaḥ /
paurvāparyobhāvāt /
nahi prayatnaḥ utpādya sthitvā vā paścādviṣayeṇa sambaddhayate /
na tṛtīyaḥ /
svarūpagrāhakapramāṇenaikatadgrahaṇāt /
buddherapi parāpekṣāprasaṅgācceti /


*6,348f.*

mahātātparyayukteśceti yaduktaṃ tadasat /
yadīśvaro necchāvānsyāttadā śrutimahātātparyaviṣayo na syādityatra vyāptyabhāvāt /
icchārahitasyāpi dharmādestattacchāstramahātātparyaviṣayatvadarśanāt /
āpādyasyāniṣṭatvābhāvāccetyata uktaṃ vivṛṇoti- mokṣārthā iti //


*6,349*

mokṣārthāḥ śrutayo yasmāt sa ca tasya prasādataḥ /
unninīṣativākyācca lokadṛṣṭānusārataḥ // MAnuv_2,1.107 //
icchāṃnimittako yasmāt tadabhāve kutaḥ śrutiḥ /
mahātātparyarahitā pramāṇatvaṃ gamiṣyati // MAnuv_2,1.108 //


yasmātkāraṇātsarvā api śrutayo mokṣārthāḥ mokṣaprayojanāstasmāttadabhāve parameśvarasyecchābhāve tata eva mokṣārthatābhāve śrutistatra mahātātparyarahitā syāt /
tathāca kathaṃ pramāṇatvaṃ gamiṣyatīti yojanā /
mokṣārthatve kimīśvarasyecchayetyata uktam- sa ceti //
sa ca mokṣastasya īśvarasya prasādato yasmāttasmāttadabhāva iti sambandhaḥ /
tathāpīśvarasya prasādena bhāvyaṃ kimicchayetyata prasādata ityetadvayākhyātam- icchānimittaka iti //
īśvarajñānādeva mokṣasiddheḥ kiṃ tatprasādenetyata uktam- loketi //
vimato bandhamokṣaḥ prabhuprasādasādhyo mokṣatvāt śṛṅkhalāmokṣavat ityādilokadṛṣṭavyāptyupetānumānānusārataḥ ityatharḥ /
na kevalamanumānātkintvāgamādapītyuktaṃ- unninīṣatīti //
"eṣa hyeṣa sādhukarma kārayati taṃ, yamebhyo lokebhya unninīṣate'; iti vākyācca /
atra karmetyupalakṣaṇam /
unninīṣate ūrdhvaṃ netumicchati /
yadvā prasādaśabdenecchocyate ityata idaṃ vākyaṃ (vākyametat) jñāpakam /
lokadṛṣṭā(dṛṣṭa)nusārata ityetadapyasyaiva arthasya jñāpakamuktam /
śrutaya ityupakramya śrutirityekavacanaṃ kaimutyārtham /
ekamapi vākyaṃ na tatra mahātātparyavatsyāt /
kimuta sarvāḥ śrutaya iti /


*6,351*

etaduktaṃ bhavati /
śāstraṃ hi sādhyasādhanabhāvavadviṣayaprayojanavattayā vyāptam /
tatra śrutīnāṃ mokṣa eva prayojanam /
"teṣāṃ duḥkhaprahāṇāya śrutireṣā pravartate'; iti vacanāt /
mokṣādanyatrātyantikaduḥkhaprahāṇāyogāt /
svargādiprayojanaṃ bhavadapyavāntarameva na pradhānam /
viṣayastu parameśvara eva /
"sarve vedā yatpadamāmananti'; ityādivacanāt /
dharmādikaṃ tvavāntarapratipādyam /
abhipretaprayojanasādhanaṃ ca viṣayatāmaśnute /
naca dharmādikaṃ mokṣasādhanam /
"puṇyacito lokaḥ kṣīyate'; iti śruteḥ /
ato bhagavatyeva mokṣasādhanatvātsavarśrutīnāṃ mahātātparyam /
nacāvyāpṛtātsādhanātphalasiddhiḥ /
vyāpāraśca prasāda eva /
natu śrutijanitaṃ tajjñāna sākṣātkāro vā /
"yasya prasādāt'; ityādivākyāduktānumānācca /
jñānaṃ tu prasādasādhanamiti na sambandhānupapattiḥ /
prasādo nāmecchāviśeṣaḥ /
tathā sati"unninīṣate'"tadicchayā yato hyasya bandhamokṣau pratiṣṭhitau'; ityādiśrutibhiḥ"yasya prasādāt'; iti śruteraikārthyalābhāt /
prasanno 'smīti pratītau paropacikīrṣāyā eva sphuraṇāt /
tathāca yadīśvaro necchāvāṃstadā na prasidedghaṭavat /
sāmānyābhāve viśeṣābhāvaniyamāt /
prasādarahitaśca na mokṣasādhanaṃ syāt /
yadyatra vivakṣitāvāntaravyāpārarahitaṃ na tattatra sādhanamiti vyāpteḥ /
mokṣaṃ pratyasādhanaṃ ca na mokṣaśāstramahātātparyaviṣayaḥ syāt /
tathāca mokṣaprayojanatā śrutīnāṃ hīyeta /
naca viṣayāntaraṃ prayojanāntaraṃ cāstīti viṣayaprayojanaśūnyatvādaprāmāṇyamevāpadyeta /
naca tadapauruṣeyatāyānāśaṅkitadoṣasya vākyasyopapadyate /
ato 'vaśyamuktena krameṇecchāvattvaṃ bhagavato 'ṅgīkaraṇīyamiti /


*6,355f.*

nanu viṣayābhāve syādaprāmāṇyam /
phalābhāve tu kathamaprāmāṇyāpādanam /
nahi phalavattvaṃ prāmāṇyam /
kintu yāthārthyamevetyuktam /
nāpi prāmāṇyasya vyāpakam /
tṛṇādidarśanasya prayojanābhāve 'pi prāmāṇyābhyupagamādityata āha- yāthārthyameveti //


*6,356*

yāthārthyameva mānatvamapi vākyaṃ prayojakam /
mānatvameti ... // MAnuv_2,1.109a-c //


yadyapi yāthārthyameva mānatvaṃ na phalavattvam /
nāpi tena vyāptam /
tathāpi vākyaṃ prayojakameva mānatvametīti yuktamāpādanam /
etaduktaṃ bhavati /
prāmāṇyamātrasya prayojanavattvena vyāptyabhāve 'pi tadviśeṣasya vākyaprāmāṇyasyāstyeva /
padānāmiṣyasādhana eva gṛhītasaṅgatikatvāt /
padasaṅgatigrahaṇasavyapekṣasyaiva vākyasya bodhakatvāt /
phalasya viṣayaviśeṣe vākyaprāmāṇyanirṇayahetutvācca /
ato vyāpakābhāve vyāpyavākyaprāmāṇyābhāvāpādanamupapannameveti /


*6,357*

nanu ca mahātātparyagocarasya viṣayasya paramaprayojanasya cābhāve 'pyavāntaraviṣayeṇa dharmādināpradhānaprayojanena ca svargādinā viṣayaprayojanavatī śrutiḥ pramāṇaṃ bhaviṣyati ityata āha- tatrāpīti //

... tatrāpi yat sampūrṇaprayojanam // MAnuv_2,1.109cd //

vākye 'pi nirdhāraṇe saptamī /
prayojanavattve 'pīti vā /
yat vākyaṃ sampūrṇaprayojanaṃ mahāprayojanam /
upalakṣaṇaṃ caitat /
pradhānaviṣayaṃ cetyapi draṣṭavyam /
yaditi śravaṇāttaditi labhyate /
sampūrṇaprayojanamiti cāvartanīyam /

mānatvametītyanuvartanīyam /
tathā cāyamarthaḥ /
nāvāntaraviṣayaprayojanābhyāṃ vākyasya prāmāṇyaṃ sambhavati /
kinnāma yadvākyaṃ yanma(hā)hatprayojanamuddiśya yaṃ pradhānaṃ viṣayaṃ pratipādayituṃ pravṛttaṃ tattābhyāṃ(eva) prayojanaviṣaṭābhyāmupetaṃ prāmāṇyamaśnute /
tadabhāve 'vāntaraprayojanāderapyasiddheḥ /
siddhau vā vā tasyaiva prādhānyaprāpteḥ /
vedavākyaṃ ca mokṣoddeśena mahātatparyopetamityuktam /
tattayoreva viṣayaprayojanayorupapattau pramāṇaṃ syānnānyatheti /

// iti śrīmannyāyasudhāyāṃ na prayojanādhikaraṇam //
Vyāsa-(20)

___________________________________________________________________________



[======= JNys_2,1.X: vaiṣamyanairghṛṇyādhikaraṇam =======]



*6,359*


// atha śrīmannyāyasudhāyāṃ vaiṣamyanairghṛṇyādhikaraṇam //


// oṃ vaiṣamyanairghṛṇye na sāpekṣatvāttathā hi darśayati oṃ //
prāṇināṃ vividhāndehendriya(yādi)viṣayāṃstatphalaṃ ca sukhaduḥkhalakṣaṇamutpādayannīśvaraḥ kiṃ tadīyaṃ dharmādharmarūpaṃ karmāpekṣate na vā /
ādye tasya svātantryapracyutiḥ /
dvitīye nirnimittaṃ kāṃścitsukhayanviṣamaḥ syāt /
kāṃścidduḥkhayannirghṛṇaḥ syāt /
ityubhayathā na tasya sarvakartṛtvamityeṣa(va) pūrvapakṣo 'trādhikaraṇe nirākriyate /
tatra tāvadādyena sūtreṇa karmādisāpekṣasya kartṛtvamabhyupetya vaiṣamyanairghaṇye parihṛte /
apekṣaṇīyaṃ karmādi īśvarāyattaṃ na vā /
neti pakṣe sarvakāraṇatvahāniḥ /
ādye nirnimittaṃ viṣamāṇāṃ karmaṇāṃ kārayiturvaiṣamyanairghṛṇye syātāmityākṣipya karmādīnāmanāditā(tvā)bhyupagamena samādhānamuktaṃ"na karmāvibhāgāditi cennānāditvāt'; iti sūtreṇa /
evaṃ tarhi karmādisāpekṣasya svātantryaṃ na syādityāśaṅkayoktamupapadyate ceti /
karmādyapekṣasyāpi tasya svātantryamupapadyate /
karmādisattāderapi tadadhīnatvasyārambhaṇādhikaraṇe samarthitatvāt /
nahi svādhīnasattādikamapekṣamāṇasya svātantryapracyutiryukteti /
evaṃ(ca) tarhi tadapekṣā nāmānapekṣaiva /
tathāca punarvaiṣamyādyāpattirityāśaṅkayoktam- upalabhyate ceti //
upalabhyate hī(ce)śvarasyedṛśaṃ vaiṣamyaṃ nirghṛṇatvaṃ ca pramāṇaiḥ /
ato nedamaniṣyamiti /

tadidamayuktam /
vaiṣamyanairghṛṇye hi vastuto dūṣaṇe na vā /
ādye kathamantato 'pyaṅgīkriyete /
dvitīye prathamamevāṅgīkārye /
kiṃ sāpekṣatāpakṣaṃ kakṣīkṛtya tatra dūṣaṇaparihārakleśena /
tathāca bakabandha(ka)rītirityato 'bhiprāyamāha- vaiṣamyamiti /


*6,360*

vaiṣamyanairghṛṇye na sāpekṣatvāt tathā hi darśayati | BBs_2,1.34 |

vaiṣamyaṃ caiva nairghṛṇyaṃ vedāprāmāṇyakāraṇam /
nāṅgīkāryamato 'nyattu na vaiṣamyādināmakam // MAnuv_2,1.110 //


dvividhaṃ khalvidaṃ vaiṣamyaṃ nirghṛṇatvaṃ ca /
ekaṃ (dha)karmādyanapekṣatāprayuktam /
aparaṃ tu sāpekṣatve 'pi karmādisattāderapīśvarādhīnatvaprayuktam /
tatrādyaṃ vedāprāmāṇyakāraṇatvena dūṣaṇatvāt neśvarasyāṅgīkartumucitam /
vedo hi dharmaṃ sukhasādhanamadharmaṃ ca duḥkhasādhanamāha /
tatra yadīśvaro dharmādharmānapekṣya viṣamo nirghṛṇaśca syāt tadā vedoditaṃ dharmādharmayoḥ sukhaduḥkhasādhanatvamasatsyāt /
tathāca tasya kathaṃ prāmāṇyaṃ syāt /
ataḥ sūtrakāreṇa karmādisāpekṣatāpakṣamurarīkṛtya tatparihṛtam /
ato 'nyattu dvitīyaṃ vaiṣamyaṃ nairghṛṇyaṃ ca na vaiṣamyādināmakaṃ dūṣaṇarūpaṃ na bhavatīti yāvat /
tathāhi vaiṣamyādikaṃ tāvanna svarūpeṇa doṣaḥ kintu doṣahetutayā /
na cedaṃ vedāprāmāṇyakāraṇam /
karmādisāpekṣatvāṅgīkārāt /
nāpi jīvānāmiveśvarasya pratyavāyahetuḥ /
tadabhāvāt /
ato 'dūṣaṇatvādaṅgīkṛtaṃ sūtrakṛteti na kaściddoṣaḥ /
tathāca bhāgyam /
"naca punarvaiṣamyādyāpātena doṣaḥ'; iti /

// iti śrīmannyāyasudhāyāṃ vaiṣamyanairghṛṇyādhikaraṇam //


___________________________________________________________________________



[======= JNys_2,1.XI: sarvadharmopapattyadhikaraṇam =======]


*6,366*


// atha śrīmannyāyasudhāyāṃ sarvadharmopapattyadhikaraṇam //


// oṃ sarvadharmopapatteśca oṃ //
sarve cetanā apūrṇaguṇā doṣiṇaśca dṛṣṭāstaddṛṣṭāntena cetanatvādīśvarasyāpi samāsavyāsābhyāmaparipūṇarguṇatvaṃ doṣitvaṃ ca syāditi pūrvapakṣo 'trādhikaraṇe nirasyate /
tadidamaspaṣṭaṃ bhāṣye /
caśabdasamuccitāyāḥ śruterevodāhṛtatvāt /
yukteravyutpādanāt /
tataḥ spaṣṭaṃ yadadhīnā iti //

sarvadharmopapatteś ca | BBs_2,1.37 |

yadadhīnā guṇāścaiva doṣā api hi sarvaśaḥ /
guṇāstasya kathaṃ na syuḥ syurdeṣāśca kathaṃ punaḥ // MAnuv_2,1.111 //


cāpiśabdāvanyonyasamuccaye /
evaśabdasya yadadhīnā evetyanvayaḥ /
hiśabdaḥ sarvasya bhagavadadhīnatāyāṃ śrutyādiprasiddhiṃ dyotayati /
kathamityākṣepe /
dvedhā hi vastu na prāpyate /
tatra svātantryābhāvādvā prepsābhāvādvā /
dvedhā ca na hīyate /
svātantryābhāvādvā jihāsābhāvādvā /
asti tāvadīśvarasya sarvatra svātantryam /
asti ca mayā sarvadā'nandādiguṇavatā duḥkhādidoṣavarjitena bhāvyamitīcchā, prekṣāvattvāt /
ataḥ kathaṃ tasyānandādiguṇapūrṇatvaṃ duḥkhādisarvadoṣadūratvaṃ na bhavati /

atraite prayogāḥ /
īśvaraḥ sakalaguṇapūrṇaḥ sarvadoṣadūraśca, svatantratvāt /
vyatirekeṇa yajñadattavat /
īśvaro vipratipannaguṇavān, tatra prepsāvattve sati svatantratvāt /
yo yatra prepsāvatve sati svatantraḥ sa tadvān yathā sampratipannaḥ /
īśvaro na vimatadoṣavān, tajjihāsutve sati svatantratvāt /
yo yatra jihāsāvattve sati svatantraḥ sa tadabhāvavān /
yathā sammata iti /


*6,368*

sarvadharmāpapattestad vākyairapi hi tādṛśaiḥ /
nirdoṣāśeṣaguṇako nirṇīto bhagavān hariḥ // MAnuv_2,1.112 //


|| iti śrīmadānandatīrthabhagavatpādācāryaviracite śrībrahmasūtrānuvyākhyāne dvitīyādhyāyasya prathamaḥ pādaḥ ||


tat evamuktaprakāreṇa sarveṣāṃ dharmāṇāṃ guṇānāṃ doṣābhāvānāṃ ca sambandhinyāstatpratipādikayā upapatteḥ tādṛśaiḥ sarvaguṇapūrtyāderupapādakaiḥ /
hiśabdasteṣāṃ"guṇāḥ śrutāḥ'; ityādīnāṃ prasiddhānāṃ sūcayati /

tadanena svapakṣe pramāṇamabhidadhataiva parakīyayuktīnāṃ kālātyayāpadiṣṭatvaṃ svātantryābhāvopādhiduṣṭatvaṃ coktaṃ bhavatīti /

// iti śrīmatpūrṇapramatibhagavatpādasukṛteranuvyākhyānasya praguṇajayatīrthākhyayatinā /
kṛtāyāṃ ṭīkāyāṃ viṣamapadavākyātharvivṛtau dvitīyādhyāyasya prathamacaraṇaḥ paryavasitaḥ //


// iti śrīmannyāyasudhāyāṃ dvitīyādhyāyasya prathamacaraṇaḥ samāptaḥ //



*************************************************************************************************



Adhyaya 2, Pada 2





[======= JNys_2,2.I: racanānupapattyadhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ racanānupapattyadhikaraṇam //


*7,1*

sakalajagajjanmādikāraṇe sakalaguṇaparipūrṇe samastāvadyagandhavidhure pare brahmaṇi viṣṇau samastaśrutisamanvayo yaḥ prathamādhyāye 'bhihitaḥ, tasya sāṅkhayādisamayavirodhenānyathātvaśa(ṅkāyāṃ tannirākaraṇārthamayaṃ)ṅkāṃ nivārayituṃ dvitīyapāda ārabhyate /

*7,4*

nanvanārambhaṇīya evāyaṃ pādaḥ /
tathāhi sāṅkhayādimatāni kiṃ smṛtitvenoktārthamanyathamantīti śaṅkayate, kiṃvā yuktyupetatayā, athavā śrutyupetatayā, yadvā pratyakṣopetatayā /
nādyaḥ, pratismṛtiparāhatatvenāptiniścāyakābhāvena ca teṣāmapasmṛtitvasya prathamapāde samarthitatvāt /
ata eva na caturthaḥ /
na dvitīyaḥ /
uktārthaviruddhānāṃ sakalayuktīnāmābhāsatvasya tatraiva vyutpāditatvāt /
prabalayuktivirodho 'tra nirasyata iti cenna /
prābalyaṃ hi yuktīnāṃ śrutyādipramāṇamūlatvena, tatsaṃvāditvena (vā), bahutvena vā syāt /
sarvathāpi nādhikāśaṅkāvakāśaḥ /
śrutyādisaṃvādinīnāṃ tanmūlānāṃ bahvīnāṃ ca yuktīnāṃ tatraiva nirākṛtatvāt /
kāścideva tatra nirastā na samastā iti cenna /
sūtrāṇāmupalakṣaṇārthatvāt /
anyathā yuktyābhāsānāmanantatvena aparyavasānaṃ syāt /
pādabhedaścaivaṃ sati na syāt /
na tṛtīyaḥ, samastaśrutīnāṃ brahmaṇi samanvayasyoktatvāt /

atra kaścidāha /
svapakṣasādanaparapakṣapratikṣepābhyāmeva nirṇayo bhavati /
tatra prathamādhyāye svapakṣe pramāṇamuktam /
tasya yuktivirodho dvitīyasya ādyapādena nirastaḥ /
evaṃ svapakṣasthāpane jāte parapakṣapratikṣepātharmayaṃ vāda ārabhyata iti /
tadayuktam /
parapakṣapratikṣepo hi tadīyasādhananirāsādanyo nāsti /
sādhanāni ca smṛtyādīnyeva /
nirastāni ca samastāni tāni prathamapāda iti kimasya kṛtyam /
kiñcaivaṃ sati virodhaparihāro 'dhyāyārtho na syāditi /

apara āha /
uktārthe smṛtinyāyavirodho nāstīti sthāpite 'pyasti brahmaṇi samanvayābhāvaśaṅkā /
katham /
yadyapyanumānaṃ brahmaṇo jagatkāraṇatvamapabādhituṃ nālam, tathāpi kāraṇāntaraṃ jagato 'vagamayitumalam /
tataśca vastuvikalpānupapatteranyataraparigrahe hetvabhāvāt brahmaiva jagatkāraṇamiti na niścetuṃ śakyate, pratyuta sarvajñapraṇetṛkatvenānumānasyopabṛṃhitatvāt pradhānādyeva jagatkāraṇaṃ na brahmeti buddhiḥ syāt /
ato na kevalaṃ brahmaṇo jagatkāraṇatvamapabādhitumanumānaṃ notsahate /
kintu kāraṇāntaramapyavagamayituṃ nālamiti pradarśanārthaṃ dvitīyaḥ pāda ārabhyata iti /
etadapyuktam /
tathāhi /
kimanenoktaṃ syāt /
yadi, prāk svābhimatārthe yuktivirodhaparihāreṇa svapakṣasthapānā vihitā, idānīṃ parapakṣapratikṣepo vidhīyata iti /
tadoktamevottaram /
atha yuktivirodhaparihāra eva pādadvayārthaḥ, kintu svapakṣavirodhiyuktinirākaraṇaṃ prathame, dvitīye tu parapakṣasādhakayuktinirākaraṇamiti, tanna /
nyāyasāmyena tāsāmapi śakyanirākaraṇatvāt (sārvajñaṃ) sarvajñatvaṃ ca praṇetṝṇāṃ prāgeva nirastam /


*7,5*

ato nāyaṃ pāda ārambhaṇīya ityata āha- smṛtīti //

smṛtiyuktiśrutiguṇayuktayo bahuyuktayaḥ /
evaṃ caturvidhā naiva viruddhayante 'nvayaṃ prati // MAnuv_2,2.1 //
iti prathamapādena nirṇīte 'pyabhiyogataḥ /
darśanānāṃ pravṛttatvānmanda āśaṅkate punaḥ // MAnuv_2,2.2 //


NYĀYASUDHĀ:
śrutayo gurā upasarjanā(ni) yāsāṃ tāstathoktāḥ /
caturvidhā virodhipratītayaḥ /
anvayaṃ prati na viruddhayante iti śrutisamanvayasiddhamarthaṃ nānyathayituṃ śaknuvantītyarthaḥ /
abhiyoga āgrahaḥ /
dṛśyate prameyamebhiriti darśanāni sāṅkhayādiśāstrāṇi /
etaduktaṃ bhavati /
yadyapi paramatasādhakānāmasmanmatabādhakānāṃ ca smṛtyādīnāmābhāsatvavyutpādanena spaparapakṣasādhanopālambhau kṛtāveveti paramārthaḥ /
tathāpyukte 'rthe punaḥ puruṣasya āśaṅkā bhavatyeva, kimetadevamanyathā veti /
kasmāt /
abhiyogato (darśanānāṃ) matānāṃ pravṛttatvāt tadupalambhāditi /


*7,10*

nanu ca śrutayastāvadapauruṣeyatayānāśaṅkitadoṣāḥ bahula(prabala)yuktibhiścānusaṃhitārthā nirastasamastapratipakṣāśca /
tatkathaṃ tatsamanvayasiddhe 'rthe 'bhiyogapravṛttadarśanopalambhamātreṇānyathātvaśaṅkā syāt /
atiprasaṅgāt /
nanvata evoktaṃ manda iti /
maivam /
prāptimanālocya śaṅkamānasyāvicikitsitaśaṅkasya śāstre 'nadhikārādityato 'bhiyogato darśanānāṃ pravṛttatvādityuktaśaṅkākāraṇaṃ vivṛṇoti- anādīti //

anādikālato vṛttāḥ samayā hi pravāhataḥ /
nacocchedo 'sti kasyāpi samayasyet ... // MAnuv_2,2.3 //



*7,11*

NYĀYASUDHĀ:
kapilakaṇādādīnāṃ praṇetṝṇāṃ smaraṇātkathamanāditvamityata uktam- pravāhata iti //
kapilādayo hi pūrvaiḥ praṇītānyeva śāstrāṇi kālabalādutsannāni sva(tapaḥ)prabhāvādināvagamya prabandhāntararacanayā pravartayanti /
evaṃ pūrve 'pi pūrvatarairityevaṃ pravāhato 'nāditvādadoṣaḥ /
tathaiva ca smaraṇānīti /
iti hetorāśaṅkita iti pūrveṇa sambandhaḥ /

idamuktaṃ bhavati /
karaṇadoṣabādhakapratyayavaśādeva hyaprāmāṇyaṃ kalpanīyam /
anyathā atiprasaṅgāt /
tatra yatā śrutīnāmanāditvātkaraṇadoṣābhāvaḥ, tathā samayānāmapi /
svarūpānāditvaṃ pravāhānāditvamiti tu vaiṣamyamātram /

puruṣadoṣasañcārābhāvasyobhayatrāpi sāmyāt /
yathā cānucchedenānuvṛtteḥ śrutīnāṃ bādhakābhāvaḥ, evaṃ samayānāmapi /
yadi karaṇadoṣabādakapratyayopetāḥ syuḥ tadonmattavākyavadidaṃprathamāḥ samucchedavantaśca syuḥ /
nacaivam /
ataḥ kathamaprāmāṇyamaśnuvate /
yathā ca śrutayo balavadyuktyanusaṃhitārthā evaṃ samayā api /
naca tāsāmābhāsatvamuktamiti vācyam /
sarveṣāṃ tadanuvartināmasmābhiranavagatatvena tatparihārasambhāvanāt /
evamevāpratipakṣatvaṃ śrutīnāmiva samayānāṃ sambhāvitam /
kathamanyathā sūtrakṛdekadhurīṇāḥ śauddhodaniprabhṛtayo 'bhiyogatastānpravartayeyuḥ, kathaṃ ca prekṣāvanto 'neke 'bhiyogenaivopādadīran /
tadevaṃ śrutitulya(samāna)yogakṣematāṃ samayānāṃ manyamānasya syādevoktārthe sandeha iti /


*7,17*

nanvevaṃ sati parasparaviruddhānāmanekeṣāṃ prāmāṇyaṃ tāvanna sambhavati, vastuvikalpāpatteḥ /
tathācāvaśyāśrayaṇīye kasyacideva prāmāṇye anādikālato 'nuvṛttatvādeḥ anyeṣvanyathāsiddhau sarvathā kalpanīyāyām"itareṣāṃ cānupalabdheḥ'; ityuktadiśā sāṅkhayādisamayānām aprāmāṇyaṃ kalpayituṃ śakyata eva, tatkathaṃ śrutisamanvayasiddhe 'rthe punaḥ śaṅketi /
ucyate /
yo hi itareṣāṃ cānupalabdheḥ'; iti saṅkṣepeṇoditaṃ nyāyaṃ para(pari)kalpiteṣu prameyaviśeṣeṣūtprekṣituṃ kṣamate, taṃ pratyevametat /
yastvevaṃ na kṣamaḥ sa yāvadayaṃ saṅkṣepo na prapañcyate tāvadanyaparityāgenaikagrahaṇasyānīśānaḥ śaṅketaiva /
nacaivaṃ śāstre nādhikriyeta /
saṅgrahaprapañcocchedaprasaṅgāt /
tadidamuktaṃ manda āśaṅkata iti /
kimato yadyevamityata āha- ata iti //

ato vibhuḥ // MAnuv_2,2.3d //
bhrāntimūlatvameteṣāṃ pṛthag darśayati sphuṭam // MAnuv_2,2.4ab //


NYĀYASUDHĀ:
bhrāntipadaṃ vipralambhasyāpyupalakṣaṇam /
pṛthak vistareṇa /
sphuṭam subodham /
tattatsamayoktārthānāmaprāmāṇikatvaṃ pramāṇaviruddhatvaṃ (ca) prāk saṅkṣepeṇāsphuṭaṃ coktaṃ, atra vistareṇa sphuṭaṃ darśayaṃsteṣāṃ bhrāntyādimūlatvaṃ jñāpayatītyarthaḥ /
etena pūrvapādenāsya pādasya prapañcyaprapañcakabhāvalakṣaṇā saṅgatiḥ, prapañcane prayojanaṃ coktaṃ bhavati /
tadidamuktamitareṣāmityādi bhāṣyeṇa /


*7,19*

nanvetadaśakyaṃ taiḥ svaprameyāṇāṃ dṛḍhatarkāgamasādhitatvāt parakīyatarkādenirastatvādityata āha- tarkairiti //

tarkairdṛḍhatamaireva vākyaiścāgamavādinām // MAnuv_2,2.4cd //


*7,19f.*

NYĀYASUDHĀ:
tarkaśabdaḥ sopaska(skā)rānumānārthaḥ /
dṛḍhatamaiḥ parakīyatarkabādhakaiḥ tadabādhyaiḥ (ca) vākyaiśca dṛḍhatarai(mai)riti sambaddhayate /
pūrveṇa sambandhaḥ (anvayaḥ) /
vedādivākyānāṃ prāmāṇyamanabhyupagacchantaṃ prati kathaṃ tadupanyāsa ityata uktam- āgamavādināmiti //
āgamasya vedādeḥ prāmāṇyamabhyupagacchatāṃ puṃsāṃ samayānāmiti sambandhaḥ /
yadvā svāgamaprāmāṇyavādināmityarthaḥ /
tataśca svāgamaprāmāṇyābhyupagamanyāyena vedāderapi prāmāṇyaṃ tairaṅgīkāryamiti(rayitvetir (yeti) bhāvaḥ /
athavā'gamasya vedādeḥ prāmāṇyavādināṃ śiṣyāṇāṃ vyapekṣayeti śeṣaḥ /
tathāca bauddhādhikaraṇāntena na virodhaḥ /
yadyapyetadanupadameva pradarśayiṣyate, tathāpi śrotṛmanaḥsamādhānārthamuktamiti /


*7,21*

nanu cānādyanantakāle 'nucchedena pravartamānānāṃ samayānāṃ na bhrāntyādimūlatvamucitam /
nahi tathāvidhasyonmattavākyāderanādyantakāle 'nuvṛttirasti /
tadayaṃ prayogaḥ /
sāṅkhayādisamayāḥ pramāṇabhūtā, na bhrāntyādi(nti)mūlā vā, sarvadānuvartamānatvāt, mahājanaparigṛhītatvāt(vā), vedavaditi /
tathāca vakṣyamāṇasya tarkāderbādhitaviṣayatvamiti /
maivam /
kimatra sarveṣāmapi samayānāṃ prāmāṇyādikaṃ sādhyamutaikasya /
nādyaḥ /
parasparaviruddhānāṃ prāmāṇyādisādhane vastuvikalpāpattyā bādhitaviṣayatvāt /
parasparapratikṣeparūpatvena satpratipakṣatvācca /
na dvitīyaḥ /
pakṣīkṛtādanyasya prāmāṇyādyabhyupagame praguktadoṣānuṣaṅgāt /
anabhyupagame tatraiva vyabhicārāt /
vedaprāmāṇyādyabhyupagame pratijñātārthānupapattiḥ /
anabhyupagame ca dṛṣṭāntadoṣaḥ /
bhavedevam /

bhrāntyādimūlatve samāne satyunmattavākye 'vidyamānāṃ anādyanantakālānuvṛttireteṣāmeva tarhi kinnimitteti suhṛdbhāvena pṛcchantaṃ pratyāha- daurlabhyāditi //


*7,22*

daurlabhyācchuddhabuddhīnāṃ bāhulyādalpavedinām /
tāmasatvācca lokasya mithyājñānaprasaktitaḥ // MAnuv_2,2.5a-d //


NYĀYASUDHĀ:
samayapravartakānāṃ puṃsāṃ durāgrahagṛhītatvādvartante samayāḥ sadā /
naikyamunmattavākye vidyate /
nanvāgrahe 'pi kiṃ kāraṇamityata uktam- vidveṣāditi //

vidveṣāt parame tattve tattvavediṣu cāniśam // MAnuv_2,2.5ef //

NYĀYASUDHĀ:
tarhi dveṣotpattyanantaraṃ pravartatām /
kathaṃ sadā ityata uktam- aniśamiti //
nanu puruṣārthakāmāḥ kathaṃ (vi)dveṣanimittādāgrahādanyāyaṃ pravartayantītyata uktam- anādīti //

anādivāsanāyogādasurāṇāṃ bahutvataḥ /
durāgrahagṛhītatvād vartante samayāḥ sadā // MAnuv_2,2.6 //


NYĀYASUDHĀ:
vāsanāvaśāttebhyastadeva rocayata iti bhāvaḥ /
nanvanādivāsanāpi balavatprayatnena kuto na nivartata ityata uktam- asurāṇāmiti //
viparītaprayatnādiprerakāṇāṃ buddhayādyabhimānināmiti śeṣaḥ /


*7,24*

nanu sādhūnāṃ viduṣāṃ nivāraṇātkuto na nivartanta ityata uktam- daurlabhyāditi //
alpavedināṃ bhramādhiṣṭhānasvarūpamātravidāṃ samayapravartakānām /
tarhi rājādirloko nivārayiṣyati ityata uktam- tāmasatvāditi //
tata eva kupaṇḍitanimittamithyājñānaprasaktiśca /
na caitāni kāraṇāni svarūpato 'pyanādau vede sambhavantīti /

yadyapyetatpādānte vaktavyam, tathāpyatra prasaṅgā(dā)gataṃ buddhisamādhānāyoktamiti /


*7,25*

yadyevaṃ tarhyeteṣāṃ sudṛḍhanirūḍhānāṃ samayānāṃ sarvathotsādanasyāśakyatvādvayartheyaṃ nirākṛtirityata āha- tathāpīti //
tathāpi śuddhabuddhīnāmīśānugrahayoginām /
yuyuktayastamo hanyurāgamānugatāḥ sadā // MAnuv_2,2.7 //
iti vidyāpatiḥ samyak samayānāṃ nirākṛtim /
cakāra ... // MAnuv_2,2.8a-c //


NYĀYASUDHĀ:
yadyapi kusumayā na sarvathā samucchedyāḥ tathāpi /
tamaḥ ajñānam /
suyuktitvasya vivaraṇaṃ sadā'gamānugatā iti /
pramāṇagṛhītavyāptyādiyuktāḥ tatsaṃvādayuktāśca /
iti ityevamartham /
etaduktaṃ bhavati /
na sāṅkhayādisamayasamucchedārtho 'yaṃ prayatnaḥ, yenoktadoṣaḥ syāt /
kinnāma keṣāñcitpuṃsāṃ taistaiḥ samayairāhitā(na)jñānasaṃśayaviparyayān āgamasahitābhiryuktibhiḥ tattvajñānamutpādya apanetumiti /



*7,25f.*

nanvetadapyayuktam /
atinirūḍhanibiḍavāsanānubaddhamanādyajñānam idānīmevotpannena tattvajñānenāpanīyata iti /
kintu tattvajñānaṃ paribhūya svavāsanāvaśātpunarudbhavati /
pravartayati ca svocitaṃ kāryamityata uktam- śuddhabuddhīnāmiti //
yathārthajñānasvabhāvānāṃ mokṣayogyānām /
ayaṃ bhāvaḥ /
vakṣyate hi kecana cetanā mokṣayogyāḥ kecana neti /
tatra nāyogyānāmajñānamapanetumaya--rambhaḥ, kintu yogyānāmeva /
teca viśuddhavijñānasvabhāvāḥ /
tathāca pramāṇairidānīmevotpannamapīdaṃ manovṛttitvaṃ tattvajñānamantaraṅgabhūtena

viśuddhasvarūpajñānenopodbalitaṃ sat bahiraṅgamanādyapi savāsanamajñānaṃ samūlaghātaṃ hanti /
svabhāvasya sarvato 'pi balavattvāt /
nacaivaṃ pramāṇavaiyarthyam /
svabhāvasya bāhyaprayatnasacivasyaiva kāryakāritvāt /
yathoktam"vinā yatnaṃ na haṭho nāpi karma'; iti /

kiñca sarvato 'pi balīyānīśvarānugraha iti tāvatsuprasiddham /
asti cāsau mokṣayogyeṣu (jīveṣu) anādita iti vakṣyate /
tathāca tatsacivamidaṃ vṛttijñānamajñānamatinirūḍhanibiḍavāsanānubaddhamanādyapi samūlakāṣaṃ kaṣatyeva /
ato na vyartheyaṃ samayānāṃ nirākriyeti bhāvenoktam- īśānugrahayogināmiti //
nacaivaṃ tata evāvidyānivṛttirbhaviṣyati kiṃ tattvajñāneneti vācyam /
īśvarānugrahasya puruṣaprayatnānusāreṇaiva phalajananasvābhāvyāt /
tathācoktam"phalaprado vāsudevaḥ akhilasya'; iti /
akhilasya yogyatākamarprayatnasākalyasya na punarekaikasyetyarthaḥ /


*7,30*

yadyevaṃ sādhūnāṃ kusumayāhitamajñānamapanetuṃ bhagavānsamayānāṃ nirākṛtiṃ cakāra, tadeyaṃ brahmādibhiranādartavyā syāt /
teṣu kusumayairajñānasyānāhitatvena prayojanābhāvāt /
tathāca"evaṃvidhāni sūtrāṇi kṛtvā'; ityāgamavirodha ityata āha- nijeti //

... nijabhaktānāṃ buddhiśāṇatvasiddhaye // MAnuv_2,2.8cd //

NYĀYASUDHĀ:
kusumayairanāhitājñānānāṃ brahmādīnāṃ buddhiṃ yuktīnāṃ śāṇatvasiddhaye yuktiśāṇena jñānāseḥ atinaiśityasiddhayarthamiti yāvat /
pūrveṇaiva sambandhaḥ /
kusumayā(hitā)jñānanirasanaprayojanābhāve 'pi jñānavaiśadyaprayojanasya vidyamānatvāttairidamādaraṇīyamiti bhāvaḥ /

// oṃ racanānupapatteśca nānumānam oṃ //
tadevaṃ samarthitaḥ pādārambhaḥ /
tatrādyādhikaraṇe nirīśvarasāṅkhayānāṃ nirākriyate /
naca tatsvarūpājñāne dūṣaṇaṃ subodhaṃ bhavati ityataḥ tanmatasthitiṃ tāvaddarśayati- cetaneti //


racanānupapatteś ca nānumānaṃ | BBs_2,2.1 |

cetanācetanaṃ tattvadvayameva nirīśvarāḥ /
āhus ... // MAnuv_2,2.9a-c //



*7,32*

NYĀYASUDHĀ:
cetanamacetanaṃ ceti dvandvaikavadbhāvaḥ /
āhuḥ saṅkhayā iti śeṣaḥ /
nanu ca vidhāntarāsambhavātprāmāṇikaistattvadvayameva vaktavyam, tatkiṃ teṣāṃ vaiṣamyamucyata ityata uktam- nirīśvara iti //
īśvaramanabhyupagamya jīvajaḍātmakaṃ tattvadvayamevāhurityarthaḥ /


*7,32f.*

nanu sāṅkhayā manyante /
saṅkṣepatastattvasya catasro vidhāḥ /
kaścidarthaḥ prakṛtireva /
kaścidartho vikṛtireva /
kaścitprakṛtivikṛtiḥ /
kaścitanubhayaḥ /
tatra sattvarajastamasāṃ sāmyāvasthā pradhānaṃ prakṛtireva /
sā hi viśvasya kāryasya mūlam /
na tvasyā mūlāntaramasti /
mahadahaṅkāratanmātrāḥ sapta prakṛtivikṛtayaḥ /
prakṛtayo vikṛtayaśceti /
tathāhi /
mahattattvamahaṅkārasya prakṛtiḥ vikṛtiśca mūlaprakṛteḥ /
evamahaṅkāratattvaṃ tanmātrāṇāmindriyāṇāṃ ca prakṛtiḥ vikṛtiśca mahataḥ /
evaṃ pañca tanmātrāṇi (tattvāni) bhūtānāmākāśādīnāṃ prakṛtayo, vikṛtayaśca ahaṅkārasyeti /
pañca bhūtānyekādaśendriyāṇīti ṣoḍaśako gaṇo vikṛtireva /
yadyapi pṛthivyādīnāmapi goghaṭavṛkṣādayo vikārāḥ, evaṃ tadvikārabhedāḥ payobījādayaḥ, teṣāṃ dadhyaṅkurādayaḥ /
tathāpi gavādayo bījādayo vā na pṛthivyādibhyastattvāntaram /
sthūlatendriyagrāhyatāsāmyāt /
tattvopādānatvaṃ ca prakṛtitvamiha vivakṣitamiti /
puruṣastvanubhayo na prakṛtirnāpi vikṛtiḥ /
tadevaṃ vistarataḥ pañcaviṃśati tattvāni /
yathoktam /
"mūlaprakṛtivikṛtirmahadādyāḥ prakṛtivikṛtayaḥ sapta /
ṣoḍaśakastu vikāro na pṛkṛtirna vikṛtiḥ puruṣaḥ'; iti /
tatkathamucyate tattvadvayamevāhuriti, āha- taditi //

... tat pañcapañcatvavibhāgasthamacetanam /
cetanaṃ ... // MAnuv_2,2.9c-e //


NYĀYASUDHĀ:
pañca ca te pañcataśca (pañcapañcataḥ) teṣāṃ bhāvaḥ pañcapañcatvam /
sa cāsau vibhāgaśca /
tenopalakṣitaṃ tiṣṭhatīti pañcapañcatvavibhāgastham /
tat cetanamacetanaṃ ca tattvadvayameva, saṅkṣepataḥ caturvidham, vistarataḥ pañcaviṃśatiprabhedamāhurityato na virodhaḥ /

nanu cetanamacetanaṃ cāsaṅkhayātaṃ pratyakṣādipramāṇairupalabhamānāḥ kathamevamāhurityata āha- taditi //

... tadasaṅkhayātaṃ ... // MAnuv_2,2.9e //

NYĀYASUDHĀ:
tadityubhayaparāmarśaḥ /
upādhikroḍīkāreṇa pañcaviṃśatiprabhedaṃ vadanto 'pyavāntarabhedena tattvadvayamasaṅkhayātamāhurityarthaḥ /


*7,37*

cetanānāmacetanānāṃ ca pratyekamasaṅkhayātatvasāmye 'pi nobhayorbhinnatvena sāmyam /
kiṃ tarhītyata āha- bhinnamiti //

... bhinnamanyad layaṃ bhavet // MAnuv_2,2.9f //


*7,38*

NYĀYASUDHĀ:
cetanamiti śeṣaḥ /
cetanaṃ parasparato bhinnamāhuḥ /
yathoktam /
"jananamaraṇakāraṇānāṃ pratiniyamādayugapatpravṛtteśca /
puruṣabahutvaṃ siddhaṃ traiguṇyaviparyayācca'; iti /
anyat cetanāt, acetanaṃ bhidojkhitamāhuḥ /


*7,39*

nanvīśvarānabhyupagame kasyāpi pravṛttyanupapatteḥ, sargādyasambhavādīśvarākhyaṃ tṛtīyaṃ tattvamaṅgīkaraṇīyam /
tatkathaṃ nāṅgīkurvantītyata āha- acetanasyeti //


*7,40*

acetanasya kartṛtvaṃ svātantryeṇa nigadyate // MAnuv_2,2.10ab //

NYĀYASUDHĀ:
nigadyate sāṅkhayairiti śeṣaḥ /
tathāhi /
cetanaḥ saṅghātaparārthatvādihesiddhaḥ /
acetanaṃ ca vyaktaṃ pratyakṣādisiddham avyaktaṃ ca kāraṇakāryavibhāgādihetusiddham /
nacaivamananyathāsiddhamīśvare pramāṇamasti /
acetanasyaiva pradhānasya kartṛtvena sargādyupapatteradṛṣṭeśvarakalpanānupapatteriti manyanta iti /

nanvacetanaṃ cetanānadhiṣṭhitaṃ kvapi na pravṛttimadupalabdham /
tataḥ pradhānasyādhiṣṭhātreśvareṇa bhāvyamityata uktam- svātantryeṇeti //
cetanādhiṣṭhānena vinetyarthaḥ /
ta(ya)thoktam /
"vatsavivṛddhinimittaṃ kṣīrasya yathā pravṛttirajñasya /
puruṣasya vimokṣanimittaṃ yathā pravṛttiḥ pradhānasya'; iti /


*7,44*

anyadbhidojkhitamityuktam /
tadasat /
acetanānāmapi cetanavatparasparato bhedasya pratyakṣādisiddhatvādityata āha- paraspareti //

parasparavibhedaśca kāryāṇāmālayaṃ bhavet // MAnuv_2,2.10cd //

NYĀYASUDHĀ:
ālayaṃ pralayaparyantam /
kāryāṇāṃ parasparavibhedaśca bhavediti nigadyate taiḥ /


*7,45*

etaduktaṃ bhavati /
kāryaṃ tāvatkāraṇavyāpārātprāgapi sat /
asadakaraṇāt /
asaccet kāraṇavyāpārātpūrvaṃ nāsya sattvaṃ kartuṃ śakyam /
nahi nīlaṃ śilpisahasreṇāpi pītaṃ śakyaṃ kartum /
kiñca kāryeṇa sambaddhaṃ kāraṇaṃ kāryasya janakam, asambaddhaṃ vā /
ādye tvasatā sambandhānupapatteḥ sattvamaṅgīkāryam /
na dvitīyaḥ /
asambaddhatvāviśeṣeṇa sarvasmātsarvasambhavāpatteḥ /
asambaddhatve 'pi kāraṇaṃ tadevaṃ karoti yatra śaktamato nātiprasaṅga iti cet /
sā śaktiḥ śakyaviṣayā vā syātsavartra vā /
sarvatra cetsaivāvyavasthā /
ādye tvasati śakye kathaṃ tadviṣayā syāditi sadeva kāryam /
naca kāraṇādanyatkāryaṃ sadupalabhyata iti kāryakāraṇayorabhedo 'ṅgīkaraṇīyaḥ /
kiñca na paṭastantubhyo bhidyate tantudharmatvāt, yadyato bhidyate tattasya dharmo na bhavati, yathā gauraśvasya /
upādānopādeyabhāvācca /
yayorarthāntaratvaṃ na tayorupādānopādeyabhāvo, yathā ghaṭapaṭayoḥ /
saṃyogāprāptyabhāvācca /
arthāntaratve hi saṃyogo dṛṣṭo yathā kuṇḍabadarayoḥ /
aprāptirvā yathā himavadvindhyayoḥ /
naceha saṃyogāprāptī /
tasmānnārthāntatvam /
gurutvāntarakāryasyāvanatibhedasyāgrahaṇācca /

evañca kāryāṇāṃ parasparaṃ bhede 'pi svasvakāraṇairabhedātkrameṇa mahāpralaye mūlakāraṇabhāvaṃ gatānāmabheda eva, ityenenābhiprāyeṇānyadbhidojkhitamityuktamiti /
taccoktam"asadakaraṇādupādānagrahaṇātsarvasambhavābhāvāt /
śaktasya śakyakaraṇātkāraṇābhāvācca satkāryam'; iti /


*7,48*

teṣvapi matabhedamāha- bhoktṛtāmiti //

bhoktṛṇāṃ cetanasyāhuḥ kecit tāmapi nāpare // MAnuv_2,2.11ab //

NYĀYASUDHĀ:
sarve 'pi sāṅkhayāḥ puruṣasya kartṛtvaṃ nānumanyante /
kriyāveśo hi kartṛtvam /
na cātmanaḥ parispandalakṣaṇā kriyopapadyate /
sarvagatatvāt /
nāpi prayatnalakṣaṇā /
tasyāḥ antaḥkaraṇavṛttitvāt /
naca vikriyālakṣaṇā /
nirvikāratvāt /
yathoktam /
"tasmācca viparyāsātsiddhaṃ sākṣitvamasya puruṣasya /
kaivalyaṃ mādhyasthyaṃ draṣṭṛtvamakartṛbhāvaśca'; iti /
tatra keciccetanasya bhoktṛtāmāhuḥ /
yathā bhoktṛbhāvāditi /
apare tāmapi nāhuḥ /
yathā"tasmānna badhyate na mucyate nāpi saṃsarati kaścit /
badhyate saṃsarati mucyate ca nānāśrayā prakṛtiḥ'; iti /


*7,51*

nanu kartṛtābhāve bhoktṛtvamapi katham /
tasyāpi kriyāveśātmakatvādityata āha- svarūpeti //

svarūpacaitanyabalāt svaprakāśācca bhogitām // MAnuv_2,2.11cd //

NYĀYASUDHĀ:
sukhaduḥkhādyanubhavitṛtvaṃ hi bhoktṛtvamāhurityata uktam- svaprakāśāditi //
sukhādyanubhavitṛtvasya svapratītisiddhatvādityarthaḥ /
yathā'ha /
bhoktṛtvayogyatā ca puruṣasya caitanyamiti /
nacaivaṃ kartṛtvamapyaṅgīkartumucitam /
upapattibādhitatvena kartṛtvapratīteradhyāsarūpatvāt /


*7,52*

nanvevaṃ tarhi pratītisiddhaṃ bhoktṛtvamapare kathaṃ nābhyupayantītyata āha- prakṛteśceti //

prakṛteśca svarūpasya vivekāgrahameva tu /
abhogavādino bhogamāhur ... // MAnuv_2,2.12a-c //


NYĀYASUDHĀ:
bhogaṃ bhogavyavahārakāraṇam /
ayaṃ teṣāmāśayaḥ /
bhoktṛtvaṃ hi na puruṣasya svabhāvaḥ /
apavargābhāvaprasaṅgāt /
āgantukaṃ tu nopapadyate /
apariṇāmitvāt /
ataḥ kartṛtvamiva bhoktṛtvamapyātmano na śakyamaṅgīkartum /
naca pratītivirodhaḥ /

pratīterabhāvāt /
vyavahāra eva hi kevalaṃ bhoktā'tmeti /
sa ca kartṛtvavyavahāravatprakṛtipuruṣavivekāgrahamātranibandhana iti /


*7,53*

syādetat /
yeṣāṃ puruṣo bhoktā teṣāṃ mokṣābhāvaḥ syāt /
prakṛtisaṃyoganimitto hi puruṣasya bhogastairaṅgīkriyate /
"puruṣasya darśanārthaṃ kaivalyārthaṃ tathā pradhānasya /
paṅgvandhavadubhayorapi saṃyogastatkṛtaḥ sargaḥ'; iti vacanāt /
naca prakṛtipuruṣasaṃyogaḥ kadāpyapaiti yena puruṣasya mokṣaḥ syādityata āha- bhedagrahāditi //

... bhedagrahāt tayoḥ // MAnuv_2,2.12d //
bhogināṃ muktiruddiṣṭā ... // MAnuv_2,2.13a //


NYĀYASUDHĀ:
tayoḥ prakṛtipuruṣayoḥ bhogināṃ puruṣasya bhogamabhyupagacchatāṃ mate /
ayamabhisandhisteṣām /
prakṛtisaṃyogo hi puruṣasya na kevalaṃ bhogārthaḥ /
kinnāmāpavargārthaśca /
tatra vivekāgrahasacivo bhogāya bhavati /
vivekagrahe cāpavargāya /
karotu nāma paunaḥpunyena śabdādyupabhogaṃ prakṛtiḥ /
anayā vivekakhyātirakṛteti /
kṛtavivekakhyātistu na śabdādyupabhojayati /
avivekakhyātinibandhano hi tadupabhogo, nibandhanābhāve na bhavitumarhati /
taccoktam"dṛṣṭā mayetyupekṣaka eko, dṛṣṭāhamityuparamatyantā /
sati saṃyogo 'pi tayoḥ prayojanaṃ nāsti sargasya iti /
tathā"raṅgasya darśayitvā nivartate nartakī yathā nṛttāt /
puruṣasya tathā'tmānaṃ prakāśya vinivartate prakṛtiḥ'; iti /
naca nivṛttāpi punaḥ pravatsyartīti śaṅkanīyam /

prayojanābhāvāt /
uktaṃ ca"prakṛteḥ sukumārataraṃ na kiñcidastīti me matirbhavati /
tasyāpi svenaiva nivṛtteḥ /


*7,56*

nanu ca yeṣāṃ mate puruṣasya bhoga eva nāsti teṣāṃ kathaṃ mokṣaḥ /
bandhābhāvāt /
tathāca yogānuśāsanavaiyarthyamityata āha- sa eveti //

... sa evābhogavādinām // MAnuv_2,2.13b //

NYĀYASUDHĀ:
sa bhedagraha eva muktiruddhiṣyā /
bhedāgrahanibandhano bhrama eva hi bandhaḥ /
sa ca bhedagrahe sati nivartate saiva muktiḥ /
na tvaparāstītyataḥ sa evetyuktam /
na punarbhedagraha eva muktiḥ /
tasyāpi nivartanīyatvāt /
nāpi vivekakhyātimityuktatvāditi /


*7,57*

evamupanyastaṃ matamadhunā nirasanīyam /
tatra sūtrakṛtā kramavivakṣitvā"racanānupapatteśca nānumānam'; iti prathamaṃ parapakṣopālambhaṃ vidhāyānantaraṃ"pravṛtteśca'; iti svapakṣasādhanaṃ vihitam /
bhāṣyakārastu sādhakapramāṇasya tattvapratipattyantaraṅgatvena tadupanyāsasya prāthamyaṃ parapakṣanirāsāya tasthaiyarhetorbahiraṅgatvena tadupanyāsyānantaryamiti kramamapi grāhayiṣyan vyatyayena vyācakṣāṇaḥ pravṛtteśceti sūtrasya pātanikārthamāha- īśasyeti //

īśasyāsaṅgrahādeva na yuktau tāvubhāvapi // MAnuv_2,2.13cd //

NYĀYASUDHĀ:
asaṅgrahāt anabhyupagamāt /
evetyasya doṣasyolbaṇatvaṃ sūcayati /
tāvubhāpi puruṣasya bhoktṛtvābhoktṛtvapakṣau /


*7,58*

nanvaprāmāṇikasyeśvarasyānabhyupagame kathamayuktatvamityataḥ pravṛtteśceti sūtrārthatayeśvare pramāṇamāha- cetaneti //

cetanecchānusāreṇa yadā dṛṣṭaḥ paṭodbhavaḥ /
etādṛśatvamanyasya vastutvāt kena vāryate // MAnuv_2,2.14 //



*7,59*

NYĀYASUDHĀ:
yadā yasmāt /
tasmāditi labhyate /
etādṛśatvaṃ paṭavaccetanecchānusāreṇodbhūtatvam /
anyasya mahadādeḥ, vastutvāt kāryatvādanumīyamānamiti śeṣaḥ /
kena ityākṣepe /

ayamatra prayogaḥ /
mahadādikaṃ cetanecchādhīnotpattikaṃ kāryatvātpaṭavaditi /
yadvā mahadādyudbhavaḥ cetanecchādhīna udbhavatvātpaṭodbhavavaditi prayoktavyam /
prayogadvayasūcanāya paṭodbhava dṛṣṭāntamuktvā vastutvāditi hetumāha /
evamuktāvupalakṣaṇatvaṃ hi ubhayatra jñāyeta /
upalakṣaṇaṃ caitat /
mahadādyupādānaṃ cetanamadhiṣṭhitaṃ upādānatvāttantuvadityādyapi draṣṭavyam /
nacānyaścetanastathā bhavitumarhatīti sarvātiśayī puruṣa īśvara eva siddhayatīti /
vyāsa-(21)


*7,61*

syādetat /
mahadādikaṃ na tāvatpratyakṣasiddham /
avyaktatvāt /
ataḥ sāṅkhayācāryavacanāt tatprayuktānumānādvā tadavagamo 'bhyupagantavyaḥ /
taiścānevaṃvidhameva taduktamanumitaṃ ceti bādhaḥ /
anyathā'śrayāsiddhiriti /
maivam /
vedatastadavagamāt /
uktaṃ hīdam"ajāmekām'; ityādiśrutiḥ pradhānamapi pratipādayatīti /

nanu puruṣaścetano nāntaḥkaraṇam /
icchā cāntaḥkaraṇadharmo na cetanasyāvikārasya /
ataḥ aprasiddhaviśeṣaṇatā bādho vā /
paṭāderapyevambhāvābhāvāddṛṣṭāntasya sādhyavaikalyaṃ ceti cenna /
ātmana evecchāvattvasya vakṣyamāṇatvāt /


*7,63*

tathāpyudbhavo nāmotpattirabhivyaktirvā /
nādyaḥ /
prathamaprayoge 'prasiddhaviśeṣaṇatvāt /
dṛṣṭāntasya sādhyavikalatvācca /
dvitīye cāśrayāsiddheḥ /
mayā satkāryavādasya abhyupagatatvāt /
dvitīye 'pyeta eva doṣāḥ /
tvayā vyaktyanabhyupagamāditi cenna /
asatkāryavādasya sādhitatvāt /
satkāryavāde pramāṇābhāvācca /
asadakaraṇādityādibhiśca kiṃ kāryasya prākkaraṇavyāpārātsattvamātraṃ sādhyam utātyantasattvam /
ādye siddhasādhanam /
sadasattvābhyupagamāt /
dvitīye tvasadakaraṇāditivatsadakaraṇādityapi samānam /
nahi sannātmā kenacitkriyate /


*7,66*

nanvasataḥ kathaṃ karmatvam /
sataḥ kathaṃ kāryatvamityapi samānam /
anena ghaṭo jāyata ityapi pratyuktam /
tarhi ghaṭaṃ karotītyādeḥ ko 'rthaḥ /
mṛttikāṃ ghaṭīkarotīti /
mṛttikā ghaṭībhavatīti /
asadutpattau kharaviṣāṇamapi kuto notpadyata iti cet /
tadātmakasyopādānasyābhāvāditi brūmaḥ /
anyathā sata utpattāvātmāpi kuto notpadyata iti samānam /


*7,69*

ya(da)dyapi kāryeṇa kāraṇaṃ sambaddhaṃ tadupajanayati utāsambaddhameveti pṛṣṭam /
tatra kāraṇaśabdenopādānaṃ vā vivakṣitaṃ nimittaṃ vā /
ādye janayatītyeva neṣyate /
kintu nimittakāraṇāni tat kāryatāṃ nayanti /
dvitīye tu kāryākāreṇāsambaddhaṃ kāraṇākāreṇa sambaddhamityuttaram /
ata eva nātiprasaṅgaḥ /
śaktiśca kāraṇānāṃ sadasadviṣayā /
anyathā nirviṣayatvāpātāt /
nahi sat kartuṃ śakyaṃ bhavati /


*7,70*

yacca tantupaṭayorabhedānumānaṃ tatrābhedamātrasādhane siddhasādha(nam)natvam /
bhedābhedāṅgīkārāt /

atyantābhedasādhane tantudharmatvaṃ tāvadasiddham /
nahi svayameva svasya dharmo bhavati /
nahi upacāro 'numānapravṛtteraṅgam /
atiprasaṅgāt /
kathaṃ ca tantudharmatvaṃ paṭasya /
tantuviśeṣaṇatvamiti cenna /
puruṣādiviśeṣaṇe daṇḍādau vyabhicārāt /
tadāśritatvamiti cenna /

abhedenāsiddhiprasaṅgāt /
kuṇḍabadarādau vyabhicārācca /
tadātmakatvamiti cenna /
sādhyaviśiṣṭatvāpatteḥ /
abhedena bhedābhāvaḥ sādhyata iti cenna /
bhedābhāvātiriktasyābhedasya anabhyupagamāt /
abhyupagamo 'pi bādhāt /
evamupādānopādeyabhāvo 'pyasiddha eva /
nahi svayamevopādanamupādeyaṃ ceti yuktam /
karaṇatvakarmatvayorbhedaniyatatvāt /
saṃyogāprāptyabhāvaścātyantabhedābhāvādupapatsyate /
gurutvāntarakāryādarśanaṃ cābhedāṅgīkāreṇa bhaviṣyati /


*7,73*

etena kāryatvamabhūtvābhāvitvaṃ cedasiddhamasmākam /
abhivyaktidharmakatvaṃ cedyuṣmākamiti ca nirastam /
tadidamuktam- kena vāryata iti //


tadevaṃ paṭādyutpattau cetanasya kuvindādeḥ pravṛtterupalambhāttaddṛṣṭāntena mahadādyutpatterapi cetanecchādhīnatvamityevaṃ svapakṣaṃ prasādhya parapakṣanirāsārthaṃ racanānupapatteśca nānumānamiti sūtraṃ vyākhyātuṃ pīṭhamāracayati- naceti //

naca kācit pramoktārthe ... // MAnuv_2,2.15a //


*7,74*

NYĀYASUDHĀ:
na kevalamasmanmate pramāṇasadbhāvaḥ /
kintu sāṅkhayoktārthe pradhānasya svātantryeṇa jagatkāraṇatve kimapi pramāṇaṃ nāsti /
tathāhi /
kimatra pratyakṣaṃ pramāṇaṃ syāduta āgamo 'thavānumānaṃ vā /
nādyaḥ /
taddhayasmadādīnāṃ vā yogināṃ vā /
na prathamaḥ /
asyārthasyātīndriyatvāt /
na dvitīyaḥ /
asiddheḥ /
nahi evaṃ yoginaḥ paśyantītyasmākaṃ pramāṇamasti /


nāpyāgamaḥ /
sa hyapauruṣeyaḥ pauruṣeyo vā syāt /
nādya ityāha- śrutireveti //


*7,75*

... śrutireva pramā hi naḥ // MAnuv_2,2.15b //

NYĀYASUDHĀ:
śrutirno 'smākameva mate pramā hi /
sarvā'pi hi śrutirīśvarameva svātantryeṇa sakalajagatkāraṇaṃ sarvajñaṃ sarvaśaktiṃ pratipādayati /
pradhānaṃ ca tadāyattasattāpratītipravṛttimattadadhiṣṭhitaṃ jagadupādānamātramiti /
tathāhi /
"yaḥ sarvajñaḥ sarvavit'; /
"yo yonimadhitiṣṭhatyekaḥ'; ityādi /
tathāca śrutiḥ parasya pratipakṣabhūtaiva /

pauruṣeyo 'pi kiṃ smṛtītihāsapurāṇalakṣaṇaḥ /
uta sāṅkhayācāryapraṇītaḥ /
nādyaḥ /
tasyāpyasmanmatānusāritvāt /
"prakṛtiṃ puruṣaṃ caiva praviśya puruṣottamaḥ /
kṣobhayāmāsa bhagavānsṛṣṭayarthaṃ jagato vibhuḥ'; ityādivacanāt /
na dvitīyaḥ /
tatprāṇyasyāsammateḥ /
āptoktatvena tatprāmāṇyasiddhiriti cettatrāha- āptatvamiti //

āptatvamuktamārgeṇa vakturnaivopapadyate // MAnuv_2,2.15cd //


*7,76*

NYĀYASUDHĀ:
uktamārgeṇa śrutireva pramā hi na ityuktarītyā śrutiviruddhabhāṣitvādityarthaḥ /
vaktuḥ sāṅkhayapraṇetuḥ /
yadvā itareṣāṃ cānupalabdherityuktamārgeṇa /
sāṅkhayaśāstre 'pi hyākhyāyikāsu yogyānupalabdhibādhitā bahavo 'rthāḥ pratipādyante /
athavā"avipralambhastajjñānam'; ityādyuktamārgeṇāptatvaniścāyakapramāṇābhāvādityarthaḥ /
"kapilo vāsudevākhyastantraṃ sāṅkhayaṃ jagāda ha /
brahmādibhyaśca devebhyo bhṛgvādibhyastathaiva ca /
tathaivāsuraye sarvavedārthaparibṛṃhitam /
sarvavedaviruddhaṃ ca kapilo 'nyo jagāda ha /
sāṅkhayamāsuraye 'nyasmai kutarkaparibṛṃhitam'; iti purāṇoktamārgeṇeti vā /
"ṛṣiṃ prasūtaṃ kapilam'; ityādiśrutyudāharaṇamapyanenaiva nirastam /
etenaiva"āgamādyogipratyakṣāvagame'; ityapākṛtam /


*7,77*

na kevalamuktamārgeṇāptatvānupapattiḥ /
kinnāmānupapannabhāṣitvādapītyāha- aprāmāṇyeti //

aprāmāṇyasvatastvasya svīkārādapi ... // MAnuv_2,2.16ab //


*7,78*

NYĀYASUDHĀ:
apiśabdena prāmāṇyasvatastvamapi samuccinoti /
jñānānāṃ prāmāṇyamaprāmāṇyaṃ jñānakāraṇamātrādhīnotpattikamiti svīkaroti sāṅkhayaḥ /
taccānupapannamityato 'pyasau nāptaḥ /

kathaṃ prāmāṇyāprāmāṇyayoḥ svatastvamanupapannamityata āha- māyivaditi //

... māyivat /
svoktākhilaniṣedhī syān ... // MAnuv_2,2.16bc //


NYĀYASUDHĀ:
prāmāṇyāprāmāṇyayorjñānakāraṇamātrajanyatve sāṅkhayasya vacanenotpannaṃ jñānaṃ pramāṇamapramāṇaṃ cetyubhayātmakaṃ vā syāt /
parasparavirādhenobhayavikalaṃ vā jñānamātramutpa(dyeta)dyate /
niḥsvabhāvasya jñānasyānupapattyā notpa(dyate)dyeta vā /
ādye sadasadvilakṣaṇaṃ viśvaṃ manyamāno māyāvādī yathā svoktaniṣedhī sadvilakṣaṇamityuktyā prāptasyāsattvasya, svayameva asadvilakṣaṇamiti niṣedhāt /
asadvilakṣaṇamityuktyā ca prāptasya sattvasya svayameva sadvilakṣaṇamiti niṣedhāt /

tathā sāṅkhayo 'pi svoktākhilaniṣedhī syāt /
tadvākyajanitajñānasya yāthārthye hi prakṛtirjagatkāraṇamityādiko 'rtho yo labdhaḥ, sa evārthastasyāyāthārthye niṣiddhaḥ syāt /
ayāthāthyarsya viṣayaviparyāsānatirekāt /
ubhayasvatastve vastuno viruddhākāradvayāliṅgitatvaṃ prasajyeteti bhāvaḥ /
māyāśabdasya vrīhyāditvānmāyīti sādhu /


*7,80*

nanvevamapi yāthārthyena prakṛtirjagatkāraṇamityādiko 'rthastāvatsiddhayatītyata āha- naceti //

... na ca kiñcit prasiddhayati // MAnuv_2,2.16d //

NYĀYASUDHĀ:
nahi parasparavirodhe kimapi siddhayatīti bhāvaḥ /
tarhi prāmāṇyasya kā gatiriti cet /
aprāmāṇye 'pi dīyatāṃ dṛṣṭiḥ /
dvitīye doṣamāha- naceti //
jñānaṃ hi yathāvasthitamayathāvasthitaṃ vār'thaṃ viṣayīkuryāt /
tṛtīyaprakārānirūpaṇāt /
tathāca prāmāṇyāprāmāṇyavikalaṃ jñānam ayaḥśalākāvadaviṣayameva syāt /
evaṃca na sāṅkhayavacanātkiñcitprasiddhayatīti /
tṛtīye tu jagadāndhyameva syādityāha- naceti //


syādetat yadā jñānakāraṇaṃ guṇopetaṃ tadā tadīyāyāmaprāmāṇyajananaśaktau guṇena pratibaddhāyāṃ pramāṇajñānamevotpadyate /
yadā tu doṣopetaṃ tadā doṣeṇa prāmāṇyajananaśaktau pratibaddhāyāṃ apramāṇajñānamevotpadyate /
nahi kimapi karaṇaṃ yugapadubhayopetamubhayavikalaṃ vā sambhavati /
yenoktadoṣaḥ syāditi /
ucyate /
kimarthamitthaṃ kalpyate /
jñānasyobhayākāratvaprasakteriti cet /
tatprasaktirapi kuto nābhyupagantavyā /
virodhabhayāditi cet /
karaṇe 'pyubhayaśaktivirodhātkuto na bibheṣi /


*7,81*

yadapi viruddhakāryadvayajanakaṃ karaṇaṃ tatsahakārisāhityāhitaśaktikameva /
prakṛte ca tathābhyupagame dvayorapi paratastvāpattiḥ /

kiñca vacane kau guṇadoṣau /
āptānāptatvapraṇītatve iti cet /
tarhyubhayābhāvādvedavākyenobhayātmakamanubhayātmakaṃ vā jñānamutpadyeta /
notpadyeta vā /
anāptapraṇītatvaṃ guṇa iti cet /
tarhyāptāpraṇītatvaṃ doṣo 'pi kinna syāditi sa eva prasaṅgaḥ /


*7,82*

etena sāṅkhayācāryavacanaṃ svata eva pramāṇaṃ kimāptiniścayenetyapi nirastam /
aprāmāṇyasyāpi svatastvenoktasakaladoṣāpatteḥ /
atha mahājanaparigrahāttatprāmāṇyaniścaya iti cenna /
pūjyārthatve 'siddheḥ /
bahvarthatve savyabhicāratvātsandigdhāsiddheśceti /


*7,83*

mā bhūtprakṛtikāraṇatve prapañcasya pratyakṣaṃ pramāṇam /
mā ca bhūdāgamaḥ /
anumānaṃ tu bhaviṣyati /
yathoktam /
"bhedānāṃ parimāṇātsamanvayācchaktitaḥ pravṛtteśca /
kāraṇakāryāvibhāgādavibhāgādvaiśvarūpasya'; iti /


*7,83f.*

ayamarthaḥ /
kāraṇakāryavibhāgādavibhāgādvaiśvarūpyasya mūlakāraṇamastyavyaktam /
yathā kūrmaśarīre santyevāṅgāni tato vibhajyante /
tasminnevāvyaktībhavanti /
evaṃ kāraṇānmṛtpiṇḍāddhemapiṇḍādvā kāryāṇi ghaṭamukuṭādīni vibhajyante /
santyeva ca pṛthivyādīni kāraṇāttanmātrāt /
santyeva ca tanmātrāṇyahaṅkārāt /
sanneva cāhaṅkāro mahataḥ /
sadeva ca mahatparamāvyaktāditi /
so 'yaṃ kāraṇātparamāvyaktātpāramparyeṇa viśvasya kāryasya vibhāgaḥ pratisarge /
mṛtpiṇḍaṃ hemapiṇḍaṃ vā ghaṭamukuṭādayo viśanto 'vyaktībhavantīti tatkāraṇarūpamevānabhivyaktaghaṭamukuṭādikāryamapekṣyāvyaktaṃ bhavati /
evaṃ pṛthivyādayastanmātrāṇi viśantaḥ svāpekṣayā tanmātramavyaktayanti /
evaṃ tanmātrāṇyahaṅkāraṃ viśantyahaṅkāramavyaktayanti /
evamahaṅkāro mahāntamāviśanmahāntamavyaktayati /
mahānprakṛtiṃ svakāraṇaṃ viśati /
prakṛtestu na kvacinniveśa iti sā sarvakāryāṇāmavyaktameva /
so 'yamavibhāgaḥ prakṛtau vaiśvarūpyasya nānārūpasya kāryasya /
tasmātkāraṇe kāryasya sata eva vibhāgāvibhāgābhyāmavyaktaṃ kāraṇamastīti /


*7,84*

itaśca, śaktitaḥ pravṛtteḥ /
kāraṇaśaktito hi kāryaṃ pravartate /
aśaktātkāraṇātkāryasyānutpatteḥ /
śaktiśca kāraṇagatā na kāryasyāvyaktatvādanyā /
astu tarhi mahata eva paramāvyaktatvamityata uktaṃ bhedānāṃ parimāṇāditi /
mahadādīnāmavyāpakatvādavyaktakāraṇakatvaṃ ghaṭādivadityarthaḥ /
itaśca, samanvayāt /
sukhaduḥkhabhogasamanvitāni hi kāryāṇi /
yāni ca yadūpamanugatāni tāni tatsvabhāvāvyaktakāni /
yathā mṛddhemarūpamanugatā ghaṭamukuṭādayo mṛddhemapiṇḍāvyaktakāḥ /
tasmādasti sukhaduḥkhamahohātmakānāṃ sattvarajastamasāṃ sāmyāvasthāvyaktaṃ bhedānāmiti /


*7,89*

yadyapyetānyanumānānyavyaktasvarūpaṃ sādhayanti /
tathāpi mahadādikāraṇatayaiva tadetaiḥ siddhayatīti /
atra vaktavyam /
kimetairanumānairjagadupādānatāmātreṇāvyaktaṃ siddhayati, uta svātantryeṇā(pīti)pi /
ādye siddhasādhanam /
asmābhirapi viśvopādānasya pradhānasyābhyupagatatvāt /
"śarīrarūpakaḥ'; iti hyuktam /
dvitīyaṃ nirākartuṃ sūtram /
racanānupapatteśca nānumānamiti /
tadvayācaṣṭe- idamiti //

idaṃ nācetanavaśaṃ vastutvāt pratipannavat /
ityeva pratiṣiddhasya kena mūlānumā bhavet // MAnuv_2,2.17 //


NYĀYASUDHĀ:
mahādādikāryamityarthaḥ /
acetanavaśaṃ svatantrācetanādhīnotpattikam /
pratipannavat /
pradhānavat /
āstāṃ tāvaddūṣaṇāntaram iti pratyanumānenaiva pratiṣiddhasya pradhānasvātantryasya mūlānumā sādhikānumā kena sāmarthyena bhavet pramāṇamiti śeṣaḥ /
mūlānumeti vā'vartanīyam /
kim ākṣepe /
akāryatvamatropādhiriti cenna /
paṭādau sādhyāvyāpteḥ /
paṭādeḥ kuvindādyadhiṣṭhitatantvādikāyartvasyānvayavyatirekābhyāmupalambhāt /


*7,91*

evaṃ pradhānasya racanāyāḥ svatantrapravṛtteranumānavirodhenānupapatternānumānaṃ tatra pramāṇamiti sūtrākṣarayojanāṃ manasi nidhāya sūtratātparyamuktam /
idānīṃ tāmeva vivṛṇvanpratipakṣāntaramāha- svatantreti //

svatantravṛttī racanā sā caivācetane kutaḥ // MAnuv_2,2.18ab //

NYĀYASUDHĀ:
caśabdo 'numānāntarasamuccaye /
kuta evetyanvayaḥ /
ayamatra prayogaḥ /
pradhānaṃ svatantrapravṛttirahitam acetanatvāt /
tantvādivaditi /


*7,92*

nanvacetanatve 'pi pradhānasya svātantryeṇa pravṛttirastu ko virodhaḥ /
tathāca vipakṣe bādhakābhāvādaprayojako 'yaṃ heturityata āha- acetanatvamiti //

acetanatvaṃ svātantryamiti cātmapramāhatam // MAnuv_2,2.18cd //

NYĀYASUDHĀ:
tāvadeva hyanenāśaṅkanīyaṃ yasminnāśaṅkayamāne svavacanasvakriyāsvanyāyapramāṇāntaravirodho na prāduṣyāt /
nahi kaścidevaṃ śaṅkate /
mūko 'pi vaktā kinna syāt /
śabdo 'pratipādakaḥ kinna bhavet /
anumānatvāt anumānamātramapramāṇaṃ kuto na syāt /
agniranuṣṇaḥ kuto na bhavediti /
na hyeṣā śaṅkāpiśācī kadācicchāntimupāgacchati /
tasmādevāmāśaṅkamāno na laukiko nāpi parīkṣaka ityunmattavadupekṣaṇīyaḥ /
prakṛte cācetanatvaṃ svātantryaṃ cātmapramāhatam /
svavyāhataṃ pramāṇaviruddhaṃ ca /
tasmādacetanatve 'pi svatantrapravṛttirastu pradhānasyeti śaṅkaiva notpattumarhatīti kimatra bādhakopanyāseneti /


*7,93*

nanvacetanasya svātantryaśaṅkāyāṃ kathaṃ svavyāhatiḥ /
nahi svātantryaṃ nāma caitanyam /
nāpyacetanatvaṃ nāmāsvātantryam /
kathaṃca pramāṇavirodhaḥ, ityata svavyāghātaṃ tāvadupapādayituṃ svātantryaṃ vyākhyāti- sveccheti //

svecchānusāritāmeva svātantryaṃ hi vido viduḥ // MAnuv_2,2.19ab //

NYĀYASUDHĀ:
pravṛttāviti śeṣaḥ /
vido vidurityanena sakalavidvatsammatametadityāha /
ata eva hi svātantryābhāvādvṛkṣastiṣṭhatītyādikartṛtvavyavahāro gauṇa iti sarve pratipannāḥ /


*7,97*

tathāpi kathaṃ svavyāhatiḥ /
nahyacetanatvaṃ nāmecchāvirahaḥ /
kinnāma caitanyaviraha ityata āha- kuta iti //

kuta icchācetanasya ... // MAnuv_2,2.19c //

NYĀYASUDHĀ:
acetanasyecchā kutaḥ kāraṇājjāyate /
na kutaścit /
jñānameva hīcchāyā janakamityarthaḥ /
tathāpi kimityata āha- secchaṃ cediti //


*7,98*

... secchaṃ cet kimacetanam // MAnuv_2,2.19cd //

NYĀYASUDHĀ:
secchaṃ cedaṅgīkṛtaṃ tadā tadacetanaṃ kiṃ cetanamevetyarthaḥ /

etaduktaṃ bhavati /
acetanamapi pradhānaṃ svātantryeṇa pravṛttimadastviti vadatācetanamicchāvadastvityuktaṃ syāt /
svecchānusāritvasya svātantryaśabdārthatayā sarvasammatatvāt /
acetanasyecchāvattvamaṅgīkurvāṇena cetanatvamapyaṅgīkartavyaṃ syāt /
anvayavyatirekābhyāmicchāyāḥ svasamānāśrayacaitanyakāryatvāvadhāraṇāt /
kāryāṅgīkāre kāraṇānaṅgīkārasyānucitatvāt /
acetanaṃ cetanamiti ca sphuṭā vyāhatiriti /


etenaitadapi nirastam /
acetanatvaṃ svātantryaṃ ca yadi parasparavyāhataṃ tarhyacetanatvena svatantrapravṛttirāhityasādhane sādhyāviśiṣṭatādoṣaḥ syāditi /
nahyasmābhiracetanatvasvātantryayoḥ vandhyā apatyavatītivatsākṣādvirodho 'bhihitaḥ /
kintu svātantryabalena caitanyaṃ pareṇāṅgī(kārya)kārayitvā anenaiva svātantryāṅgīkāre 'cetanatvānupapattiriti bādhakaṃ coktaṃ bhavati /


*7,103*

evamacetanasya svātantryāṅgīkāre svavyāhatimupapādya pramāṇavirodhamapyupapādayati- icchāmīti //

icchāmyahamiti hyeva nijānubhavarodhataḥ /
acetanecchāpagatā ... // MAnuv_2,2.20 //


NYĀYASUDHĀ:
hiśabdenāsyānumānasya viśvajanaprasiddhatvaṃ sūcayati /
evaśabdasyāpagataivaityanvayaḥ /
nijānubhavaḥ sākṣyanubhavaḥ /
ahamicchāmīti tāvadicchā ātmasambandhinī sākṣiṇānubhūyate /
naca sā dvikartṛkā sambhavati /
kvāpyekasya vyāpārasya dvikartṛkatvānupalambhāt /
tataścācetanasyecchāṅgīkṛtā(vaitada)ce(tta)danubhavavirodhādacetanasyecchāpagatā nāstīti yāvat /
icchābhāve ca svecchānusāritvalakṣaṇaṃ svātantryaṃ dūrotsāritamiti bhāvaḥ /


*7,104*

nanu navamastyanubhavaḥ kintvahamicchā(mīcchā)mīti vyavahāramātram /
tasyāpi nimittaṃ bhedāgrahaḥ /
ātmā hi nityo nirvikāraścaitanyamātravapurna tasyecchādikartṛtvamāgantukaṃ sambhavati /
kintvantaḥkaraṇasyaiva prasavadharmatvāt /
tayoścātmāntaḥkaraṇayorbhedāgrahāditaretaradharmavyavahāraḥ pravartate /
bhedāgrahe ca nimittaṃ sannidhānam /
yathoktam /
"tasmāttatsaṃyogādacetanaṃ cetanāvadiva liṅgam /
guṇakartṛtve ca tathā karteva bhavatyudāsīnaḥ'; iti /
ato 'nubhavabalāccetanasyaivecchāvattvaṃ nācetanasyetyayuktamityata āha- yadīti //

... yadi bhedāgraho 'tra ca // MAnuv_2,2.20d //
kathaṃ na sa ghaṭasya syān ... // MAnuv_2,2.21a //


NYĀYASUDHĀ:
yadi evamanubhava eva nāsti kintu vyavahāramātram, atra ca vyavahāre bhedāgraha eva nimittamucyate, tadā sa bhedāgraho ghaṭasya kiṃ (kathaṃ) na syāt /
vyavahāraheturiti śeṣaḥ /
idamuktaṃ bhavati /
svaprakāśānubhavāpalāpadoṣastāvat /
vyavahāre ca nimittaṃ nāsti /
naca bhedāgrahaḥ /
viśiṣṭavyavahārasya tādṛśajñānakāryatāniyamāt /
anyathā ghaṭapaṭāvapītaretarabhedaṃ na gṛhṇīta itītaretaradharmasaṃsargavyavahāraḥ syāditi /


*7,107*

nanu gṛhyamāṇayorbhedagraho vyavahāraheturna tu bhedāgrahamātram /
naca ghaṭapaṭau svarūpaṃ gṛhṇītastatkathamatiprasaṅga iti cet /
kimayaṃ viśiṣṭo bhedāgraho 'ntaḥkaraṇasya, utātmanaḥ /
nādyaḥ /
tasyācetanatvena svarūpagrahānupapatteḥ /
upapattau vā sa kathaṃ viśiṣṭo bhedāgraho ghaṭasya na syāt /
tathāca vyavahāro 'pi syāt /
nanvantaḥkaraṇe 'sti caitanyāropo na ghaṭe, ato nātiprasaṅga iti cet /
kiṃ tasya nimittam /
sannidhānamiti cet /
tarhi sarvagatātmasannidhānaṃ ghaṭe 'pyastīti kathaṃ sa na ghaṭasya syāt /
nanu na saṃyogamātraṃ nimittam /
kintūpakāryopakārakabhāve sati /
sa cāstyātmāntaḥkaraṇayoḥ /
puruṣasya darśanārthamityuktatvāt iti cet /
tarhi ghaṭo 'pi puruṣasyopakāraka iti kathaṃ sa na ghaṭasya syāt /

dvitīye vyavahāro 'pi kimātmana utāntaḥkaraṇasya /
nādyaḥ /
tasya nirvikārasya vyavahārakriyānupapatteḥ /
upapattau vā kimicchayāparāddham /
dvitīye 'nyagatena bhedāgraheṇānya(tra)sya vyavahāraścetkathaṃ sa na ghaṭasya syāt /


*7,109*

kiñca yadi bhedāgrahādantaḥkaraṇadharma evecchā'tmani vyavahriyata ityaṅgīkriyate tadā ghaṭasyāpyātmanā bhedāgrahātpṛthubudhnodarākāro 'hamiti vyavahāraḥ kathaṃ na syāditi gūḍhābhisandheruttaram /

yadvātra cātmāntaḥkaraṇayośca sphuṭaṃ pratibhāsamānabhedayorapīti hṛdayam /
yadi bhedāgrahaḥ syāttadā kathaṃ sa bhedāgraho ghaṭasyātmanaśca na syāditi yojanā /

athavaivaṃ vadanpraṣṭavyaḥ /
bhedāgrahaḥ kiṃ bhedagrahasya virodhī na veti /
neti pakṣe kathaṃ sa ghaṭasyātmanā paṭādinā vā na syādityuttaram /


*7,110*

nanu bhedagraho bhedāgrahavirodhī /
sa cāsti ghaṭa iti kutastatra bhedāgrahastatprayukto vyavahāro veti gūḍhābhisandhimajānato dvitīyapakṣamāśaṅkayāha- mana iti //

... mano ma iti bhedataḥ /
manaso 'pi gṛhītatvād ... // MAnuv_2,2.21bc //



*7,110f.*

NYĀYASUDHĀ:
bhedata iti tṛtīyārtho tasiḥ /
yadi bhedagraho bhedāgrahavirodhīti bhedena gṛhyamāṇe ghaṭe na bhedāgraha ityucyate, tadā me mana iti manaso 'pi bhedena gṛhītatvānnātmanā bhedāgrahaḥ syāt /
tathāca bhedāgrahanimitto 'hamicchāmīti vyavahāra ityasat /
kintvanubhavanimitta eva /
ata eva nāntaḥkaraṇadharmasyātmanyāropa ityapi yuktam /
bhedagrahasadbhāvena āropahetorbhedāgrahasyāyogāt /
nahyaviditabhedaṃ sambandhitayā gṛhyate /
ātmanyapi prasaṅgāt /
kena punaḥ pramāṇena mano gṛhyate /
sākṣiṇeti vadāmaḥ /
tathāhi /
natāvaccakṣurādinā tadavagamaḥ /
arūpidravyatvāt /
cakṣurādyavyāpāre 'pyupalabdheḥ /
nacānumānena /
liṅgābhāvāt /
nanvasti yugapajjñānānutpattirmanaso liṅgam /
tathāhi /
bāhyendriyeṣu svaiḥ svairviṣayairyugapatsannikṛṣṭeṣvātmanādhiṣṭhiteṣvapi na yugapajjñānāni jāyante /
tena jñāyate 'styetebhyo 'nyatsahakāri /
yatsaṃyogakramavaśājjñānakramaḥ prakramata iti //


*7,115f.*

atra kaścidāha /
ātmana evaivaṃvidhasāmarthyakalpanopapattāvanyathāsiddhamanumānam /
manasaḥ pratīndriyasaṃyogavyavahāre kramavati kāraṇāntaraśūnye 'naikāntikaṃ ca /
phalasya ca vṛkṣaśatpatataḥ kramavartinyākāśasaṃyoge kuṭhārādivyāpāre ca /
indriyāṇāṃ prativiṣayasaṃyogavyāpāre ceti /
tadayuktam /
dṛṣṭānusāriṇī hi kalpanā /
kartā hyanekakaraṇādhiṣṭhānena yugapannānākāryāṇi kurvāṇo dṛṣṭaḥ /
tathāhi /
yugapanmāṇavako gacchati paṭhati panthānamīkṣate vahati ca kamaṇḍalum /
tasmānnaiva kartṛdharmo yuktaḥ kalpayitum /
kintu dṛṣṭatvād dravyāntaramevāvyāpakam /
anaikāntyaṃ tu nāstyeva /
tatrāpi kriyākramādernimittasya vidyamānatvāditi /


*7,118f.*

atrocyate /
asti tāvadavivekināmapi manaḥpratītiḥ /
mama mano 'nyatra gatamityādivyavahārāt /
naca te yugapajjñānānutpattiṃ jānanti /
pratyuta yugapadeva jñānotpattiṃ manyante /
anyathā vyāsaṅge kramadarśanenānyatrāpi kramānumānaṃ parasya vyarthaṃ syāt /
tasmālliṅgadarśanātprāgeva bhavadidaṃ manojñānaṃ na tannimittakamiti /
astu tarhi buddhayādīnāmasamavāyikāraṇasya saṃyogasyāśrayatayā manaḥsiddhiḥ /
maivam /
pratyakṣajñāne tāvadindriyātmasaṃyogasyaivāsamavāyikāraṇatvasyopapatteḥ /
anumityādau liṅgajñānādeḥ /
smṛtau bhāvanāyāḥ, sukhādāviṣyārthopalabdhāderiti /
nityaviśeṣaguṇānāṃ saṃyogāsamavāyikāraṇatvaniyamānnaivamiti cenna /
vibhāga(ja)śabdajaśabde vyabhicārāt /
aśrāvaṇattvena hetuviśeṣaṇānneti cet /
yathā tarhi vibhāgādiśabde kāraṇāntaradarśanāttannirāsārthaṃ vyāptigrahaṇavelāyāṃ prayatyate tathā sukhādinirāsāya prayatanīyam /
asamavāyikāraṇāntaradarśanasya tulyatvāt /
nimittaṃ taditi cenna /
asamavāyikāraṇalakṣaṇasyātivyāptiprāpteriti /
naca sukhādyupalabdhikaraṇatvena manassiddhiḥ /
sākṣisiddhatayānyathāsiddheḥ /


*7,123*

evamanumānāntaramapi nirasanīyam /
nacāgamo manasi pramāṇam /
jātibadhirāṇāmapi tatpratyayāt /
tasmātsiddhaṃ sākṣigrāhyatvaṃ manasaḥ /
tasya ca tenaivātmano bhinnatayā grahaṇādbhedāgrahāsambhavenecchāmyahamīti na bhedāgrahanibandhano vyavahāra iti /


*7,125*

nanu ca "kāmaḥsaṅkalpo vicikitsā śraddhāśraddhā dhṛtiradhṛtirbhīrhīrityetatsarvaṃ mana eva'; iti śrutau kāmasyāntaḥkaraṇarūpatvaṃ tāvatpratīyate /
naca śrautenārthenānyathā bhavituṃ yuktam /
ato balavadbādhakopanipātādicchāmyahamiti bhedāgrahanimittaṃ vyavahāramātrametaṅgīkaraṇīyam /
na tvātmana icchāsambandhānubhavaḥ /
naca me mana iti bhedagrahāttadagrahāsambhavaḥ /
me caitanyamitivadvayavahāramātratvāt /
nacoktānupapattiḥ /
sattvarajastamasāmādikāryaṃ hi buddhirityucyate /
sā cāṃśatrayavatī /
puruṣoparāgo viṣayoparāgo vyāpārāveśaścetyaṃśāḥ /
bhavati hyahamidaṃ karomīti /
tatrāhamiti cetanoparāgo darpaṇasyaiva mukhoparāgo bhedāgrahādatāttvikaḥ /
idamiti viṣayoparāga indriyapranāḍikayā pariṇatibhedo darparasyeva malasambandhaḥ pāramārthikaḥ, tathobhayāyatto vyāpārāveśaḥ /
eṣaiva digahamicchāmītyatrāpītyata āha- ubhayeti //

... ubhayātmakatā yataḥ // MAnuv_2,2.21d //
kāmasya tu manaḥ kāmaḥ ... // MAnuv_2,2.22a //


NYĀYASUDHĀ:
tuśabdo 'vadhāraṇe /
tata ityupaskartavyam /
yataḥ kāraṇātkāmasyobhayātmakatāsti /
ātmadharmatā manodharmatā ca /
tata eva manaḥ kāma iti śrutirupapadyate /
idamuktaṃ bhavati /
bhavedidaṃ bhedāgrahakalpanam /
yadyātmanaḥ kāmavattvaṃ pāramārthikaṃ na syāt /
nacaitadasti /
bādhakābhāvāt /
dvividho hi kāmo 'sti /
eka ātmadharmo 'paro 'ntaḥkaraṇadharmaḥ /
tatrāntaḥkaraṇadharmaṃ kāmamabhipretya śrutiḥ pravṛttā, nātmanaḥ kāmavattvaṃ bādhate /
nahi devadatto gomāniti vākyaṃ yajñadattasya gosambandhaṃ bādhituṃ śaknotīti /


*7,133*

syādetadevam /
yadi kāmadvaividhyaṃ pramitaṃ syāt, etadeva kuta iti cet /
śrutyanubhavabalāttāvat /
prakārasahasrānusaraṇe 'pyaghaṭanāyāṃ khalvanubhavāpalāpasāhasamabhyupeyam /
pramāṇāntaraṃ cāha- priyeti //

... priyāpriyavibhedataḥ /
dvaividhyaṃ dṛśyate cāsya ... // MAnuv_2,2.22bc //



*7,133f.*

NYĀYASUDHĀ:
priyamityātyantikeṣyamucyate 'priyamiti ca tātkālikeṣyam /
viṣayeṇa viṣayiṇa upalakṣaṇam /
asya kāmasya /
ayamarthaḥ /
asti tāvadāstikakāmukasya puruṣasya srakcandavanitādau idaṃ me syādityekataḥ kāmaḥ /
anyatastyajeyamiti /
nacaika evāyam /
viruddharūpatvāt /
naca dvāvapi manodharmau, yaugapadyāt /

yugapatsajātīyadharmajananāyogāt /
naca yaugapadyaṃ nāsti /
anubhavasiddhatvāt /
bādhakābhāvācca /
tatra yo 'priyaviṣayaḥ saḥ antaḥkaraṇadharmaḥ yastu priyaviṣayaḥ sa ātmadharma iti /


*7,134*

yadvā priyāpriyaśabdābhyāṃ muktisaṃsārāvucyete /
tatsambandhivibhedena kāmadvaividhyaṃ dṛśyata iti /
asti tāvatsaṃsāre pracuro 'yamantaḥkaraṇavṛttirūpaḥ kāmaḥ /
asti cāsau muktau /
"sa yadi pitṛlokakāmo bhavati'; ityādiśruteḥ /
nacaika evāyam /
muktāvantaḥkaraṇavilayāt /
tathācāsāvātmadharmo 'bhyupeyaḥ /
nacāgantukadharmasambandho muktāviti prāgapi kāmadvaividhyaṃ siddhayatīti /


*7,136*

śrutibādhaparihārasya prayojanamāha- tasmāditi //

*7,137*

... tasmād bhedāgrahaḥ kutaḥ // MAnuv_2,2.22d //

NYĀYASUDHĀ:
śrutivirodhasya parihṛtatvādbhedāgrahaḥ kutaḥ pramāṇātkalpanīyaḥ /
kutaścānubhavāpalāpena vyavahārasya tannimittatvam /
na kuto 'pītyarthaḥ /
anenācetanasya pradhānasya svātantryeṇa jagatkāraṇatvaṃ sādhayatāmanumānamapi svavacanavirodhaḥ pramāṇavirodhaścoktau bhavataḥ /
dṛṣṭāntaśca sādhyavikalaḥ /
acetanasvātantryasya kvāpyasammateriti /


*7,138*

sūtrārthamupasaṃharannānumānamityetatprakārāntareṇa vyācaṣṭe- racaneti //
racanānupapattestanna sarvajñānumāgatam /
acetanaṃ jagatkartṛ ... // MAnuv_2,2.23a-c //


NYĀYASUDHĀ:
tattasmāt /
sarvajñānumāgatamanumānaṃ prakṛtyādikaṃ, kasyacitpratyakṣaṃ, prameyatvāditi sarvamasādhakānumayāvagatam /
etadanumānasiddhasarvajñavākyāvagatamiti yāvat /

yadvānumānasiddhaprāmāṇyakatvenānumānapradhānatvena ca sarvajñābhimatasya vākyameva sarvajñānumocyate /
vyākhyānāntarasya cedaṃ prayojanam /
yatprāguktaṃ na yogipratyakṣeṇa sāṅkhayācāryavacanena vāyamarthaḥ siddhayatīti tadapi sūtrasūcitameveti jñāpanam /
yadā tu sarvajñābhimatotprekṣitayā bhedānāṃ parimāṇādityādikayānumayāvagatamānumānamiti yojanā /
tadā vaici(trya)trīpradarśanaṃ vyākhyānāntaraprayojanam /
jagatkartṛ svātantryeṇa jagatkāraṇam /


*7,142f.*

syādetat /
parimāṇādihetubhistāvanmahadādikāryāṇāṃ kimapi mūlakāraṇamastītyavagamyate /
tasyāpi kāraṇāntarakalpane pramāṇābhāvādanavasthānācca /
tasya ca svātantryaṃ kārakāntarāprayojyatvameva natu svecchānusāritvam /
yenoktadoṣaḥ syāt /
tacca tatprayoktuḥ kārakāntarasyāprāmāṇikatvādeva siddham /
nacācetanasya tadasambhāvitam /
acetaneṣvapi payo 'mbuprabhṛtiṣu darśanāt /
acetanameva hi payo 'nyānadhiṣṭhitamapi vatsavivṛddhayarthaṃ pravartate /
dadhibhāvaṃ cāpadyate /
ghanavinirmuktaṃ cāmbu jambīranārikelādiṣvanekavidhaṃ vikāraṃ prāpnoti /
nādeyaṃ cāpasarpati /
tṛṇaṃ ca gavā jagdhaṃ kṣīrībhavati /
ayaścāyaskāntamabhisarpati /
naca"idaṃ nācetanavaśam'; ityādipramāṇavirodhaḥ /
tasyoktasthāneṣvevānaikāntyam /
nacedaṃ brahmavādināṃ sammatam /
yena siddhasādhanaṃ syādityāśaṅkāparihārārthaṃ sūtram- //
oṃ payo 'mbuvaccettatrāpi oṃ //
iti /
tadvayācaṣṭe- payo 'mbvādi ceti //

*7,143*

payo 'mbuvac cet tatrāpi | BBs_2,2.3 |

... payo 'mbvādi ca nopamā // MAnuv_2,2.23d //
etatpraśāstivacanāccetanācetanasya ca // MAnuv_2,2.24ab //


NYĀYASUDHĀ:
upamā svārthasambhāvanāyāmasmadīyahetuvyabhicāre ceti śeṣaḥ /
yathātra sādhyaṃ vyabhicarati tathā pakṣe 'pi vyabhicaratu heturityevamarthaṃ hi vyabhicārodbhāvanam /
tadatra na yujyate /
cetanācetanasyaitatpraśāstivacanāt /
pārameśvarapreraṇāpratipādakaśruteḥ /
ādyaścaśabdo laukikānāṃ svatantratayā pratīyamānamapītyarthe /
dvitīyastu na kevalamacetanasya /
kintūbhayasyāpīti /

etaduktaṃ bhavati /
kārakāntarāprayojyatvalakṣaṇamapi svātantryaṃ na pradhānasyopapadyate /
asambhāvitatvāt /

uktānumānaviruddhatvācca /


*7,146*

yaduktamatra payombvādivaditi /
tadasat /
tatrāpīśvarapreraṇayā"etasya vā akṣarasya'; ityadiśrutisiddhatvāt /
ata eva pradhānasya paraprayojyatve pramāṇābhāvo 'pi parāsta iti /
sūtre payo 'mbuvadityukte 'pi nodāharaṇamādaraṇīyam /
sthalāntare sambhāvanā vyabhicāraśca bhaviṣyata ityāśaṅkāparihārārthasya"vyatirekānavasthiteścānapekṣatvāt'; iti uttarasūtrasyāpi vyākhyānāyādipadaprayogaḥ /
yadvā payo 'mbugrahaṇamupalakṣaṇamityabhipretyādipadaṃ pratyuktam /
uttarasūtraṃ tu kaimutyārtham /
cetanapravṛtterapīśvaravyatirekeṇānavasthiteracetanapravṛttestadadhīnatvaṃ kimu vācyamiti /

tadvayākhyānāya cetanācetanasya cetyuktam /
vyāsa-(22)


*7,145*

kiñca parimāṇāditi hetustāvadanaikāntikaḥ /
sattvarajastamasāṃ sāmyāvasthā hi prakṛtirucyate /
sattvādayaśca parimitā eva /
yathoktam /
abagnīranabho 'haṅkṛnmahattattvaguṇatrayaiḥ /
kramāddaśottaraiḥ'; (ādi pu.veṃ.māhā.2-46) iti /
naca prakṛtiravyaktāntaravatīti kathaṃ nānaikāntyam /
naca parimitasyāpi mūlaprakṛtitve bādhakamasti /
sārvatrikakāryānutpattiparimitānāmeva kāraṇatvam /
tantvādiṣu darśanāt /
aparimitasya kṛtsnaikadeśavikalpānupapatteśca /
asmākaṃ tvīśvaraśaktyaivopapadyate /

samanvayādityapyasat /
yatkāryaṃ yadanugatimattattādṛkkāraṇopetamityasyā vyāpteravyaktādvayaktajanmāṅgīkāreṇaiva bhagnatvāt /
śaktitaḥ pravṛtteścetyetadapi na vivakṣitārthasādhakam /
antarbhāvitakāryatvameva kāraṇasya śaktirityasya siddhau hi tathā syāt /
tacca satkāryavādanirvāhyamiti /
ata eva vibhāgāvibhāgāvapi nirastau /
vibhāgāvibhāgayoreva satkāryavādasiddhayadhīnayorasattvāt /
svaprakriyāmātreṇārthasiddhau"sthūlakāyarsya loṣṭhādeḥ'; ityādinā tārkikaparikalpitābhyāṃ vibhāgāvibhāgābhyāṃ paramāṇukāraṇatvamapi syādityāstāṃ prapañcaḥ /


*7,151f.*

nanvidaṃ ghaṭṭakuṭṭīprabhātanyāyamanusarati /
icchāvattvamātmana eva na tu jaḍasyetyatra hi prathamamanubhavaḥ pramāṇīkṛtaḥ /
tatra ca śrutivirodhe codite 'ntaḥkaraṇadharma ātmadharmaśceti kāmasya dvaividhyānna virodha ityuktam /
evañcātmana evecchāvattvaṃ na tvacetanasyeti tyaktamevetyāśaṅkāṃ siṃhāvalokananyāyena pariharati- dvaividhye 'pīti //


*7,152*

dvaividhye 'pitu kāmādeḥ kutaḥ svāmitvamātmanaḥ // MAnuv_2,2.24cd //
sākṣādanubhavārūḍhaṃ śakyate 'podituṃ kvacit // MAnuv_2,2.25ab //


NYĀYASUDHĀ:
kāmāderdvaividhye 'pi sākṣādanubhavārūḍhamātmanaḥ kāmādeḥ svāmitvaṃ tu kutaḥ pramāṇādapodituṃ śakyate na kuto 'pīti yojanā /
śrutyapekṣayā'dipadagrahaṇam /
apoditumiti samprasāraṇaṃ chāndasam /
ayamatrottarakramaḥ /
satyaṃ kāmo dvividha ātmadharmo manovṛttiśceti /
tatra manovṛttimapi kāmaṃ pratyātmana eva svāmitvaṃ na manasaḥ /
ahaṃ kāmaya iti sākṣyanubhavasiddhatvāt /
manasastu kāmaṃ pratyupādānatvameva /
yathā hi /
kṣetropādānakānāmapi sasyānāṃ kṛṣīvala eva svāmī na kṣetraṃ tathaiva /
naca vācyaṃ manasa eva kāmasvāmitvamahaṃ kāmaya ityanubhavastu bhrāntirvyavahāramātraṃ veti /
bādhakapramāṇābhāvāt /
naca kauṭasthyaṃ bādhakam /
antaḥkaraṇasyaiva kāmopādānatvenāṅgīkṛtatvāt /
svāmitvamātreṇa ca kauṭasthyāvighātāt /
anyathā kṛpaṇadhanasyevātmano vaiyarthyāpatteriti /
tadidamuktaṃ kvaciditi /


*7,155*

nanvastu kāmasvāmitvamātmana eva mā bhūcca manasaḥ /
tathāpi pūrvottaravirodhastadavastha eva /
icchāsvāmitvābhāve 'pi yādṛśatādṛśasyecchāvattvasya manasyaṅgīkṛtattvādityata āha- iccheti //

icchāsvāmitvamevoktamicchāvattvaṃ nacāparam // MAnuv_2,2.25cd //

NYĀYASUDHĀ:
acetanecchāpagatetyādāvicchāsvāmitvamevecchāvattvamuktam /
nacāparamicchopādānatvalakṣaṇam /
etaduktaṃ bhavati /
syādatra pūrvāparavirodhaḥ /
yadi yadevecchāvattvaṃ prāṅmanaso niṣiddhaṃ tadevātra punaraṅgīkriyeta /
na caitadasti /
pūrvaṃ hīcchāsvāmitvalakṣaṇamicchāvattvamātmana eva na tvacetanasyetyuktam /
tasyaiva kartṛtvopayogāt /
śrutyarthatayā tvicchopādānatvalakṣaṇamicchāvatvamidānīṃ manaso 'bhyupagamyata iti kuto virodha iti /


*7,156*

yadvā kāmasya dvaividhyena manaso 'pi kāmavattvātkartṛtvamupapatsyata ityata āha- dvaividhye 'pīti //
dvayoḥ kāmavattve 'pi kāmasvāmitvamātmana eva na tu manasaḥ /
nirapavādasākṣyanubhavasiddhatvāt /
manasastu kāmopādānatvameveti /
tataḥ kimityata āha- iccheti //
icchāsvāmitvalakṣaṇamevecchāvattvaṃ prāk kartṛtvopayuktamuktam /
na punaricchopādānatvalakṣaṇam /
yo hīcchati sa prayatate na tu yadicchā bhavati taditi /
tasmādicchāsvāmitvāccetanasyaiva kartṛtvaṃ nācetanasya /
tasyecchopādānatve 'pīcchāsvāmitvābhāvāditi /


*7,157*

syādetat /
svaṃ nāma tadbhavati, yadyatheṣyaviniyogayogyam /
yathā gavādi /
svāmī ca sa ucyate yo yatheṣyaviniyoktā /
nacecchātmanoretadasti /
yasmādāstikakāmukasya niṣiddhecchāṃ niyacchato 'pi (icchā)sā'virbhavati /
prayatamānasyāpi vihitecchā nodeti /
tatkathamicchāsvāmitvamātmanaḥ syāditi cet /
kimicchā'tmanaḥ sarvathāpi vaśā na bhavati ityucyate /
uta kiñcidvaśatvamaṅgīkriyate /
nādyaḥ /
anubhavavirodhāt /
icchati devadatta ityādivyavahāravirahaprasaṅgācca /
dvitīye tu siddhaṃ svāmitvamityāha- kiñciditi //

kiñcit tadvaśagatve 'pi svāmitvaṃ lokavad bhavet // MAnuv_2,2.26ab //

NYĀYASUDHĀ:
prabalavirodhivaśādatyantavaśatvābhāve 'pīcchāyāḥ kiñcidātmavaśatvamātreṇāpi tāṃ pratyātmanaḥ svāmitvaṃ bhavede(vatye)va /
katham /
yathātyantamavaśāyāmapi gavi kiñcidvaśatvamātreṇa devadattasvāmitvaṃ loke dṛṣṭaṃ tathaiva /
anyathā tadapi na syāditi /


*7,158*

nanvevaṃ satyekaṃ sandhi(di)tsato (paraṃ pracya)nyaccyavata ityāpannam /
acetanasya kartṛtvaṃ nirākartumātmana evecchāsvāmitvaṃ natu manasa iti samarthitam /
tarhīśvarasyāpi kulālādimanovṛttīcchāṃ prati svāmitvaṃ nāstīti ghaṭādikartṛtvaṃ na syāt /
tathācetaravyapadeśādityadhikaraṇavirodhaityata āha- sarvātmeti //

sarvātmatantrakāmādeḥ kimutaiva pareśituḥ // MAnuv_2,2.26cd //

NYĀYASUDHĀ:
yadā jīvasyāpi kāmādisvāmyaṃ tadā sarvātmanā tantramadhīnaṃ kāmādi yasyāsau tathoktaḥ /
sarveṣāmātmanāṃ tantraṃ sādhanaṃ yaḥ kāmastasyādiḥ kāraṇaṃ tasya pareśituḥ kāmasvāmitvaṃ kimutaiva vaktavyam /
etaduktaṃ bhavati /
jīveśvarau dvāvapi śarīramadhitiṣṭhataḥ /
tatreśvaro 'ntaḥkaraṇaṃ spaṣṭaṃ dṛṣṭvā tatra jñānecchāprayatnarūpā vṛttīḥ svecchājñānaprayatnairutpādya bāhyakaraṇāni cādhiṣṭhāya ghaṭādyutpādayati /
jīvastu taddattasvāmyo 'vatiṣṭhate /
yathoktaṃ"baddhirjñānam'; ityādi /
tasmādīśvarasyaiva mukhyaṃ svāmyaṃ kartṛtvaṃ ca /
jīvasya tvamukhyameveti /
tathā coktam"svasvāmibhāvo dhruva eṣa yatra tarhyacyute 'sāviti kṛtyayoge'; iti /


*7,161*

yaduktaṃ nirapavādānubhavabalādātmana evecchāsvāmitvamiti /
tadayuktam /
kāmaḥ saṅkalpa iti manasaḥ kāmasvāmitvābhidhātryāpauruṣeyatvena balavatyā vedavācaivāpoditatvādityata āha- naceti //

na cānubhavagaṃ kāmasvāmitvaṃ vedavāgapi /
śaktāpavadituṃ ... // MAnuv_2,2.27a-c //



*7,161f.*

NYĀYASUDHĀ:
kāmasvāmitvamātmana iti śeṣaḥ /
kāmādyanuvādena khalviyaṃ vedavāk ātmopādānatvaṃ vaiśeṣikādimataprāptaṃ vārayituṃ teṣāṃ manorūpatvamācaṣṭe /
kāmādisvarūpaṃ ca sākṣyanubhavenaiva siddhamiti tasyopajīvyatvam /
sa ca tānātmasvāmikāneva viṣayīkaroti /
nacopajīvyakamupajīvyamapavadituṃ śaknoti /
vedasyotsargato balavattve 'pyupajīvyāpekṣayā daurbalyameva /
yathā āhuḥ /
"prābalyamāgamasyaiva jātyā teṣu triṣu smṛtam /
upajīvyavirodhe tu na prāmāṇyamamuṣya ca'; iti /
ato na śruteranubhavāpavādakatvaṃ yuktamiti /

tarhi śruteḥ kā gatirityata āha- tasmāditi /

... tasmāt sā tadanyābhidhāyinī // MAnuv_2,2.27cd //

NYĀYASUDHĀ:
upajīvyatvena balavatānubhavena bādhitatvādityarthaḥ /
tadanyābhidhāyinī svāmitvādanyasyopādānatvasyābhidhāyinī /


*7,164*

na kevalamupajīvyabādhāt /
kintūpapattivirodhāccetyāha- mokṣakāma iti //

mokṣakāmo bhavedanyo yadi muktād bhaviṣyataḥ // MAnuv_2,2.28ab //

NYĀYASUDHĀ:
yadi kāmo 'ntaḥkaraṇakartṛkaḥ syāttadā mokṣakāmo 'pyantaḥkaraṇasyaiva syāt /
mokṣastu ātmana iti ca prasiddham /
tathāca yo mukto bhaviṣyati tasmādanya eva mokṣakāma itayuktaṃ syāt /
kāmasyānyagatatve sādhanānuṣṭhātāpyanya evetyaṅgīkartavyam /
phalakāmanāsādhanānuṣṭhānayorekaniṣṭhatvadṛṣṭeḥ /
tathācākṛtābhyāgamakṛtavipraṇaśaprasaṅgaḥ /


*7,166*

nanu nāyaṃ doṣaḥ /
puruṣavimokṣārthaṃ prakṛtipravṛttyabhyupagamāt /
dṛśyate hi paraprayojanārthaṃ janānāṃ pravṛttiriti /
atredamupatiṣṭhate- mokṣakāmasyeti //

mokṣakāmasya kiṃ tena ... // MAnuv_2,2.28c //

NYĀYASUDHĀ:
upalakṣaṇametat /
sādhanānuṣṭhātetyapi draṣṭavyam /
paraprayojanārtaṃ pravatarmānāḥ khalu loke dṛṣṭamadṛṣṭaṃ vā kimapi prayojanamanusandadhānāḥ prāyeṇopalabdhāḥ /
tathātrāpi prakṛteḥ prayojanena bhāvyam /
naca tadastītyarthaḥ /

syādetat /
svaprayojanamananusandhāyaiva jīvamokṣārthaṃ prakṛteḥ pravṛttiḥ, yatā kṛpālutvena bhavatāmīśvarasyetyata āha- svanāśārthaṃ ceti //

... svanāśārthaṃ ca ko yatet // MAnuv_2,2.28d //


*7,167*

NYĀYASUDHĀ:
na kevalaṃ paraprayojanārthā prakṛteḥ pravṛttiryujyate /
prakṛtilayo hi mokṣo nāma /
na hi ko 'pi kṛpālurātmanāśārthaṃ yatamāno dṛṣṭa iti /
yadyapyatrānādheyātiśayasya niṣkriyasyopakāryatvamapi kvacinna dṛṣṭamityeva vaktavyam /
tathāpi tacchiṣyairevohyatāmiti tadabhyupagamena dūṣaṇāntaramidamuktam /


*7,168*

nanvidamayuktam /
cetano hi svaprayojanamanusandadhyāt /
svanāśācca bibhyat parāvarteta /
prakṛtistvacetanā kathamevaṃ paryanuyogamarhatīti /
evaṃ tarhi kathamātmamokṣamapyanusandhāya pravarteta /
svabhāvo 'yaṃ pradhānasyeti cet /
tarhi kadāpi saṃsāro 'sya na syāt /
bhogārthā pravṛttiḥ prakṛteḥ svabhāva iti cet /
tarhi mokṣābhāvaḥ /

ubhayasvabhāvatve tūbhayaṃ na syāt /
virodhāt /
avirodhe vā yugapadubhayaṃ syāt /
vyavasthāpakābhāvāt /
bhogeṣūpabhukteṣu mokṣārtheti cenna /

bhogānāmānantyenāparisamāpteriti /

ayaṃ prasaṅgātharḥ /
yadyātmā na kāmakartā syāttadā mumukṣurapi na syāt /
tataśca na tadarthaṃ prayateta /
tathāca na mucyeta /

parapravṛtteḥ svaprayojanabhāvābhāvayorayuktatvāditi /
bahulametannidarśanamiti smaraṇādyatediti parasmaipadam /
tathācāha"candrādayastu manyante sarvasmādubhayaṃ padam'; iti /


*7,171*

evamanīśvarasāṅkhayamataṃ sādhāraṇadūṣaṇairapākṛtya ye kartṛtvaṃ prakṛtereva bhoktṛtvaṃ tvātmana iti manyante tanmataṃ dūṣayati- kartṛtvamiti //

kartṛtvaṃ yasya tasyaiva bhoktṛtvamupalabhyate // MAnuv_2,2.29ab //

NYĀYASUDHĀ:
yadvaivamātmanaḥ kartṛtvamupapādya bhoktṛtvamapyanenaivopapādayati /
yena mayedaṃ kṛtaṃ sa evāhaṃ tatphalaṃ bhuñja iti kartṛtvabhoktṛtvayoḥ sāmānādhikaraṇyānubhavāttayadvaiyadhikaraṇyāṅgīkāre 'nubhavavirodha ityarthaḥ /

bhrānto 'yamanubhava iti cenna /
bādhakābhāvādityāha- vibhāge ceti //

vibhāge ca tayormānaṃ naiva kiñcit kvacid bhavet // MAnuv_2,2.29cd //

NYĀYASUDHĀ:
tayoḥ kartṛtvabhoktṛtvayoḥ /
vibhāge vyadhikaraṇatve /
akṛtābhyāgamakṛta- vināśau caivaṃ sati syātāmiti /


*7,172*

yaduktamātmano mokṣo na syāditi /
tadiṣyāpādanam /
prakṛtereva mokṣābhyupagamāt /
naca bandhamokṣayorvaiyadhikaraṇyānupapattiḥ /
bandhasyāpi prakṛtigatatvāditi cenna /
sakalaśrutismṛtīhāsapurāṇānubhavairbandhamokṣayerātmagatatvāvagamena tadvirodhādityāśayavānupasaṃharati- sarveti //

sarvamānavirodhaikadurdīkṣādīkṣitastvayam /
māyāvādyupamāṃ yāyāt ... // MAnuv_2,2.30 //


NYĀYASUDHĀ:
sarvamānavirodha eva yā pradhānadurdīkṣā duṣyo 'nuṣṭhānasaṅkalpaḥ /
tayā dīkṣito 'yaṃ tu sāṅkhayo māyāvādināmupamātvaṃ prāpnuyāt /
te 'pi hi kartṛtvabhoktṛtvādisakaladharmavikalamasatkalpaṃ caitanyamātramaṅgīkṛtyāvidyāyā evācetanāyāḥ sarvakāraṇatvaṃ bandhamokṣādhikaraṇatvaṃ cābhyupagacchanti /
tadeteṣāṃ sarvapramāṇaviruddhārthāṅgīkāritve sāṅkhayo 'yaṃ dṛṣṭāntabhāvamāpadyata iti /


*7,174*

yatpuruṣabahutvaṃ sāṅkhayenāṅgīkṛtaṃ tadapi māyāvādibhirabhyupagatameva /
jananādiprakṛtidharmaireva hi tadbahutvam /
natu svarūpe kaścidasti parasparato viśeṣaḥ /
māyāvādino 'pi upādhinibandhanaṃ bhedamaṅgīkurvantyeva /
naca prapañcasatyatvaṃ viśeṣaḥ /
kāraṇamātratvābhyupagamena kāyarprapañcasya sāṅkhayena nirastatvāditi /


*7,177*

yāpi sāṅkhayaparikalpitā sṛṣṭipralayabandhamokṣatatsādhanaprakriyā sāpi sarvapramāṇaviruddhetyuktaṃ bhavati /


*7,178*

na kevalaṃ sāṅkhayasya māyāvādisadṛśatvamasmābhirevocyate, kintu sūtrakṛtāpi sūcitamityāha- taditi //

... taccaśabdānnirākṛtaḥ // MAnuv_2,2.30d //

NYĀYASUDHĀ:
tasmānmāyāvādisadṛśatvādeva hi sāṅkhayo bhoktrāpatteravibhāgaścetsyāllokavaditi prāk parākṛtena māyāvādinā racanānupapatteśca nānumānamiti caśabdena samuccitya nirākṛtaḥ /
yadvā pramāṇavirodho 'pi notsūtrita ityanenāha /
tasmātsarvamānavirodhitvādeva /
caśabdātsarvamānavirodhasamuccayārthaṃ caśabdaṃ prakṣipyetyarthaḥ /

// iti śrīmannyāyasudhāyāṃ racanānupapattyadhikaraṇam //




___________________________________________________________________________


*7,180*


[======= JNys_2,2.II: anyatrābhāvādhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ anyatrābhāvādhikaraṇam //

anyatrābhāvāc ca na tṛṇādivat | BBs_2,2.5 |

// oṃ anyatrābhāvācca na tṛṇādivat oṃ //
idaṃ sūtraṃ keciditthaṃ vyācakṣate /
yathā tṛṇapallavādikaṃ gavādinopabhuktaṃ svayameva kṣīrībhavati /
evaṃ pradhānaṃ svayameva mahadādirūpeṇa pariṇamata ityāśaṅkā kilātra nirasyate /
na tṛṇādivatsvayameva pradhānasya pariṇāmo vaktavyaḥ /
yatastṛṇādīnāmapi svayameva pariṇāmo nāsti /
kutaḥ /
anyatrānaḍuhopabhukte tadabhāvāditi /
atrāśaṅkaiva tāvadanupapannā /
payo 'mbuvaccettatrāpītyanenaiva parihṛtatvāt /
pratyudāharaṇaṃ ca sūtrapraṇayanāyogāt /
parihāro 'pyayamanupapannaḥ /
gavādyupabhuktasyaiva kṣīratvaṃ nānyatreti hi vadatā prakṛteḥ sahakārisadbhāvamātramupapāditaṃ syāt /
na punarīśvarāpekṣatvam /
ato nāyaṃ sūtrārthaḥ /
kintu pātañjalamatamatrādhikaraṇe nirākriyata ityāśayavāṃstadupanyasyati- sāṅkhayānāmiti //

sāṅkhayastu seśvaro brūte kṣetrānugrahaśaktimān /
astīśvaraḥ svayambhātaḥ kleśakarmādivarjitaḥ // MAnuv_2,2.31 //


NYĀYASUDHĀ:
sāṅkhayamatasya nirastatvātkiṃ punarupanyāsenetyato 'sya matasya tato viśeṣaṃ tuśabdena sūcayati /
tameva viśeṣaṃ vyanakti- seśvara iti //
seśvaraścenna nirākāryo virodhābhāvādityata uktam- kṣetreti //
tuśabdo 'vadhāraṇārtho 'trāpyanvīyate /
yadyapi seśvara ityanenaiveśvaro 'stīti brūta iti siddham /
tathāpi tadanuvādena viśeṣaṇavidhānamevaitat /
ya īśvaro 'sti sa kṣetrānugrahaśaktimāneveti brūta iti /

kṣiyantyasminkāryāṇyavyaktatayeti kṣetramupādānaṃ prakṛtiḥ /
tadanugrahaśaktireveśvarasya tenābhyupagamyate /
ato nirākaraṇīya evāsāviti /
sarvaśaktitvābhāve kiṃ tasyeśvaratvamityata uktam- svayambhāta iti //
svayamindriyādyanapekṣameva bhātaḥ /
kartari ktaḥ /
tataśca sarvajña iti labhyate /
īśvaratvopapādakaṃ viśeṣaṇāntaramāha- kleśeti //
kleśakarmavipākāśayavarjita ityarthaḥ /
tathācāha patañjaliḥ /
"kleśakarmavipākaśayairaparāmṛṣṭaḥ puruṣaviśeṣa īśvaraḥ'; iti /
tathā"nirmāṇakāyamadhiṣṭhāya sampradāyapravartako 'nugrāhakaśca'; iti /
tatrāvidyāsmitārāgadveṣābhiniveśāḥ pañca kleśāḥ /

anātmanyātmabuddhiravidyā /
idaṃ madīyamityabhimāno 'smitā /
viṣayeṣvāsaktī rāgaḥ /
kopo dveṣaḥ /
bhayamabhiniveśaḥ /
eta eva pañca kleśāstantrāntare tamo moho mahāmohāḥ tāmisro 'ndhatāmisra iti vyavahriyante /
vārṣagaṇyastvenānavidyetyevāha /
karmeti

vidhiniṣedhāvucyete /
āśayaśabdena dharmādharmau /
vipāka iti tatphalaṃ sukhaduḥkhe tadupāyaśceti /
itiśabdasya āgāminaḥ prativākyaṃ sambandhaḥ /


*7,185*

vedavādavirodhaṃ sphuṭīkartumavadhāraṇavyāvartyamāha- kṣetreti //

kṣetraśaktimatī saiva prakṛtir ... // MAnuv_2,2.32ab //

NYĀYASUDHĀ:
yā jagadupādānaṃ sā prakṛtirevopādānatvaśaktimatī brūte /
na punarvedavādina iva tāmapi śaktimīśvarāyattām /
vyāvartyāntaramāha- bījeti //

... bījaśaktimān /
jīvaḥ parjanyavad ... // MAnuv_2,2.32bc //


NYĀYASUDHĀ:
atrāpyeveti sambaddhayate /
śarīrendriyādisambandhenotpattau yā śaktiḥ sā bījaśaktiḥ /
jīva eva tadvāniti brūte /
natu tadīyāṃ bījaśaktiṃ tattva(vādina)vida iva bhagavadadhīnām /
yadyupādānatvotpattiśaktimattvaṃ prakṛtipuruṣayoreva tadā kimīśvareṇānugrāhakeṇetyata āha- parjanyavaditi //
yathā hi pṛthivyāḥ kalamādibījānāṃ copādānatvabījatvaśaktī yadyapi svāyatte /
tathāpyaṅkurotpattau parjanyasyāsti pṛthivyanu(grahakāraka)grāhakatvam /
tathā prakṛtipuruṣayoḥ svāyattaśaktitve 'pīśvaraḥ prakṛtyanugrahaśaktimānaṅgīkaraṇīyaḥ /

tatkiṃ parjanyavadanvayavyatirekābhyāmīśvarasya prakṛtyanugrāhakatvamavaseyaṃ netyāha- daiveti //

... daivaśaktimānīśvaraḥ smṛtaḥ // MAnuv_2,2.32cd //

NYĀYASUDHĀ:
daivaśabdo 'dṛṣṭasvarūpatvamāha /
tenānvayavyatirekāviṣayatvaṃ lakṣayati /
tatkiṃ niṣpramāṇaka eveśvaraḥ prakṛtyanugrāhako 'ṅgīkaraṇīya ityata uktam- smṛta iti //
"māyādhyakṣeṇa prakṛtiḥ sūyate sacarācaram'; ityādāviti śeṣaḥ /
smṛta ityupalakṣaṇam /
śruta ityapi grāhyam /

prakṛtipuruṣayoḥ svāyattaśaktitvaṃ kuta ityata āha- pṛthivīvaditi //


*7,186*

pṛthivīvat pradhānaṃ taj ... // MAnuv_2,2.33a //

NYĀYASUDHĀ:
yathā pṛthivyāḥ svāyattopādanatvaśaktiḥ tathā tat tasmādupādānatvātpradhānamapi svāyattopādānatvaśaktimadanumeyamityarthaḥ /
upalakṣaṇaṃ caitat /
kalamādibījavadbījatvājjīvo 'pi svāyattabījaśaktimānanumātavya ityapi draṣṭavyam /


*7,187*

nanu yathā loke kalamādibījānāṃ kaścidāvapanakartāsti /
tathātrāpi tatsthānīyena kenāpi bhāvyam /
nacāsāvanyo 'sti parameśvarāt /
tatkathaṃ kṣetrānugrahaśaktimāneveśvara ityata āha- jīva iti //

... jīvaḥ sannidhimātrataḥ /
bījāvapanakartevety ... // MAnuv_2,2.33bc //

NYĀYASUDHĀ:
dṛśyate khalvapatyajīvo bījabhūtaḥ /
pitṛjīvaścāvapanakartṛsthānīyaḥ /
tasmātkimīśvarasya tacchaktikalpanayā /
viṣayotpattau tu tadapekṣaiva nāstīti bhāvaḥ /
nanvevaṃ pitṛjīvasyāpatyotpādakatvāṅgīkāre 'pasiddhāntaḥ syāt /
sāṅkhayairjīvasya kartṛtvānabhyupagamādityata uktam- sannidhimātrata iti //
śarīrādirūpā prakṛtirevāpatyo(tpatti)tpādakatrī /
tatsannidhinimittādvivekāgrahājjīve tatkartṛtvavyavahāra eveti brūta iti /


*7,188*

evamupyastamatanirāsārthaṃ sūtramavatārayati- atreti //

... atra prāha prabhuḥ svayam // MAnuv_2,2.33d //

NYĀYASUDHĀ:
atraitanmataviṣaye dūṣaṇaṃ prāhetyatharḥ /
svayaṃ sākṣānnopacāreṇa /
prabhuriti sūtrakṛto dūṣaṇasāmarthyamācaṣṭe /
sūtraṃ vyācaṣṭe- anyatreti //

anyatra kāpi śaktirna svātantryeṇ[a] ... // MAnuv_2,2.34ab //

NYĀYASUDHĀ:
anyatra prakṛtau puruṣe /
tathā pṛthivyāṃ kalamādibīje ca /
kāpīti kṣetraśaktirbījaśaktirbījāvapanaśaktiścetyarthaḥ /
kathaṃ tarhyupādānatvādikamityata uktam- svātantryeṇeti //
kuto nāstītyata āha- īśeti //

... [ī]śa eva hi /
śaktīstāḥ prerayatyañjas ... // MAnuv_2,2.34bc //


NYĀYASUDHĀ:
yasmādīśa eva tāḥ pradhānādiśaktīḥ prerayatīti śrutyādiprasiddham /
tasmādanyatra kāpi śaktiḥ svātantryeṇa nāstīti /
naca pradhānādivadīśvarasyāpi preraṇāśaktiḥ parāyattetyuktam- añja iti //
kriyāviśeṣaṇametat /

*7,189*

tadanena parakīyānumānasya bādhitaviṣayatvaṃ dṛṣṭāntasya ca sādhyavikalatvamuktaṃ bhavati /


*7,190*

na kevalaṃ prakṛtipuruṣayoḥ svātantryeṇa śaktyabhāvaḥ parameśvarāyattaśaktitvaṃ ca /
kiṃ tarhītyataścaśabdasamuccitamarthamāha- tadadhīnāśceti //

... tadadhīnāśca sarvadā // MAnuv_2,2.34d //
sattāpradhānapuruṣaśaktīnāṃ ca pratītayaḥ /
pravṛttayaśca tāḥ sarvā ... // MAnuv_2,2.35a-c //



*7,191*

NYĀYASUDHĀ:
ādyaścaśabdaḥ śaktiprerakatvasya sattādipradatvena saha samuccayārthaḥ /
uttarāvanyonyasamuccaye /
pradhānapuruṣayostadīyānāṃ śaktīnāṃ ca, sattā svarūpaṃ, pratītayaśca pramāviṣayatvaṃ ceti yāvat, tāstāḥ sarvāḥ pravṛttayaśca sarvadā tadadhīnā iti yojanā /
kecinmanyante svarūpameva vastunaḥ sattvamiti, apare tu pramāṇayogyatvam, anye punararthakriyāvattvam /
tadidaṃ trayamapi prakṛtyādīnāṃ bhagavadadhīnameveti /


*7,192*

nanvetadayuktam /
pradhānādisattādenirtyatvāt /
nityasya parādhīnatāsambhavādityata āha- nityamiti //

nityaṃ nityātmanā yataḥ // MAnuv_2,2.35d //
yathā nityatayā nityaṃ nityaśaktayā svayeśvaraḥ /
niyāmayati nityaṃ ca ... // MAnuv_2,2.36a-c //


NYĀYASUDHĀ:
yathānityaṃ ghaṭādikamanityatayā niyamyate, tathā nityamapi nityātmanā nityaṃ ca sarvadaiveśvaro niyāmayati /
yata evaṃ tasmāduktamupapannamiti yojanā /


*7,192f.*

etaduktaṃ bhavati /
yathā hi ghaṭādayo 'nitya(ttva)svabhāvā api nākasmādanityā bhavanti /
ko doṣaḥ /
na cānityatā parādhīneti kadācidghaṭādenirtyatā prāptā /
vināśakāraṇopanipātaghrauvyāt /
tathā nityasya nityatāyāḥ parādhīnatve 'trapa na jātvanityatāprasaktiḥ /
tanniyamananiyamāditi /
tadidamuktam- nityaṃ ceti //
na caitadalaukikam /
nityakarmabhirduritaprāgabhāvānuvṛtteḥ sādhyatvena vādibhirabhyupagatatvāt /
anuvṛtternityatāpādanānatirekāt /
bhavedetade(vama)svarasanityasya /
na svarasanityasyeti cenna /
īśvarātiriktasya tadbhāvāsammateḥ /
iyāṃstu viśeṣaḥ /
kiñcidasmadāyattanityatvam /
kiñcicceśvarāyattanityatvamiti /
tadapyasmāsu kasmānnāyatate tathābhūtaṃ ca kathamīśvarādhīnamityata uktam- nityaśaktyeti //
pradhānādiśakteḥ prakṛtatvāt tadgrahaṇamidamiti mandāśaṅkāṃ vārayituṃ svayetyuktam /


*7,195*

yaduktaṃ pradhānāderupādānatvādiśaktirna svādhīnā kintvīśvarapreritaiveti /
tatkuta ityata āha- neti //


"na ṛte tvatkriyate kiñcanāre'; iti śruteḥ /
prāguktaṃ pratipattavyamiti śeṣaḥ /
śaktireva hi kriyocyate /

yatpradhānādisattāderbhagavadadhīnatvamuktaṃ tasya sambhāvanaivoktā /
pramāṇaṃ tu tatra kimityata āha- svabhāveti //

svabhāvajīvakarmāṇi dravyaṃ kālaḥ śrutiḥ kriyāḥ /
yatprasādādime santi na santi yadupekṣayā // MAnuv_2,2.37 //
iti śruterna sattādyā api nārāyaṇaṃ vinā // MAnuv_2,2.38ab //


NYĀYASUDHĀ:
karmaśabdena dharmādhamarvyaktayo gṛhyante /
kriyāḥ parispandāḥ /
śrutiḥ vedaḥ /
santīti trividhamapi sattvaṃ vivakṣitam /
sattādyāḥ pradhānādeḥ /
nārāyaṇaṃ vinā tatpreraṇāṃ vinā /


*7,197*

tasmādanyatropādānatvādiśakterabhāvāt, tatsattāderapīśvarāyattatvācca, na, tṛṇādīnāmutpattau parjanyasyeva pṛthivyanugrāhakatvaṃ, īśvarasya mahadādyutpattau kṣetrānugrāhakatvamātram, kintu sarvasvātantryameva, iti, yadanyadabhyupagataṃ pātañjalairvaidikamataviruddhaṃ, tatsarvaṃ prathamādhikaraṇa eva nirastam /
kiṃ punaḥ prayatnenetyāśayavānpūvarmatena sahaitasya hetāmupasaṃharati- taditi //

tatpatañjalivindhyādimataṃ na puruṣārthadam // MAnuv_2,2.38cd //

NYĀYASUDHĀ:
vindhyo 'nīśvaraḥ sāṅkhayaḥ /
ādipadena tadekadeśināṃ pañcaśikheśvarakṛṣṇādīnāṃ grahaṇam /
tadavāntaramatayorapi nirastatvāt /
yadvā patañjalivindhyāvādī yasya tattathoktam /
patañjalināṅgīkṛto 'pīśvaro anī(nirī)śvarakalpa eva /
ataḥ pūrvasyāsya ca sāmyābhiprāyeṇa vā sahopasaṃhāra iti /

// iti śrīmannyāyasudhāyāṃ anyatrābhāvādhikaraṇam //



___________________________________________________________________________


*7,199*


[======= JNys_2,2.III: abhupagamādhikaraṇa =======]



// atha śrīmannyāyasudhāyāṃ abhyupagamādhikaraṇam //


abhyupagame 'py arthābhāvāt | BBs_2,2.6 |


// oṃ abhyupagame 'pyarthābhāvāt oṃ //
kecididaṃ satramevaṃ vyācakṣate /
prāk pradhānasya pravṛttirnopapadyata ityuktam /
athedānīṃ pravṛtterabhyupagame 'pi tasyāḥ prayejanābhāvāditi /
tadayuktam /
abhyupagame 'pītyetāvato vaiyarthyāt /
arthābhāvāccetyetāvataiva pūrṇatvāt /
kiñca arthābhāvena kiṃ sādhyam /
sāṅkhayamatasyāsāmañjasyaṃ vā prakṛteḥ pravṛttyanupapattirvā /
nādyaḥ /
vyadhikaraṇatvāt /
kathañcidekādhikaraṇatāpādane 'pi svamatenānaikāntyāt /
na dvitīyaḥ /
abhyupagama(vāda)virodhāt /
na hyabhyupagamavāde 'pi yadevābhyupagamyate tadeva nirākriyate /
anāsthāṃ khalu tātkālikīmabhyupagamena dyotayanti /
yathāstu śabdo nityo 'nityo vā, anuśāsanaṃ tāvatkartavyamiti /
tasmānnāyaṃ sūtrārthaḥ /


*7,203*

kinnāma mā bhūdacetanasya kartṛtvaṃ, śarīrasyaiva cetanāvattvena kartṛtvopapatteḥ /
kimīśvarādinetyadhikāśaṅkayā pratyavatiṣṭhamānasya cārvākasya matamatrādhikaraṇe nirasyata iti bhāvena tanmatamupanyasyati- cārvākairiti //

cārvākairucyate mānamakṣajaṃ nāparaṃ kvacit // MAnuv_2,2.39ab //

NYĀYASUDHĀ:
cārvī buddhistatsambandhādācāryo 'pi cārvī /
tasyeme chātrāścārvākāḥ /
tairakṣajaṃ mānamucyate /
nanvetadasmākamapi sammatamityataḥ sāvadhāraṇamidamuktamityāśayenoktaṃ vivṛṇoti- nāparamiti //
anumānamāgamaśca mānaṃ nocyata ityarthaḥ /
etadapyasmākamanumatameva /
prameyaviśeṣe pratyakṣasyaiva mānatābhyupagamādityata āha- kvaciditi //

etaduktaṃ bhavati /
pramāṇādhīnā hi prameyasiddhiḥ /
pramāṇaṃ ca pratyakṣameva /
nāto 'nyadasti /
naca pratyakṣeṇeśvaraṃ pratīmaḥ /
tasmātpramāṇābhāvānnāstīśvara iti /

nanu yadi pratyakṣātiriktaṃ na pramāṇaṃ tadā dharmamokṣayostatsādhanānāṃ ca pratyakṣāviṣayāṇāmasiddhiḥ syādityata āha- deha iti //

deha ātmā pumarthaśca kāmārthābhyāṃ vinā nahi // MAnuv_2,2.39cd //

NYĀYASUDHĀ:
jñānavānkhalvātmanā /
jñānaṃ ca dehadharmaḥ /
yathoktam-"pṛthivyāpastejovāyuriti tattvāni /
tatsamudāye śarīrendriyaviṣayasaṃjñā /
tebhyaścaitanyaṃ madaśaktivadvijñānam'; iti /
tasmāddeha evātmā /
sa ca vināśītyataḥ kālāntarabhāvinaḥ puṃsa evābhāvāddharmamokṣākhyapuruṣārthābhāvo nāniṣyaḥ /
puruṣārthau tu kāmārthāveva /
puruṣānvayasambhavāditi /
tatrāpi kāma eva mukhyo 'rthastu tatsādhanatayaiva pumartha iti jñāpayituṃ kāmasyādau saṅkīrtanam /
iti cocyata iti sambandhaḥ /


*7,208*

etanmatanirāsārthaṃ sūtraṃ vyākhyātumupodghātaṃ tāvadāha- yadevamiti //

yadevaṃ ... // MAnuv_2,2.40a //

NYĀYASUDHĀ:
yadyevamatīndriyaṃ vastu na syāt tadā tadīyaṃ śāstraṃ viṣayaprayojanaśūnyamāpadyeteti śeṣaḥ /
tatkathamiti cet /
kimanena śāstreṇa tatpraṇetā viṣayaṃ pratipadyate prayojanaṃ ca labhate /
uta vineyā narāḥ /

ādyaṃ dūṣayati- darśaneneti //

... darśanenāsya ko 'rthaḥ pratyakṣagocaraḥ /
labdhastenaiva hi ... // MAnuv_2,2.40a-c //


NYĀYASUDHĀ:
kimākṣepe /
artho viṣayaḥ prayojanaṃ ca /
labdha upalabdhaḥ prāptaśca /
pratyakṣagocaro hīti /
tatra hetuḥ /
tataścāyamarthaḥ /
na tāvadanena śāstreṇa śāstrapraṇetrāstīndriyo 'rthaḥ upalabhyate /
tadabhāvāt /
nāpyaindriyakaḥ /
tasya pratyakṣagocaratvena viṣayatvānupapatteḥ /
"aprāpte hi śāstramarthavat'; /
kiñca pratyakṣeṇa tamarthamupalabhya khalvasau śāstre pravīṇavān /
anyathā (tatpra)praṇayanānupapatteḥ /
tathāca taṃ prati tamevārthamupadarśayatkathaṃ saviṣayaṃ syāt /
evaṃ prayojanamapi na tāvadatīndriyam /
tadabhāvāt /
nāpyaindriyakam /
tasya yogyānupala(bdhi)mbhabādhitatvāt /
nanu hitopadeṣyari jano 'nurajyate /
"janānurāgaprabhavāśca sampadaḥ'; iti cet /
kṛtaghnatānimittapratyavāyānusandhāne satyevametat /
tattu pareṇa tyājitamiti /
dvitīyaṃ dūṣayati- narairiti //

... naraiḥ śāstrāt kiṃ mohanaṃ vinā // MAnuv_2,2.40cd //
NYĀYASUDHĀ:
labdhamityanuvartate /
atrāpi pūrvavaduttaram /
syādetat /
dharmādyatīndriyābhimatārthābhāvaḥ śāstrasya viṣayaḥ /
tasya pratyakṣatve 'pi vaidikavāsanānimittaśaṅkākalaṅkitatvena viṣayatvamupapadyate /
prayojanaṃ ca dharmādharmaśaṅkoparuddhārthakāmopabhogaḥ /
tatkathaṃ naraiḥ śāstrātkiṃ labdhamityucyate /
maivam /
viṣayapratipattau hi prayojanāvāptiḥ /
viṣayaṃ ca kiṃ śāstramāptavākyatayā pratipādayet utopapattivyutpādanena /
nādyaḥ /
āgamaprāmāṇyābhyupagamaprasaṅgāt /
nāsti atīndriyaṃ kimapītyetāvataiva pūrṇatve(naiva)na vākyavistaravaiyarthyācca /
na dvitīyaḥ /
upapattiprāmāṇyābhyupagamaprasaṅgāt /
śāstraṃ śaṅkāmeva nivārayati /
viṣayapratipattistu pratyakṣeṇaiveti cenna /
svayaṃ vopapattivyutpādanena vā kamapyarthamanupadarśayataḥ śaṅkānivāraṇāsāmarthyāt /
śaṅkā hi saṃśayo vā syādviparyayo vā /
dvāvapi viparītārthagocarabalavatpratyayanirasanīyau /
nājñāmātreṇa /
tarkavyutpādanaṃ śāstreṇa kriyata iti cet(na) /
tasyāpi pramāṇatvāt /
tadidaṃ"darśanena'; iti prakṛtānuvṛttau satyāṃ"śāstrātkim'; itrata vadatā sūcitam /
anyathā naraiścetyavakṣyat /
mohanaṃ vinetyubhayavākyaśeṣaḥ parihāsaḥ /
śāstrapraṇetrā suraguruṇāyogyajanavyāmohanaṃ prayojanaṃ labdham /
anyaiśca mithyājñānam /
nāto 'dhikamiti /


*7,211*

kimato yadyevamityata āha- sveti //

svaparārthavihīnatvāt ... // MAnuv_2,2.41a //

NYĀYASUDHĀ:
niṣphalaṃ śāstramiti vakṣyamāṇaṃ siṃhāvalo(kananyāye)kitenānuvartate /
taccopalakṣaṇam /
nirviṣayaṃ cetyapi draṣṭavyam /
viṣayaprayojanavattvaṃ hi svaparaviṣayaprayojanavattayā vyāptam /
tṛtīyaprakārābhāvāt /
sarvaprakāraparityāgena sāmānyānavasthānāt /
tataśca vyāpikāyāḥ svaparaviṣayaprayojanavattāyā abhāvāttadvayāptaṃ viṣayaprayojanavattvamapi nāstītyarthaḥ /

astvevaṃ viṣayaprayojanaśūnyamasmadīyaṃ śāstram /
tataḥ kimityataḥ sūtraṃ vyākhyāti- svamatenaiveti //

... svamatenaiva niṣphalam /
kimityunmattavacchāstraṃ vṛthā pralapati svayam // MAnuv_2,2.41b-d //



*7,211f.*

NYĀYASUDHĀ:
yata evaṃ svamatenaiva niṣphalaṃ nirviṣayaṃ ca na kevalaṃ paropapādanameva /
tasmād vṛthā viṣayaprayojanaśūnyam /
yasmādvādinā cārvākeṇa prativādibhiśca taditaraiḥ sarvairviṣayaprayojanaśūnyatayābhyupagatam /
tasmādviṣayaprayojanaśūnya(meve)tyarthaḥ /
yasmādvṛthā tasmāttacchāstraṃ kimiti svayaṃ prekṣāvānpralapati /
prekṣāvatā nārambhaṇīyamiti yāvat /
viṣayaprayojanaśūnyaṃ cārabhamāṇo na laukiko nāpi parīkṣaka ityunmattavadupekṣaṇīyaḥ syāditi /
yadvā niṣphalamiti prayojanābhāvābhidhānam /
vṛtheti viṣayābhāvavacanam /
tathācaivaṃ sūtrayojanā /
na kevalaṃ paropapādanena kintu svābhyupagame 'pyarthābhāvādanārambhaṇīyaṃ śāstramiti śeṣa iti /
arthābhāvahetorasiddhiparihārāyābhyupagame 'pītyuktam /
vyāsa-(23)

*7,213*

nanu ca pramāṇānurodhi prayojanam /
na punaḥ prayojanamanurudhyāprāmāṇiko 'yartho 'ṅgīkartumucitaḥ /
atiprasaṅgāt /
pramāṇaṃ ca pratyakṣameva nānyat /
nacaivaṃ lokavyavahārocchedaḥ /
sambhāvanayaiva tadupapatteḥ /
saṃvādena ca prāmāṇyābhimānāt /
pratyakṣeṇa ca deha evātmopalabhyate /
gauro 'haṃ jānāmīti /
tathāca kālāntarabhāviprayojanānvayinaḥ puruṣasya abhāvātkathaṃ dharmamokṣākhyaṃ prayojanamatīndriyaśca viṣayo 'ṅgīkartuṃ śakyata ityata āha- dehāditi //

dehādanyo 'nubhavata ātmā bhāti śarīriṇām /
mama deha iti vyaktaṃ mamārtha itivat sadā // MAnuv_2,2.42 //


NYĀYASUDHĀ:
anubhavataḥ parābhyupagataprāmāṇyena pratyakṣeṇaiva /
mama deha iti hyahaṅkārāspadātmasambandhī dehaḥ pratīyate /
nacānyatāpratītau sambandhapratītirupapadyate /
yathā mamārtha iti pratītau bhedapratītipūrvaka eva sambandhābhāsa iti /
nanvevaṃ pratibhāsa eva nāsti /
api tarhi ghaṭasya svarūpamitivadvayavahāramātramiti cenna kalpakābhāvāt /
viparītapratī(mi)tau khalvevaṃ kalpyate /
nacaivaṃ prakṛte /
kasyacitkadācidapi deho 'hamiti pramābhāvāt /
tadidamuktam- śarīriṇāṃ sadeti //
ata eva pratibhāso 'pi bhramo 'stviti nirastam /
asti gauro 'hamiti prameti cenna /
pratipakṣatayā bādhakatvānupapatteḥ /


*7,215*

kiñca nāyaṃ dehātmatāvabhāsaḥ /
kintu dehadharmasyātmadharmatāvabhāsaḥ /
naca vyadhikaraṇayorvirodho 'sti /
tadabhāve kathamasāviti cet /
kimetadanumānamarthāpattirvā praśnamātraṃ vā /
na prathamadvitīyau /
apasiddhāntāt /
sphaṭikajapākusumayorabhedāpratibhāse 'pi taddharmasya tatra pratītidarśanācca /
tṛtīye tu vakṣyate /
astu pratītiḥ /
pratyakṣamiti tu kutaḥ /
abādhapratibhāsasya pratyakṣādanyasya pareṇānabhyupagamāt /
abhyupagame vā prāmāṇyāparihārāt /
aparokṣatayānubhavācca /
tadidamuktam- vyaktamiti //
naca tadevāsiddham /
liṅgādyanusandhānābhāve 'pi bhāvāt /
anyathā dehapratibhāsasyāpi tanna syāt /
etadapyuktam- sadeti //

kecidāhuḥ /
dehātmabhedajñānaṃ samādhiparipākavatāmeveti /
tadasat /
āvipālagopālaṃ mama deha itrata pratibhāsasyānapalapanīyatvāt /
ata evāha- śarīriṇāṃ a(śarīrā)bhimānināmiti //


*7,218*

nanvastvātmā dehātiriktastathāpyarthakāmātirikte puruṣārthe tatsādhanādau ca kiṃ mānam /
vedādirāgamo 'numānaṃ ceti vadāmaḥ /
tasya prāmāṇyameva kuta iti cet /
tatrāha- pratyakṣasyaiveti //

pratyakṣasyaiva mānatvamiti kenāvasīyate // MAnuv_2,2.43ab //

NYĀYASUDHĀ:
yatpareṇābhyupagatamarthādi tatkutaḥ siddhamiti vaktavyam /
pratyakṣeṇeti cet /
pratyakṣasya mānatvamityeva kenāvasīyate /
tathāca puruṣārthatatsādhanamātrāsiddhau jagadanīhamāpadyeteti /
pratyakṣajñānaṃ tāvatpratīyate /
prāmāṇyaṃ ca jñānagrāhakamātragrāhyam /
ataḥ kathamukto doṣaḥ /
prāmāṇyaparatastvāvāde 'pi bādhakābhāvādinā pratyakṣaprāmāṇyasiddhirityata āha- yadīti //

yadi tatsādhakaṃ vedaprāmāṇye na kathaṃ bhavet // MAnuv_2,2.43cd //

NYĀYASUDHĀ:
yadi pratyakṣajñānaprāmāṇyasya jñānagrāhakaṃ vā bādhakābhāvādikaṃ vā sādhakamucyate /
tarhi tadeva vedaprāmāṇyaviṣaye kathaṃ sādhakaṃ na bhavet /
nahi vedavākyājjñānaṃ notpadyate /
naca na pratīyate /
atra vedagrahaṇamupalakṣaṇam /
ata evānyeti sāmānyena vakṣyati /


*7,220*

nanu jñānagrāhakasya prāmāṇyagrāhakatvamityutsargaḥ /
apavāde(na tva)satyaprāmāṇyamapi gṛhyate /
tatkathaṃ vedādiprāmāṇyasiddhiḥ /
paratastve 'pi bādhakābhāvaḥ kuta iti cet /
samametatpratyakṣe 'pi /
anupalambhādapavādādyabhāvaḥ pratyakṣasiddha iti cet /
tulyametadvedādāvityāha- na ceti //

nacānyāmānatā kvāpi pramāṇenāvasīyate // MAnuv_2,2.44ab //

NYĀYASUDHĀ:
pratyakṣādanyayoranumānāgamayoramānatā /
kvāpi viṣaye /


*7,221*

yadvā pratyakṣaprāmāṇyamabhyupagacchanpraṣṭavyaḥ /
kiṃ tvayānubhūyamānasyaikasyaiva pratyakṣasya mānatvam uta sarvasyāpi pratyakṣasya /
ādye doṣamāha- pratyakṣasyaiveti //
itareṣāmapi pratyakṣāṇāṃ tattulyasāmagrījanyatve satyekasyaiva pratyakṣasya mānatvamiti kenāvasīyate /
dvitīye doṣamāha- pratyakṣasyaiveti //
pratyakṣasya mānatvameva sarvamapi pratyakṣaṃ pramāṇamiti kenāvasīyate /
anubhūyamānapratyakṣādanyasya pratyakṣasya, tatprāmāṇyasya vā cāvasāyakaṃ na kimapītyarthaḥ /

parakīyavacanena ceṣyayā vā pratyakṣamavagamya pratyakṣatvena tasya prāmāṇyamavagamyata ityata āha- yadīti //
pratyakṣasya tatprāmāṇyasya ca sādhakaṃ vacanamanumānaṃ ca yadi pramāṇamiṣyate tarhi vedādiprāmāṇye kathaṃ na bhavet /
abhyupagama iti śeṣaḥ /

evamanumānāgamaprāmāṇyaṃ pratyapi vikalpaḥ /
ādyastu pūrvavannirastaḥ /
apasiddhāntaśca adhikaḥ /
dvitīyaṃ dūṣayati- naceti //
anyayoḥ parapuruṣādivartinoranumānāgamayoramānatā /
pūrvavadāśrayādyasiddheḥ /
tatsādhakāṅgīkāre ca vyāghātāditi bhāvaḥ /


*7,222f.*

nanvarthasannikṛṣṭakaraṇajanyatvātpratyakṣaṃ pramāṇam /
anumānāgamayoratītādikamapi viṣayīkurvatostadabhāvātkathaṃ prāmāṇyamiti /
kiṃ yāthārthyameva prāmāṇyaṃ tanniyāmakaśca sannikarṣaḥ anyathātiprasaṅgādityabhiprāyaḥ uta viṣayasannikṛṣṭakaraṇajanyatvaṃ prāmāṇyamiti /

ādye 'pi kiṃ yathākathañcitsannikarṣo niyāmakaḥ uta saṃyoga eva /
ādyaṃ dūṣayati- naceti //
evaṃ tarhyanyayoranumānāgamayoramānatā nāsti /
avinābhāvādisannikarṣasya tatrāpi sattvāditi bhāvaḥ /
dvitīye doṣamāha- kvāpīti //


kvāpi pramāṇe cākṣuṣe śrāvaṇe ca /
nāvasīyate nābhyupagamyate 'rthasaṃyuktakaraṇajanyatā /
pareṇa golakā(dya)tiriktasya cakṣurāderanabhyupagamāt /
tadātmakasya cārthasaṃyogābhāvāt /
tataḥ pratyakṣasyāpi kasyacitprāmāṇyaṃ na syāditi /

dvitīyaṃ dūṣayati- naceti //
yāthārthyādanyā arthasannikṛṣṭakaraṇajanyatālakṣaṇā mānatā na vaktavyā /
kuta ityata āha- kvāpīti //
pūrvavaccākṣuṣādāvavyāpteriti bhāvaḥ /
upalakṣaṇaṃ caitat /
viparyayādāvativyāptiścetyapi draṣṭavyam /

yāthārthye satīdaṃ lakṣaṇamiti cet /
tarhi tadevāstu kiṃ viśeṣyeṇa /
anumānādivyāvṛttyarthamiti cenna /
tadaprāmāṇyasyādyāpyasiddherityāha- naceti //


nanu vedādyarthasyānupambhabādhitatvātkathaṃ tatprāmāṇyamiti cenna /
vedādinaivopalabdheḥ /
tadanyena nopalabhyata iti cet /
tatkiṃ pramāṇāntarasaṃvāditvaṃ prāmāṇyam /
addheti cettatrāha- naceti //
pramāṇāntarasaṃvādalakṣaṇā mānatā netyarthaḥ /
kuto netyata āha- kvāpīti //
anavasthāprasaṅgāt kvāpi pramāṇe nāvasīyate /
yataḥ yadvā kvāpi svasukhādijñāne pramā(ṇa)ṇe saṃvāda eva nāvasīyate iti yojyamityalam /


*7,225*

sūtrārthamupasaṃharati svamateneti /

svamatenārtharahita upekṣyaḥ pakṣa īdṛśaḥ // MAnuv_2,2.44cd //

NYĀYASUDHĀ:
svasammatyaiva artharahito viṣayaprayojanarahitaḥ /
īdṛśaḥ īśvarādyatīndriyānabhyupagamalakṣṇaḥ /

// iti śrīmannyāyasudhāyāṃ abhyupagamādhikaraṇam //


___________________________________________________________________________


*7,226*

[======= JNys_2,2.IV: puruṣāśmādhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ puruṣāśmādhikaraṇam //

puruṣāśmavad iti cet tathāpi | BBs_2,2.7 |

// oṃ puruṣāśmavaditi cettathāpi oṃ //
a(trānīśva)tra nirīśvarasāṅkhayaikadeśināṃ puruṣopasarjanaprakṛtikartṛkatvavādināṃ matamapākriyate /
nanvevaṃ tarhi tadanantaramevedamārambhaṇīyam /
satyam /
tathāpyabhyadhikāśaṅkānusāreṇeyamuktiḥ /
tathāhi /
paramacetanasya bhagavata eva sarvakartṛtvaṃ prāguktam /
tasya kevalaprakṛtikartṛkatvavādaḥ sākṣādvirodhīti prathamamapākṛtaḥ /
tatra mā bhūtkevalasyācetanasya pradhānasya jagatkartṛtvam /
īśvarānugṛhītasya tu bhaviṣyatītyāśaṅkā dvitīyādhikaraṇe (nirastā)nirākṛtā /
mā bhūdacetanasya kartṛtvaṃ kintu śarīrasyaiva caitanyāśrayasya kartṛtvamastvityāśaṅkaya śarīrasya caitanyāśrayatāyogāt punastadavasthaḥ kartṛtvāyoga iti tṛtīye 'bhihitam /
idānīṃ tu kevalasyācetanasya kartṛtvāyoge 'pi cetanasannidhānena tadupapatteḥ kimīśvare(ṇetyā)ṇetyeṣā śaṅkā nirākriyate /


*7,227*

tanmatarītiḥ sūtra evokteti tadeva vyācaṣṭe- sannidhānāditi //

sannidhānāccetanasya vartate yadyacetanam /
tathāpyabuddhipūrvatvāduktadoṣaḥ samo bhavet // MAnuv_2,2.45 //



*7,227f.*

NYĀYASUDHĀ:
yathā khalvacetanameva śarīraṃ cetanasyātmanaḥ sannidhānamātreṇa aśmānayanādikaṃ karoti /
evamacetanāpi prakṛtiḥ puruṣasannidhānānmahadādikāryaṃ kariṣyati /
tathāca prayogaḥ /
mahadādikaṃ puruṣopasarjanaprakṛtikartṛkam kāryatvādaśmānayanādivaditi /
evaṃca kimīśvareṇeti śaṅkārthaḥ /
yadyapyevamabhyadhikamāśaṅkitaṃ tathāpi racanānupapatterityuktadoṣaḥ samo bhavet /
na parihṛto bhavet /
kutaḥ /
abuddhipūrvatvāt /
prakṛteriti śeṣaḥ /
buddhiḥ pūrvā yasya tat buddhipūrvam /
jñānecchāprayatnā ityarthaḥ /
na vidyate buddhipūrvaṃ yasya tattathoktaṃ tasya bhāvastattvam /
tasmāt /
etaduktaṃ bhavati /
jñānecchāprayatnavattvaṃ hi kartṛtvam /
naca puruṣasannidhāne('pi) na prakṛterbuddhimattvaṃ sambhavati /
acetanatvāṅgīkāravirodhāt /
naca buddhayabhāve tatkāryayoricchāprayatnayorapi sambhavaḥ /
tathā cācetanasya kartṛtvapratijñā vyāhataiveti /
nanvātmopasajarnasya śarīrasyāśmānayanādikartṛtvaṃ nidarśitam /
tatkatha(metadi)miti cenna /
śarīrasyāpyuktarītyā kartṛtvāsammateḥ /


*7,229*

dūṣaṇāntaraṃ ca dṛṣṭānte darśayituṃ sūtram- //
oṃ aṅgitvānupapatteḥ oṃ //
iti /
tadvayācaṣṭe- aṅgitvāditi //

aṅgitvānupapatteś ca | BBs_2,2.8 |

aṅgitvaṃ puruṣasyaiva sarvairapyanubhūyate /
tadaṅgatvoktitaścaiva syāt sarvasyāpalāpakaḥ // MAnuv_2,2.46a-d //


NYĀYASUDHĀ:
caśabdo dūṣaṇāntarasamuccayārthaḥ /
evaśabdo vakṣyamāṇakaimutyasphuṭīkaraṇārthaḥ /
aṅgitvaṃ pradhānatvaṃ śarīraṃ pratīti śeṣaḥ /
tadaṅgatvoktitaḥ tasyopasarjanatvāṅgīkārāt /
syāt sāṅkhaya iti śeṣaḥ /

nanvetatprakṛtaviruddham /
parameśvarasya hi sarvakartṛtvamupapādayitumayamārambhaḥ /
tathāca aśmānayanādikārye jīvasya prādhānyopapādanaṃ kathaṃ na prakaraṇaviruddhamiti cenna /
jīvagatasya amukhyasya kartṛtvasya nirāsa eva yadā pramāṇavirodhaḥ tadā kimu vaktavyaṃ sarvakarturīśvarasyāpalāpa ityetatpradarśanāyaiva sūtrakṛtā jīvasyāṅgitvopapādanādityāśayavānāha- kimviti //

kimu sarveśvarasyāsya hyapalāṣād yato 'khilam // MAnuv_2,2.46ef //

NYĀYASUDHĀ:
asya sarvakartṛtvena pratipipādayiṣitasya /
uttarasūtre cāsyāṅgīkāravādatvaṃ sphuṭībhaviṣyatīti hiśabdena sūcayati /

kathaṃ jīvasya prādhānyanirāsādapyatiśayeneśvaranirāsaḥ pramāṇaviruddha ityata āha- yata iti //


yataḥ kāraṇādakhilaṃ pramāṇaṃ yogipratyakṣānumānāgamātmakaṃ sarvakartāramīśvaraṃ pratipādayati tasmāditi pūrveṇa sambandhaḥ /

// iti śrīmannyāyasudhāyāṃ puruṣāśmādhikaraṇam //


___________________________________________________________________________


*7,231*


[======= JNys_2,2.V: anyatānumityadhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ anyathānumityadhikaraṇam //

anyathānumitau ca jñaśaktiviyogāt | BBs_2,2.9 |

// oṃ anyathānumitau ca jñaśaktiviyogāt oṃ //
prakṛtyupasarjanapuruṣakartṛtvavādināṃ nirīśvarasāṅkhayaikadeśināṃ matamatra nirākriyate /
tathāhi aśmānaya(napra)nādipravṛttau tāvatpuruṣasya prādhānyaṃ śarīrasya copasarjanatvamanubhavasiddhamityuktam /
tathāca taddṛṣṭāntena mahadādikāryamapi prakṛtyupasarjanapuruṣakartṛkamanumīyate /
puruṣasya ca cetanatvena na kartṛtvānupapattiḥ /
suṣuptyādau ca kartṛtvānupalambhātprakṛtirupasarjanabhūtāṅgīkaraṇīyā /
evaṃca kimīśvareṇeti /


*7,232*

atra vaktavyaṃ kiṃ puruṣasyaikākinaḥ kutrāpi svātantryaṃ nāsti uta astīti /
ādyaṃ dūṣayituṃ sūtraṃ vyācaṣṭe- aṅgitvamiti //

aṅgitvaṃ yadi tasyaiva svātantryaṃ cennacākhilam /
tatpreraṇe 'pyaśaktatvāt svatantro 'nyo hyapekṣitaḥ // MAnuv_2,2.47 //


NYĀYASUDHĀ:
yadi puruṣa(syaivāṅgi)syāṅgitvaṃ prādhānyaṃ kartṛtvamiti yāvat /
prakṛtestūpasarjanatvameveti pūrvamatādanyathānumīyate /
tatrāpi ca puruṣasyākhilaṃ svātantryaṃ nāstīti pakṣo yadyaṅgīkriyate tadā svatantro 'nyaḥ parameśvaro 'ṅgīkaraṇīya eva syāt /
kutaḥ /
prakṛtipreraṇe puruṣasyāśaktatvāt /
mā bhūttāvatkāryāntarārthamīśvarāpekṣā /
tathāpi prakṛtipreraṇārthamapekṣaṇīya evāsāvityaperarthaḥ /

etaduktaṃ bhavati /
na tāvatsattāmātreṇa saṃyogamātreṇa vā pradhānasya kartāraṃ puruṣaṃ pratyupasarjanatvam /
suptipralayādāvapi prasaṅgāt /
kintu karaṇatvādinā /
naca kartrāprayujyamānasya karaṇatvādikaṃ dṛṣṭam /
naca tadeva tatpreraṇe karaṇādi /
svavṛttivirodhāt /
tathāca prakṛtinirapekṣasya puruṣasya kvāpi vyāpārāsāmarthye 'vaśyamanyena sahakāriṇā bhāvyam /
nacāsāvapyevaṃvidha eva /
tasyāpi sahakāryantarāpekṣāyāmanavasthāprasaṅgāt /
ataḥ svatantra evāsāvaṅgīkaraṇīyaḥ /
sa eva ceśvara iti kathamasau nābhyupagamyata iti /


*7,234*

dvitīyaṃ niṣedhati- naceti //

na ca svātantryamasyaiva ... // MAnuv_2,2.48a //

NYĀYASUDHĀ:
tathā sati prakṛtyanapekṣatvaprasaṅgena (asya) svasiddhāntavirodhāpatteriti bhāvaḥ /
anena vipratiṣedhācceti sūtraṃ vyākhyātaṃ bhavati /
[vipratiṣedhāc cāsamañjasam | BBs_2,2.10 |]
sūtrasyārthāntaramāha- pratyakṣādīti //

... pratyakṣādivirodhataḥ // MAnuv_2,2.48b //

NYĀYASUDHĀ:
pratyakṣādipramāṇairhi puruṣasyāsvātantryaṃ sarvadā u(sarvatro)palabhyate /
prakārāntareṇa vyācaṣṭe- hiteti //

hitākṛtyādidoṣācca ... // MAnuv_2,2.48c //

NYĀYASUDHĀ:
ādipadenāhitakriyopādīyate /
evaṃ pañcamatāni nirākṛtyopasaṃharati- bhadramiti //

... bhadraṃ nānīśvaraṃ matam // MAnuv_2,2.48d //

NYĀYASUDHĀ:
pātañjalābhimatasyeśvarasyeśvaralakṣaṇābhāvāttadapyanīśvarameva matamiti /

nanvanyānyapi bhinnakasaṃsāramocakādīnyanīśvarāṇi matāni santi tāni kuto na nirākriyante /
uktadoṣaireva nirastatvāt abhyadhikāśaṅkābhāvāccetyāha- saṃsāriṇa iti //


*7,235*

saṃsāriṇo 'nyaṃ sarveśaṃ sarvaśaktimanaupamam /
cetanācetanasyāsya sattvādestadadhīnatām /
nāṅgīkurvanti ye teṣāṃ sarveṣāṃ ca samā ime // MAnuv_2,2.49 //


NYĀYASUDHĀ:
saṃsāripadamīśvarātiriktopalakṣaṇam /
sarveśamiti viśeṣyapadam /
tena na paunaruktayam /
upamaivopamam /
svārthiko 'ṇ /
nāstyaupamaṃ yasyāsāvanaupamaḥ /
yadvopamāyā ayamaupamaḥ /
sopama iti yāvat /
tato nañsamāsaḥ /
asya prapañcasya /
ime kathitā doṣā iti śeṣaḥ /
na kevalaṃ sarveśaṃ svarūpeṇānaṅgīrkurvatāmime doṣāḥ /
kintu tamaṅgīkṛtyāpi jīvā(dya)nyatvādiviśeṣaṇāni tasyānaṅgīkurvatāmapi /
tathātve phalatastasyānīśvaratvāditi /


*7,237*

kimato yadyevamanīśvaramatamasamañjasamityata āha- tasmāditi //

tasmācchrutipramāṇena yuktibhiśca paro hariḥ /
aṅgīkāyartamo nityaḥ sarvairapi suniścitam // MAnuv_2,2.50 //


NYĀYASUDHĀ:
na parapakṣanirāsamātreṇa svapakṣasiddhirityataḥ śrutipramāṇenetyādyuktam /
para utkṛṣṭa uktaviśeṣaṇopapannaḥ /
nitya iti sāmarthyādaṅgīkārasya viśeṣaṇam /
sarvadeti yāvat /
niścayasya svaparapakṣasādhanopālambhātiriktānapekṣatvātprāmāṇikaniścayasya cāsamīcīnatvāyogātsuniścitamityuktam /
prathamādhyāyavyutpāditena parapakṣopālambhena ca yathālakṣitaṃ brahma siddhamityāśayaḥ /
nanvevaṃ tarhi uttarādhikaraṇānāmānarambha eva /
nirākariṣyamāṇai(ru)rapyuktaviśeṣaṇasyeśvarasyānabhyupagatatvāditi cet /
satyam /
tathāpi tanmatānāmatyantaheyatāpradarśanāya dūṣaṇāntarāṇi vyutpādanayitumuttaro granthaḥ /

// iti śrīmannyāyasudhāyāṃ anyathānumityadhikaraṇam //


___________________________________________________________________________



*7,239*



[======= JNys_2,2.VI: vaiśeṣikādhikaraṇam =======]



// atha śrīmannyāyasudhāyāṃ vaiśeṣikādhikaraṇam //

mahaddīrghavad vā hrasvaparimaṇḍalābhyām | BBs_2,2.11 |

// oṃ mahaddīrghavadvā hrasvaparimaṇḍalābhyām oṃ //

nityajñānaprayatnecchaṃ saṅkhayadyairapi pañcabhiḥ /
yuktamīśaṃ vadantyanye ... // MAnuv_2,2.51a-c //


NYĀYASUDHĀ:
atra paramāṇvārambhavādināṃ vaiśeṣikādīnāṃ matamapākriyate /
nanu vaiśeṣikādayaḥ parameśvaramaṅgīkurvantyeva /
tatkathaṃ tannirāsāyādhikaraṇārambha ityāśaṅkaya yadyapīśvaraṃ svarūpeṇāṅgīkuvarnti tathāpi taddharmeṣu sukhādiṣu vipratipadyanta eva /
tathā sṛṣṭipralayādividhiṃ cānyathā manyanta ityato yuktastannirāsāyādhikaraṇārambha ityāśayavāṃstanmatamupanyasyati- nityeti //


īśaṃ vadanto 'nye ityāhuriti vakṣyamāṇenānvayaḥ /
nityā jñānaprayatnecchā yasyāsau tathoktaḥ /
saṅkhayādyaiḥ saṅkhayāparimāṇapṛthaktavasaṃyogavibhāgaiḥ /
sāvadhāraṇaṃ caitat /
evamaṣṭaguṇakameva vadanta iti /
nityadravyāśritānyekatvaikapṛthaktavaparimāṇāni nityānyeva dvitvadvipṛthaktavādīni saṃyogavibhāgau ca savartrānityā eveti siddhatvātsaṅkhayādau vidyamāno 'pi nityānityavibhāgo nābhihitaḥ /
jñānādīnāṃ tu jīvāśritānāmanityatvādatra nityatvasaṅkīrtanam /

yadyapi kecidīśvaraṃ ṣaḍguṇamācakṣate /
tathāpi na tatparamaṃ matamityaṣṭaguṇatvamevopanyastam /
evamātreyasya jñānānityatvamapi nopanyastam /

yadvā nityatvasaṅkīrtanaṃ guṇāntarābhāve yuktitvena kṛtam /
tathāhi /
jīvātmāno buddhisukhaduḥkhecchādveṣaprayatnadharmādharmabhāvanābhirnavabhirviśeṣaguṇairyuktāḥ /
tatra nityayathārthajñānasya mohābhāvāttatprabhavasya dveṣasyābhāvaḥ /
tadabhāve tanmūlayordharmādyayorabhāvaḥ /
icchāyā api mohābhāvenārāgarūpatvānna dharmādikāraṇatvam /
dharmādyabhāve ca tatkāryayoḥ sukhaduḥkhayorabhāva eva /
nityajñānatvādeva smṛtyasambhavena kalpakābhāvādbhāvanāyā apyabhāva iti /

athavā nityatvena jñānādīnāmakhaṇḍatvaṃ sūcayati /


*7,242*

evamapīśvaraviṣayāṃ vipratipattimupanyasya sṛṣṭiviṣayāmupanyasyati- tadiccheti //

... tadicchādṛṣṭacoditāḥ /
paramāṇavaścaturvargāḥ saṃyujyante dviśo 'khilāḥ // MAnuv_2,2.51d-f //


NYĀYASUDHĀ:
mahāpralaye hi vakṣyamāṇo nityavargo 'nityāśca dharmādharmasaṃskārādayo 'vatiṣṭhante /
tato brahmavarṣaśatānte prāṇināṃ bhogabhūtaye maheśvarasya sisṛkṣā sañjāyate /
tayā ca sarvātmagatā dharmādharmalakṣaṇādṛṣṭādayo labdhavṛttayo bhavanti /
tatastadicchayā sisṛkṣālakṣaṇeśvarecchayādṛṣṭairadṛṣṭavadātmasaṃyogaiśceti yāvat /
coditāḥ preritāḥ /
kriyāvanta iti yāvat /

prāk pravibhaktatayāvasthitāḥ paramāṇavaścaturguṇāḥ pāthirvāḥ pāthasīyāstaijasā vāyavīyāśca dviśaḥ saṃyujyante /
atra paramāṇava ityevokte manasāmapi grahaṇaṃ syāt /
teṣāṃ saṃyogasadbhāve 'pi vakṣyamāṇaṃ dravyārambhakatvaṃ gaganavadasparśavattvādayuktam /
atastadvayāvṛttaye caturvargā ityuktam /
yadvā sajātīyasaṃyoga eva dravyārambhako na tvanya iti anena sūcayati /

akhilā iti /
dviśaḥ saṃyoge niyamavacanāt /
ye paramāṇavo dravyārambhāya saṃyujyante te 'khilā dviśo dvau dvāveveti /



*7,249*

tataḥ kimityata āha- paramāṇviti //

paramāṇudvayenaiva dvayaṇukaṃ nāma jāyate /
dvayaṇukatrayeṇa tryaṇukaṃ taiścaturbhistadātmakam // MAnuv_2,2.52 //
tatastvaniyamenaiva khaṇḍāvayavināṃ bhavaḥ /
tataścāniyamenaiva sarvāvayavisambhavaḥ // MAnuv_2,2.53 //


NYĀYASUDHĀ:
paramāṇupuñjavādaṃ pariṇāmavādamaniyamavādaṃ caivaśabdena vyāvartayati /
paramāṇudvayenaiva, natu nirantaratayotpannaparamāṇudvayaṃ, nāpi paramāṇudvayameva saṃyuktamāsāditapariṇāmaviśeṣaṃ, naca trayādineti /
jāyate ityasatkāryavādaṃ sūcayati /
jātyapekṣayaikavacanam /
tataśca saṃyuktasajātīyaparamāṇudvayaistato 'tyantabhinnāni tatsamavetāni prāgasantyeva dvayaṇukanāmakāni dravyāṇyutpadyanta ityarthaḥ /
dvayaṇukatrayeṇa tryaṇukaṃ jāyate ityanurvate /
eveti ca /
atrāpi pūrvavadvayākhyānam /
aṇutvaparimāṇasya paramāṇau dvayaṇuke ca sāmyāddvayaṇukasaṃjñāvattryaṇukasaṃjñāpyupapadyata eva /
taiḥ sajātīyaiḥ saṃyuktaiścaturbhistryaṇukaiḥ tadātmakaṃ dravyaṃ jāyate /
tryaṇukeṣvaṇusaṃjñopacārāt /
kecit dvayaṇukaireva caturaṇukārambhamabhyupayanti /
tanmatānusāreṇa taidvaryaṇukairiti vyākhyeyam /
dvayaṇukāni trīṇi (dravyaṃ) yatkāyarmārabhante tattryaṇukam /
caturbhirārabdhaṃ caturaṇukamiti /
atra ca saṃjñā mukhyaiva /
tataḥ tryaṇukebhyaścaturaṇekebhyo vā /
tuśabdo viśeṣārthaḥ /
tamevāha /
aniyamenaivaitāvadbhireveti saṅkhayāniyamaṃ vinetyarthaḥ /
dravyasamavāyikāraṇāni kāyardravyāṇi khaṇḍāvayavinaḥ /
tryaṇukāderantyāvayavinaśca madhye naikameva khaṇḍāvayavi kintu aniyamenānekānyapi bhavantīti sūcayituṃ bahuvacanam /
tataḥ taiḥ khaṇḍāvayavibhiścāniyamenaiva saṅkhayāniyamaṃ vinaiva sarvāvayavināmantyāvayavināṃ śarīrendriyaviṣayāṇāṃ sambhavaḥ /
tadanena dravyotpattirabhihitā /
guṇānāṃ karmaṇāṃ ca svāśrayadravyeṣūtpādo draṣṭavyaḥ /


*7,253*

sarvamapi kāryaṃ bhāvarūpaṃ kāraṇatritayajanyam /
kāraṇāni ca samavāyyasamavāyinimittānāmāni /
tatra ya(tsama)tra samavetaṃ kāyarmutpadyate tatsamavāyikāraṇam /
tatsvarūpeṇa darśayati- kāraṇamiti //

kāraṇaṃ samavāyyākhyaṃ paramāṇvādi tatra hi // MAnuv_2,2.54ab //

NYĀYASUDHĀ:
atra dvayaṇukādikāryotpattau paramāṇvādidravyapadārthaḥ samavāyikāraṇam /
kutaḥ /
atra paramāṇvādau dravye hi yasmātsarvakāryaṃ samavetamutpadyate tasmāditi śeṣaḥ /


*7,254*

samavāyyasamavāyivyatiriktaṃ kāraṇaṃ nimittam /
tadudāharati- īśeti //

īśecchādṛṣṭakālāstu nimittaṃ kāraṇaṃ matam // MAnuv_2,2.54cd //

NYĀYASUDHĀ:
nimittaṃ tvityanvayaḥ /
idaṃ ca sarvakāryasādhāraṇaṃ nimittaṃ darśitam /
evamanyadapi draṣṭavyam /
yathā turīvemādikaṃ paṭasyetyādi /


*7,255f.*

samavāyikāraṇapratyāsannamavadhṛtasāmarthyamasamavāyikāraṇam /
samavāyikāraṇatatsamavāyikāraṇayoranyatarasamavetatvaṃ samavāyikāraṇapratyāsannatvam /
sāmarthyāvadhāraṇaṃ cānanyathāsiddhaniyatapūrvabhāvitvena bhavati /
taccāsamavāyikāraṇaṃ dravyaṃ samavāyikāraṇamitivannaikoktayā vaktuṃ śakyam /
pratikāryaṃ pṛthaktavāt /
atastadvivekena darśayituṃ tajjñānasya kāyarjñānasāpekṣatvātkāryākāryavibhāgaṃ tāvadāha- sāmānyeti //


*7,256*

sāmānyāntyaviśeṣau ca samavāyaśca tattrayam /
nityaṃ kriyā anityāstu guṇadravye dvirūpake // MAnuv_2,2.55 //


NYĀYASUDHĀ:
kāryatvānityatvayoḥ samaniyamānnityānityavibhāgoktayā kāryākāryavibhāga eva siddhayati /


*7,257*

ṣaḍime dravyaguṇakarmasāmānyaviśeṣasamavāyāḥ bhāvarūpāḥ padārthāḥ /
abhāvaḥ saptamaḥ /
vidhirūpo bhāvaḥ /
niṣedharūpo abhāvaḥ /
guṇāśrayo dravyam /
samavāyikāraṇaṃ vā /
sāmānyavānasamavāyikāraṇamaspandātmā guṇaḥ /

calanātmakaṃ karma /
nityamekamane(kānugataṃ)kasamavetaṃ sāmānyam /
nityeṣveva dravyeṣveva vartanta eva ye te (antya)viśeṣāḥ /
atyantavyāvṛttihetavo vā /
ayutasiddhayoḥ sambandhaḥ samavāyaḥ /
avaśyamāśrayāśrayibhāvenāvasthitāvayutasiddhau /
nityaḥ sambandho vā /


*7,266*

tatra sāmānyamantyaviśeṣaśca samavāyaścetyetattrayaṃ nityamakāryaṃ ca /
viśeṣa ityevokte dravyaguṇakarmasāmānyānāmapi grahaṇaṃ syāt /
viśiṣṭate 'neneti hi viśeṣaḥ /
dravyaṃ ca daṇḍādikamadaṇḍyādibhyo devadattādikaṃ vyāvartayati /
guṇaśca nirguṇāddravyam /
karmāpi niṣkriyānmūrtam /
sāmānyaṃ dvividhaṃ paramaparaṃ ca /
paraṃ sattā pracurāśrayatvāt /
aparaṃ dravyatvādi alpāśrayatvāt /
tatra parasāmānyasyānuvṛttimātrahetutvena sāmānyamātratve 'pyaparasāmānyaṃ vyāvṛtterapi hetutvādviśeṣo 'pi ye vyāvartakā bhavanti te 'ntyāḥ /
atyantavyāvṛttihetava iti yāvat /
nahi daṇḍādikaṃ tathā /
daṇḍyantarādibhyo 'vyāvartakatvāt /


*7,269*

kriyā utkṣepaṇāpakṣepaṇākuñcanaprasaraṇagamanarūpā anityāśca /
caśabdo 'vadhāraṇe /
na dravyādivadubhayarūpā ityarthaḥ /

guṇā dravyāṇi ca nityānityabhedena dvividhānīti /
tathāhi /
dravyāṇi pṛthivyaptejovāyvākāśakālādigātmamanāṃsi /
tatra paramāṇurūpāṇi pṛthivyādīni catvāri, gaganādīni pañca nityāni /
dvayaṇukādirūpāṇi pṛthivyādīni catvāryanityānīti /
guṇāścānityadravyagatā anityā eva /
pārthivaparamāṇāvaikatvaikapṛthaktavaparimāṇagurutvāni nityāni /
rūparasagandhasparśānekatvānekapṛthaktavasaṃyogavibhāgaparatvāparatvasaṃskārā anityāḥ /
(āpye ca) pāthasīye ca rūparasasparśaikatvaikapṛthaktavaparimāṇagurutvadravyatvasnehā nityāḥ /
anekatvānekapṛthaktavasaṃyogavibhāgaparatvāparatvasaṃskārā anityāḥ /
taijase ca rūpasparśaikatvaikapṛthaktavaparimāṇāni nityāni /
anekatvānekapṛthaktvasaṃyogavibhāgaparatvadravyatvasaṃskārā anityāḥ /
vāyavīye ca sparśaikatvaikapṛthaktavaparimāṇāni nityāni /
anekatvānekapṛthaktavasaṃyogavibhāgaparatvāparatvasaṃskārā anityāḥ /
ākāśe caikatvaikapṛthaktavaparimāṇāni nityāni /
aketvānekapṛthaktavasaṃyogavibhāgaśabdā anityāḥ /
kāle diśi caikatvaikapṛthaktavaparimāṇāni nityāni /
anekatvānekapṛthaktavasaṃyogavibhāgā anityāḥ /
ātmani caikatvaikapṛthaktavaparimāṇāni nityāni /
anekatvānekapṛthaktavasaṃyogavibhāgā buddhayādayaśca nava anityāḥ /
īśvarasyāpi viśeṣo 'bhihitaḥ /
manasi caikatvaikapṛthaktavaparimāṇāni nityāni /
anekatvānekapṛthaktavasaṃyogavibhāgaparatvāparatvasaṃskārā anityāḥ /
iti vivekaḥ /


*7,271*

evaṃ kāryākāryavibhāgamuktavā yasya yadasamavāyikāraṇaṃ tadāha- kārya iti //

kārye guṇakriyāṇāṃ tu samavāyyanyakāraṇam /
kāraṇasthā guṇādyāstu saṃyogo dravyakāraṇam // MAnuv_2,2.56 //


NYĀYASUDHĀ:
kāryakāraṇagrahaṇamupalakṣaṇam /
tataśca kārye 'kārye ca dravye jāyamānānāṃ guṇānāṃ samavāyikāraṇasamavāyikāraṇasthāḥ samavāyikāraṇasthāśca guṇāḥ samavāyikāraṇasthaṃ karma ca samavāyyanyakāraṇaṃ asamavāyikāraṇam /
karmaṇaśca asamavāyikāraṇasthā guṇā evāsamavāyikāraṇamiti yojyam /

ādyastuśabdo dravyādviśeṣaṃ dyotayati /
dvitīyasya dravyakāraṇaṃ tvityanvayaḥ /
yadvā dvāvapyanuktasamuccayārthau /
taccoktam /
tathāhi /
kāryagatānāṃ rūparasagandhasparśaparimāṇaikatvaikapṛthaktavottarasaṃyogavibhāgagurutvadravatvasnehavegānāṃ kāraṇagatā rūpādayo 'samavāyikāraṇam /
pārthivaparamāṇugatānāṃ rūparasagandhasparśānāṃ pārthivataijasaparamāṇugatadravyasya tadgata eva tejaḥ saṃyogaḥ /
sarvatrānekatvānekapṛthaktavayorāśrayagataikatvaikapṛthaktavāni /
saṃyogavibhāgavegānāmāśrayagataṃ karma /
paratvāparatvayorāśrayagatau dikkālasaṃyogau /
ātmaviśeṣaguṇānāmātmagato manaḥ saṃyogaḥ /
śabdasyākāśagatāḥ saṃyogavibhāgaśabdāḥ /
karmaṇaścāśrayagatā gurutvadravatvavegasaṃyogā iti /
dravyasya tu samavāyikāraṇānāmavayavānāṃ saṃyogo 'samavāyikāraṇamiti /


*7,275*

uktasya kvacidapavādamāha- evamiti //

evaṃ sthite 'pi siddhānte viśeṣastatra kalpitaḥ // MAnuv_2,2.57ab //

NYĀYASUDHĀ:
kāraṇagataṃ parimāṇaṃ kāryagatasya parimāṇasyāsamavāyikāraṇamityevaṃ sāmānyataḥ siddhānte sthite 'pi, tatra parimāṇaviśeṣe viśeṣo 'nyathābhāvaḥ kalpito vaiśeṣikaiḥ /
kathamityata āha- dvayaṇuka iti //

dvayaṇuke paramāṇau ca hrasvatvaṃ parimaṇḍalam // MAnuv_2,2.57cd //
na kāraṇaṃ kāryaguṇe ... // MAnuv_2,2.58a //


NYĀYASUDHĀ:
caturvidhaṃ parimāṇam /
aṇutvaṃ mahattvaṃ hrasvatvaṃ dīrghatvaṃ ca /
tatrāṇutvaṃ dvividhaṃ, nityamanityaṃ ca /
nityaṃ caturvidhaparamāṇau manasi ca /
pārimāṇḍalyamiti cocyate /
anityaṃ dvayaṇuka eva /
mahattvamapi dvividhaṃ nityānityabhedāt /
nityamākāśakāladigātmasu paramamahattvam /
anityaṃ tryaṇukādau kāyardravye /
hrasvatvaṃ dvayaṇuka eva /
dīrghatvaṃ tryaṇukādikāryadravya eva /
kecitparamāṇāvapi hrasvatvaṃ gaganādāvapi dīrghatvamabhyupayanti /
tatra dvayaṇuke vartamānaṃ hrasvatvam /
upalakṣaṇametat /
aṇutvaṃ ca kāryaguṇe dvayaṇukakāryatryaṇukaparimāṇe /
viṣayasaptamīyam /
tryaṇukamahaddīrghatvayorasamavāyikāraṇaṃ na bhavati /
tathā paramāṇau vartamānaṃ parimaṇḍalaṃ pārimāṇḍalyaṃ paramāṇukāryadvayaṇukaguṇasya hrasvatvasyāṇutvasya cāsamavāyikāraṇaṃ na bhavati /
tryaṇukādigataṃ tu mahattvaṃ dīrghatvaṃ ca caturaṇukādiparimāṇaṃ pratyasamavāyikāraṇaṃ bhavatyeveti /


*7,276*

kasmādevaṃ kalpitamityata āha- vairūpyamiti //

... vairūpyaṃ tatra kāraṇam /
ityāhus ... // MAnuv_2,2.58bc //



*7,276f.*
NYĀYASUDHĀ:
tatra dvayaṇukaparamāṇuparimāṇānāṃ tryaṇukadvayaṇukaparimāṇāni prati kāraṇatvābhāve vairūpyaṃ vijātīyatvaṃ kāraṇam /
sajātīyayoreva hi tantupaṭaparimāṇayoḥ kāryakāraṇabhāvo dṛṣṭaḥ /
tathāca prayogaḥ /
dvayaṇukatryaṇukaparimāṇe na kāryakāraṇabhāvavatī vijātīyaparimāṇatvāt /
vyatirekeṇa tantupaṭaparimāṇavat /
evaṃ paramāṇudvayaṇukaparimāṇayorapi draṣṭavyam /
paramāṇoraṇutvaṃ dvayaṇukāṇutvasya kāraṇamastviti cenna /
tatrāpi nityaparimāṇatvasya paramāṇutvasya ca vairūpyasya sattvāt /
evañcedvayaṇukatryaṇukaparimāṇānāṃ kimasamavāyikāraṇamityata āha- vairūpyamiti //
anekatvamityarthaḥ /
īśvarabuddhimapekṣyotpannā paramāṇvordvitvasaṅkhayā dvayaṇuke 'ṇutvaṃ hrasvatvaṃ ca karoti /
dvayaṇukeṣu cotpannā tritvasaṅkhayā tryaṇuke mahattvaṃ dīrghatvaṃ ca karotīti /


*7,278*

evamupanyastaṃ matamapākartumadhikaraṇa(sūtra)mavatārayati- tāniti //

... tānathovāca vidyādhīśaḥ svayaṃ prabhuḥ // MAnuv_2,2.58cd //

NYĀYASUDHĀ:
uvāca mahaddīrghavadvetyādīti śeṣaḥ /
prabalatarkopabṛṃhitamatanirāse sāmarthyaṃ sūtrakṛtaḥ kathamityata uktam- svayaṃ sākṣātsarvavidyānāmadhīśastasmātprabhuriti /


*7,279*

na vaiśeṣikādimatavirodhenoktārthasyānyathātvaṃ śaṅkanīyam /
tasyopapattiviruddhatvāt /
tathāhi /
yattāvaduktaṃ dvayaṇukādiparimāṇaṃ na tryaṇukādiparimāṇasyāsamavāyikāraṇamiti, tadupapattiviruddhamiti darśayan"mahaddīrghavadvā hrasvaparimaṇḍalābhyām'; iti sūtraṃ vyācaṣṭe- mahattvaṃ ceti //

mahattvaṃ caiva dīrghatvaṃ tryaṇukādyeṣu kalpitam /
tasmācca sadṛśaṃ kāryaṃ tatkāryeṣūpajāyate // MAnuv_2,2.59 //
yathā tathaiva hrasvatvāt pārimāṇḍalyato 'pi hi /
jāyeta sadṛśaṃ kārye parimāṇaṃ samatvataḥ // MAnuv_2,2.60 //


NYĀYASUDHĀ:
evaśabdasya tryaṇukādyeṣveveti kalpitameveti vā sambandhaḥ /
tryaṇukādyeṣu dravyeṣu /
tasmāt tryaṇukādau kārye 'ntyāvayavivyatirikte vartamānānmahattvāddīrghatvāt /

caśabdo vākyārthasamuccaye /
kāryaṃ parimāṇam /
tatkāryeṣu tryaṇukādikāryeṣu caturaṇukādiṣu /
tathaivetyevaśabdena dṛṣṭāntadārṣyāntikavaiṣamyaśaṅkāmapākaroti /
kārye tryaṇuke dvayaṇuke ca samatvataḥ kāryaparimāṇatvādisāmyāditi hetuvacanam /
hiśabdo vyāptidyotakaḥ /


*7,281*

yadyapi mahadādiśabdā dravyavacanāstathāpi bhāvapradhānatvātparimāṇavācino(pi) bhavantītyāyena mahattvamityādyuktam /
sūtrakṛtasya bhāvaprādhānyenoktiḥ kaṇādasūtrānusāreṇa /
"kāraṇabahutvātkāraṇamahattvātpracayaviśeṣācca mahat'; ityādi hi tat /
mahaddīrghavaditi ṣaṣṭhayarthe vatiḥ /
vibhaktivipariṇāmena vā sakāśādityadhyāhāreṇa vā tasmādityuktam /
atraitāvadādau vaktavyam /
yathā tasmātkāryeṣu kāyarmupajāyate tathaiva hrasvatvātpārimāṇḍalyato 'pi kārye parimāṇaṃ jāyeta samatvato hīti /


*7,285*

etaduktaṃ bhavati /
tryaṇukādvayaṇukaparimāṇaṃ svāśrayāśrayasamavāyikāraṇaparimāṇajam kāryaparimāṇattvāccaturaṇukādiparimāṇavat, dvayaṇukaparamāṇuparimāṇaṃ parimāṇārambhakaṃ dravyasamavāyikāraṇaparimāṇatvāt, tryaṇukaparimāṇavat tryaṇukadvayaṇuke vā parimāṇārabhyaparimāṇavatī kāryadravyatvāccaturaṇukādivat, dvayaṇukaparamāṇū parimāṇāsamavāyikāraṇaparimāṇavantau dravyasamavāyikāraṇatvāt tryaṇukavaditi /
naca vivakṣitārthāsiddhiḥ, anyathānupapattyā tatsiddheḥ /
naca yatra kevalena pracayena parimāṇamārabhyate tatra vyabhicāra iti vācyam, tasyāpi pakṣatulyatvāt /
nacaivaṃ sati bādhaḥ, pracayakāraṇatāyā anivāraṇāt /
nacobhayakāraṇatvakalpane gauravadoṣaḥ, dvayorapi kḷptaśaktitvāt /
dvayaṇukaparimāṇaṃ tryaṇukaparimāṇājanakam, paramāṇuparimāṇaṃ ca dvayaṇukaparimāṇājanakam, parimāṇatvāt paṭaparimāṇavat, ityādinā satpratipakṣateti cenna, tatsamavāyikāṇaparimāṇatvābhāvasyopādhitvāt, tryaṇukaparimāṇaṃ caturaṇukaparimāṇājanakam parimāṇatvātpaṭaparimāṇavat, ityādyābhāsasamānayogakṣematvācca /
paramāṇuparimāṇaṃ parimāṇānārambhakaṃ nityaparimāṇatvāt gaganaparimāṇavadityapi na, dravyasamavāyikāraṇaparimāṇatvābhāvasyopādhitvāt /
apyaparamāṇurūpaṃ rūpānārambhakaṃ nityatvāt gaganaparimāṇavat, paramāṇavo dravyānārambhakā nityatvādgaganavat, ityādyābhāsatulyatvācca /


*7,290*

etena paramāṇudvayaṇukaparimāṇe parimāṇānārambhake aṇutvānmanaḥparimāṇavadityapi parāstam /
na cānaṇutvamupādhiḥ /
vakṣyamāṇanyāyena parimāṇāvāntarajāterapākaraṇāt /
pakṣīkṛtādghrasvatvādavyāvṛtteśca /


*7,293*

nanu ca tryaṇukādiparimāṇaṃ caturaṇukādiparimāṇaṃ ca sajātīyamiti yuktastatra kāryakaraṇabhāvaḥ /
dvayaṇukatryaṇukaparimāṇayostu vijātīyatvātkathaṃ tathātvamityato dṛṣṭāntadārṣyāntikayoḥ sadṛśamityuktam /
yathā tryaṇukādiparimāṇāccaturaṇukādau sajātīyaṃ parimāṇamutpadyate /
tathā dvayaṇukaparamāṇuparimāṇādapi tryaṇukādau sajātīyaparimāṇotpādasyaiva sisādhayiṣitatvānna doṣa ityarthaḥ /


*7,294*

nanu ca tryaṇukādau mahattvadīrghatve dvayaṇukādau tvaṇutvahrasvatve pramāṇasiddhe /
tatkathaṃ sājātyasādhane bādho na bhavedityata uktam- mahattvaṃ ceti //
kalpanaivaiṣā vaiśeṣikāṇāṃ natu parimāṇāvāntarajātibhede pramāṇamasti /
kinnāma parimāṇamekajātīyamevotkarṣāpakaṣarvaditi bhāvaḥ /
anena vairūpyasyāsiddhiruktā veditavyā /


*7,294f.*

nanu ca dvayaṇukādiparimāṇasya paramāṇvādiparimāṇājanyatve bādhakābhāvādaprayojakatvamanumānānām /
dvayaṇukādiparimāṇasya saṅkhayaiva janmasambhavādityāśaṅkāṃ pariharan vāśabdaṃ vyākhyāti- nacediti //

na cenmahattvataścaiva dīghartvādapi no bhavet // MAnuv_2,2.61ab //

NYĀYASUDHĀ:
cāpiśabdāvitaretarayoge /
evaśabdo no bhavedeveti sambaddhayate /


*7,296f.*

idamiha vaktavyam /
dvayaṇukādiparimāṇe 'samavāyikāraṇalakṣaṇamasti na veti /
ādye 'samavāyikāraṇalakṣaṇasadbhāve 'pi tryaṇukādiparimāṇaṃ dvayaṇukādiparimāṇajaṃ ca cedbhavettadā tryaṇukādigatānmahattvato dīrghatvācca no bhavedeva, caturaṇukādiparimāṇamiti śeṣaḥ /
idamuktaṃ bhavati /
yadi samavāyikāraṇapratyāsannatvādisadbhāve 'pi nāsamavāyikāraṇatvaṃ tadedamativyāpakatvādalakṣaṇaṃ syāt /
tathāca na tathābhūtasyāpi mahattvāderasamavāyikāraṇatvaṃ syāditi /

dvitīye kiṃ samavāyikāraṇapratyāsattirnāsti uta sāmarthyāvadhāraṇam /
nādyaḥ /
dvayaṇukādiparimāṇasya tryaṇukādiparimāṇasamavāyikāraṇasamavāyikāraṇe dvayaṇukādau samavetatvasya pramitatvāt /
samavāyikāraṇasamavetatvābhāvānna cet dvayaṇukādiparimāṇāttryaṇukādiparimāṇasyotpādastadā tryaṇukādigatābhyāṃ mahattvadīrghatvābhyāṃ caturaṇukādiparimāṇamapi no bhavet tasyāpi samavāyikāraṇasamavetatvābhāvāt /
na dvitīyaḥ /
ananyathāsiddhiniyatapūrvabhāvitvena hi sāmarthyamavadhāraṇīyam /
taccāsti dvayaṇukādiparimāṇe /
evamapi na cettatastryaṇukādiparimāṇādijanma, tadoktaprasaṅga eva /


*7,297f.*

sadṛśaparimāṇasyaiva kāraṇatvāvadhāraṇādvisadṛśametadakāraṇamavarjanīyasannidhīti cet /
kimidaṃ visadṛśatvam /
kiṃ jātibhedaḥ /
uta vailakṣaṇyamātram /
nādyaḥ /
paramāṇudvayaṇukādiparimāṇānāmanumānenaikajātīyatvasyāpi sādhitatvāt /
dvitīye vailakṣaṇyamātreṇa na cetkāraṇatvaṃ tadā mahattvāderapi na syāt /
nahi tryaṇukacaturaṇukamahattve na vilakṣaṇe /
sotkarṣatvasyānubhavasiddhatvāt /


*7,298*

atha saṅkhayāta eva janmasambhave parimāṇasyāpi kāraṇatvaṃ na kalpanīyamiti cet /
tathāpyukta evātiprasaṅgaḥ /
caturaṇukādiparimāṇasyāpi saṅkhayāta eva jananopapatteḥ /
yatra tu niyāmakaviśeṣastatra parimāṇamapyādriyatāmiti /
yadyapi pariṇāmavādināṃ nāyaṃ panthāḥ /
kintūpādānāni svaguṇayuktāni tathāvidhakāryatāmāpadyanta iti /
tathāpi paramatamāśritya pa(reṣāmevedaṃ)rasyedaṃ dūṣaṇābhidhānamiti na kācitkṣatiḥ /


*7,299f.*

evaṃ paramāṇuparimāṇāddvayaṇukaparimāṇasyotpādaḥ tatastryaṇukaparimāṇasya janma teṣāṃ caikajātīyatvamityanumānena sādhitam /
tadasat /
pratitarkaparāhatatvāt /
tathāhi /
kiṃ paramāṇuparimāṇādvayaṇuke dvayaṇukaparimāṇācca tryaṇuke sajātīyaparimāṇasyāṇutvasyotpattiḥ sādhyate uta mahattvasya atha hrasvatvasya yadvā dīrghatvasya /
sarveṣāmapi pakṣāṇāṃ duṣṭatvaṃ pratijānīte- sadṛśasya hīti //

*7,300*

sadṛśasya hi kāryasya naiva yogaḥ kathañcana // MAnuv_2,2.61cd //

NYĀYASUDHĀ:
yogo ghaṭanā /
kathañcana uktaprakāreṣu kenāpi prakāreṇa /


kuta ityataḥ prathamapakṣe 'niṣyamāha- apratyakṣatvamiti //

apratyakṣatvamevaṃ syād yataḥ kāryeṣvaṇutvataḥ /
iti cen ... // MAnuv_2,2.62a-c //


NYĀYASUDHĀ:
yadi paramāṇuparimāṇādaṇutvena sajātīyaṃ dvayaṇuke, dvayaṇukaparimāṇācca tryaṇuke parimāṇamutpadyate /
tadā sarvakāryeṣvaṇutvaprasaṅgenāsmadādyapratyakṣatvameva syādyatastasmānneti /
dvyaṇukasyāpratyakṣatvamiṣyamevetyato 'vadhāraṇam /
sarveṣāmapi kāryāṇāmapratyakṣatvameva syāt /
natu (yasya) kasyacitpratyakṣatvamiti /
dravyasya hyasmadādipratyakṣatvaṃ mahattve satyudbhūtarūpasparśavattvena vyāptam /
tathāca tryaṇukādīnāmaṇutve mahattvābhāvādapratyakṣatvaṃ syāt /
etena tṛtīyo 'pi parāstaḥ /
tryaṇukāderapi hrasvatve mahatvābhāvenāpratyakṣatvaprasaṅgasya durnivāratvāt /


*7,306*

dvitīye tu paramāṇudvayaṇukayorapi mahattve pratyakṣatvāpattiḥ /
na codbhūtarūpasparśayoranyatarābhāvena tadabhāvaḥ /
tryaṇukādāvapi tadā(dabhāvā)patteḥ /
ata eva caturtho 'pi parāstaḥ /
dīrghatve mahatvasyāvarjanīyatvāditi pakṣadvayadūṣaṇaṃ spaṣṭatvānnoktam /
yadyapīdaṃ parimāṇāvāntarajātīnāmaṇutvādīnāmaprāmāṇikatvoktayā parihṛtameva /
tathāpi tasyaivārthasya sphuṭīkaraṇārthaṃ punarāśaṅkitamityadoṣaḥ /

atra tāvadvikalpiteṣu mahattvapakṣaṃ gṛhṇāti- na mahattvaṃ ceti //

... na mahattvaṃ ca paramāṇāvaṇāvapi // MAnuv_2,2.62cd //

NYĀYASUDHĀ:
caśabdo dīrghatvasamuccayārthaḥ /
aṇau dvayaṇuke /
kathaṃ na kathyata iti vakṣyamāṇamatrāpa sambadhyate /

yaduktaṃ kimaṇutvasyotpattiḥ sādhyata ityādi, tatra paramāṇumahattvāddvayaṇuke mahattvam /
dvayaṇukamahattvāttryaṇukamahattvamutpadyate ityeṣa pakṣastāvatparigṛhyata ityarthaḥ /
yadyapyatra parimāṇāvāntarajātyabhāvānnaivaṃ vikalpa eva yujyata iti vaktavyam, tathāpi tadabhāvamevopapādayituṃ gūḍhābhisandhinā pakṣaparigrahaḥ kṛta iti jñātavyam /


*7,309*

ata eva pakṣāntaramapi gṛhṇāti- kathameveti //

kathaṃ tṛyaṇukapūrveṣu nāṇutvamapi kathyate // MAnuv_2,2.62ef //

NYĀYASUDHĀ:
paramāṇoraṇutvāddvayaṇuke 'ṇutvaṃ dvayaṇukāṇutvāttryaṇuke 'ṇutvaṃ tataśca caturaṇuke 'ṇutvamiti vā pakṣaḥ parigṛhyata iti bhāvaḥ /
nanvevaṃ sati pakṣadvayoktadoṣāpattirvyāghātaścādhikaḥ /
tathā hi /
paramāṇumārabhyāntyāvayaviparyantasyodbhūta(rūpa)sparśavato mahattve sarvasyāpi pratyakṣatvaṃ syāt /
aṇutve cāpratyakṣatvaṃ syāt /
naca paramāṇvādeḥ pratyakṣatvaṃ tryaṇukāderapratyakṣatvaṃ yuktam /
pratyakṣatvāpratyakṣatve ca parasparavyāhate /
yatpratyakṣaṃ ghaṭādi na tadapratyakṣam /
yaccāpratyakṣaṃ gaganādi na tatpratyakṣamiti tayoḥ parasparaparihāreṇaiva vṛtteḥ /


kiñca mahattvāṇutve parasparaviruddhe kathamekaikatrāṅgīkartumucite /
(tadāha) yathā āha sūtrakāraḥ"dṛṣṭāntācca'; iti /
naca kālabhedena virodhaparihāraḥ, parimāṇasya yāvaddravyabhāvitvādityāśaṅkaya pratyakṣatvāpratyakṣatvaprasaṅgayostāvadiṣyāpādanatvaṃ vadanvyāhatiṃ pariharati- pratyakṣatveti //

pratyakṣatvatadanyatve puruṣāpekṣayākhile // MAnuv_2,2.63ab //

NYĀYASUDHĀ:
paramāṇvādāvakhile 'pi dravye pratyakṣatvāpratyakṣatve sta eveti naitau prasaṅgau yuktau /
naca vyāhatiḥ /
puruṣabhedāpekṣayā vyavasthopapatteriti /
etaccottaratra sphuṭībhaviṣyati /


*7,312*

idānīmaṇutvamahattvavyāghātaṃ pariharati- aṇutvaṃ ceti //

aṇutvaṃ ca mahattvaṃ ca yato vastuvyapekṣayā // MAnuv_2,2.63cd //

NYĀYASUDHĀ:
akhiletyanuvartate /
aṇutvaṃ ca mahattvaṃ cākhile vastuni vidyete /
natu viruddhe /
katham /
yato vastuvyapekṣayāṇutvaṃ ca mahattvaṃ ca tadevocyata iti yojanā /


*7,312f.*

etaduktaṃ bhavati /
syādayaṃ paramāṇvādiṣvakhiladravyeṣvaṇutvamahattvāṅgīkāre virodho yadi rūpe nīlatvapītatvavatparimāṇe 'ṇutvamahattvādijātiyogaḥ syāt /
nacaivam /
pramāṇābhāvāt /
kintu yathā tryaṇukādiṣu mahattvamekajātīyameva, utkarṣāpakarṣavatpareṇāṅgīkṛtam /
yathācāṇutvaṃ paramāṇudvayaṇukayoḥ /
evaṃ parimāṇamavāntarajātirahitameva sarvadravyeṣūtkarṣāpakarṣavadvartate /
tathā caikatra dravye vartamānaṃ parimāṇaṃ dravyāntaravartyutkṛṣṭaparimāṇāpekṣayāṇutvamityucyate /
tadeva dravyāntavartino 'pakṛṣṭaparimāṇasyāpekṣayā mahattvamityucyate /
evañca kuto virodhaḥ /
yathā khalvekameva dravyaṃ dravyabhedāpekṣayā sannikṛṣṭaṃ viprakṛṣṭaṃ cocyamānaṃ

na virodhāspadam /
ata eva pratyakṣatvāpratyakṣatvavirodho 'pyapāstaḥ /
tayormahattvādimātranimittatve hi sa syāt /
na caivam /
kintu puruṣāṇāmindriyapāṭavanimittatvameva /
anyathā mandavilocanenāpi tryaṇukamupalabhyeta /
tarhi gaganāderapi kadācitpratyakṣatvaṃ syāditi cenna /
udbhūtarūpābhāvāt /
dvayaṇukānupalambho guṇaviśeṣaviparyayādhīnaḥ ālokendriyasannikṛṣṭacākṣuṣadravyānupalambhatvāt /
pavanānupalambhavadityādikaṃ tvapakṛṣṭamahattvādinaivānyathāsiddham /
tarhi parvatāderapratyakṣatā syāt iti cenna /
apakarṣaviśeṣasya vivakṣitatvāt /
nāsau vyavasthito 'stīti cet /
satyam /
ata eva puruṣāpekṣayetyuktamiti /


*7,318f.*

astvevaṃ parimāṇe 'vāntarajātyabhāvastathāpi na sarvatra mahattvāṇutvabhyupagamo yujyate /
utkṛṣṭāpakṛṣṭaparimāṇāpekṣayā hi madhyavarti parimāṇamaṇutvaṃ mahattvaṃ cocyata ityuktam /
tacca dvayaṇukādiparimāṇe sambhavati /
naca paramāṇuparimāṇe /
nahi paramāṇuparimāṇādapakṛṣṭaṃ parimāṇamasti /
yadapekṣayā tanmahattvaṃ syāt /
ataḥ paramāṇoraṇutvameva /
tathāca na mahattvaṃ cetyasadityata āha- tāratamyeti //

*7,319*

tāratamyasthitā yasmāt padārthāḥ sarva eva ca // MAnuv_2,2.64ab //

NYĀYASUDHĀ:
yasmātsarve 'pi padārthāḥ parimāṇatāratamyenaiva sthitāḥ /
svaparimāṇāpekṣayotkṛṣṭāpakṛṣṭaparimāṇavantaḥ /
sarvāṇyapi dravyāṇi kutaścitparimāṇādutkṛṣṭena parimāṇena upetānīti vā /
tasmātparamāṇorapi mahattvaṃ yujyate iti sambandhaḥ /
ayamatra prayogaḥ /
paramāṇuḥ kutaścidutkṛṣṭena parimāṇena yuktaḥ, svaparimāṇāpekṣayāpakṛṣṭaparimāṇavāniti vā, dravyatvāttantuvaditi /
naca paramāṇorapakṛṣṭadravyābhāvādbādhitaviṣayatvam /
tadbhāgānāṃ vakṣyamāṇatvāt /
naca teṣveva vyabhicāraḥ /
teṣāmapi bhāgavattvāt /


*7,321*

tadevaṃ paramāṇudvayaṇukādiparimāṇānāṃ vaijātyasyābhāvādyuktaṃ sautramanumānamiti siddham /
yadyapi vaijātyamaṅgīkṛtyāpi kāryakāraṇabhāvaḥ śakyopapādanaḥ /
anyathā saṅkhayāyā apyakāraṇatvāpatteḥ /
parimāṇasyaivamiti niyamasya nirmūlatvāt /
tathāpi vastusthitireva vaktavyeti /
parimāṇatvāvāntarajātyapākaraṇena sajātīyatāmupapādyānumānaṃ samāhitamiti jñātavyam /


*7,322*

paramāṇorapyutkṛṣṭaparimāṇāśrayatvamuktaṃ tadākṣipati- yatheti //

yathā mahattvaviśrāntistathāṇutvasya ceṣyate // MAnuv_2,2.64cd //
parimāṇatvataścen ... // MAnuv_2,2.65a //


NYĀYASUDHĀ:
yathā mahattvasya viśrāntistathā parimāṇatva(to)hetoraṇutvasya ca viśrāntiriṣyate cediti yojanā /
atra mahattvāṇutvaśabdābhyāṃ parimāṇotkarṣāpakarṣāvucyete /
tābhyāṃ ca tattāratamyamupalakṣyate /

parimāṇatvata iti //
parimāratāratamyatvādityarthaḥ /
tatācāṇau siddhe 'ṇutvasiddhistatsiddhau ca tat(aṇutva)siddhiriti parasparāśrayadoṣaḥ parāstaḥ /
tadayamarthaḥ /
parimāṇāpakarṣatāratamyaṃ kvacidviśrāntaṃ parimāṇatāratamyatvāt parimāṇotkarṣatāratamyavadityanumānena parimāṇāpakarṣatāratamyasya kvacidviśrāntisiddhau yatredaṃ viśrāntaṃ yataḥ paramāṇurnāsti sa paramāṇuriti parimāṇāpakarṣakāṣṭhāśrayatayā siddhasya paramāṇoḥ kathamutkṛṣṭaparimāṇākhyamapi mahattvaṃ sādhayituṃ śakyam /
dharmigrāhakapramāṇena svavacanena (ca) vyāghātāditi /


*7,323*

atra vaktavyam /
keyaṃ kvacidviśrāntirnāma /
kimiyattāparicchedaḥ, tryaṇukaparimāṇāt ṣaṣṭhabhāga eva parimāṇaṃ, na tato 'pakṛṣṭamastīti, kiṃvā kvaciddravye vṛttiḥ, apakarṣatāratamyamiyattāvacchedarahitameva kintvanantāṃśopetamapi tatsarvaṃ kvacidāśritameveti /

tatrādye sādhye dṛṣṭāntaḥ sādhyavikala ityāha- neti //

... na mahattvasyāpi viśramaḥ // MAnuv_2,2.65ab //


*7,324*

NYĀYASUDHĀ:
dṛṣṭāntīkṛtasya mahattvasya parimāṇotkarṣatāratamyasyāpi viśramaḥ uktarūpo nāsti /
na kevalaṃ pakṣasyetyaperarthaḥ /
kuto nāstītyata āha- dṛśyata iti //

dṛśyate 'nanta ityeva ... // MAnuv_2,2.65c //

NYĀYASUDHĀ:
parimāṇotkarṣataratamabhāvo 'nanto 'navadhika ityeva dṛśyate /
na tviyattāparicchedavāniti /
bādhakapramāṇasadbhāvātsādhakābhāvāccetyarthaḥ /
kālātyayāpadiṣyaṃ cāsminpakṣe 'numānamityāha- tatheti //

... tathānantyamaṇāvapi // MAnuv_2,2.65d //

NYĀYASUDHĀ:
tathāśabdo dūṣaṇasamuccaye /
na kevalaṃ parimāṇotkarṣataratamabhāvo 'nanta iti dṛśyate /
kintvasāvaṇau parimāṇāpakarṣatāratamye 'pyānantyamanavadhikatvaṃ dṛśyata ityarthaḥ /


*7,326*

dṛśyate 'nanta ityeva'; itīyattāparicchedo na dṛṣṭānte dṛśyata iti evaśabdena uktam /
tadviśadayati- neti //

na mahattatvaguṇata etāvāniti hīśvaraḥ /
paricchinnas ... // MAnuv_2,2.66a-c //


NYĀYASUDHĀ:
mahattvamiti dravyaviśeṣasyevaṃ (syaiva) saṃjñā /
tena ānmahata ityeṣa vidhirna bhavati /
"dṛṣṭānugatirhi saṃjñāchandasoḥ'; iṣyate /
yathā'ha"bahulaṃ taṇi'; iti /
guṇaśabdo 'tra tantreṇa dviḥ upāttaḥ /
tatrādyasya parimāṇākhyo guṇaviśeṣo 'rthaḥ /
dvitīyasya guṇanam īśvara iti paramamahattvāśrayadravyopalakṣaṇam /
parimāṇotkarṣatāratamyasyeyattāparicchedo hi tathā sati dṛṣṭaḥ syāt /
yadi mahattattvādiparimāṇagaṇanayeśvarādiḥ etāvānpañcaguṇaparimāṇavān ṣaḍguṇaparimāṇavānveti paricchinnaḥ syāt /
nacaivam /
tathā sati paramamahattvānupapatteriti hiśabdārthaḥ /


*7,327*

atra mahattattvagrahaṇenedaṃ sūcayati /
yaduktaṃ vaiśeṣikādibhiḥ pṛthivyādīni navaiva dravyāṇi iti tadasat /
mahadahaṅkārādīnāmapi sattvāt /
naca tatra pramāṇābhāvaḥ /
śrutyādeḥ pramāṇasya vidyamānatvāt /
naca tryaṇukādikameva tathocyate /
avyaktatvādiśravaṇāt /
naca bādhakaṃ kiñcit vidyate /
yenopacārakalpaneti /
īśvaragrahaṇena jīvātmanāmapi yatparaiṣaḥ paramamahattvamuktaṃ tadasaditi sūcayati /
upapādayiṣyate khalvaṇutvaṃ jīvasyeti /


*7,329*

dṛṣṭānte viśramābhāvopapādanasya prayojanamāha- tatheti //

... tathāṇośca naitāvadbhāgatā kvacit // MAnuv_2,2.66cd //

NYĀYASUDHĀ:
yato dṛṣṭānta etāvadguṇameva parimāṇamutkṛṣṭate nāto 'dhikamiti vākyaṃ nāsti /
atastathā taddṛṣṭāntena aṇoḥ aṇutvasya parimāṇāpakarṣasya caitāvadbhāgatā tryaṇukaparimāṇāt ṣaṣṭhabhāga eva parimāṇamapakṛṣṭate nāto 'dhikamitīyattā kvaciddravye na siddhayati /
nahi mahāhradaṃ sapakṣīkṛtya parvate 'gnimatvaṃ śakyasādhanam /
tadasiddhau ca na vivakṣitārthalābhaḥ /
asmādetāvadbhāgameva parimāṇamapākṛṣṭate nāto 'dhikamityasyārthasya hi siddhāvapakarṣakāṣṭhāśrayabhūtaṃ kutaścidapyanutkṛṣṭamāṇaṃ dravyaṃ siddhayatīti /

yadvānena vākyena pratipakṣamāha /
tathāhi /
samarthitaṃ tāvatparimāṇotkarṣatāratamyaṃ na kvacidviśrāntamasmādetāvadguṇameva parimāṇamutkṛṣṭata itīyattābhāvāditi /
tathā taddṛṣṭāntenāṇoścaitāvadbhāgatā kvacinnāstīti sādhyata iti /
atrāyaṃ prayogaḥ /
parimāṇāpakarṣatāratamyaṃ kvacinna viśrāntam parimāṇatāratamyatvāt parimāṇotkarṣatāratamyavaditi /


*7,330*

dvitīyaṃ śaṅkate- viśrānta iti //

viśrānto yadyanantāṃśaḥ kaścidastīti gamyate // MAnuv_2,2.67ab //

NYĀYASUDHĀ:
viśrānta ityasya tryaṇukādyapekṣayā parimāṇato 'nantāṃśo dravyaviśeṣaḥ kaścidastītyartha iti dvitīyapakṣo gamyate 'bhyupagamyate yadītyarthaḥ /
idamu(etadu)ktaṃ bhavati /
parimāṇāpakarṣatāratamyamiyattānavacchinnameva /
kintvanantāṃśarūpamapi tatkvacidāśritamiti /
nirākaroti- neti //


*7,331*

nāvasāyayituṃ śakyo virodhādeva kevalam // MAnuv_2,2.67cd //

NYĀYASUDHĀ:
tarhīti śeṣaḥ /
kaściditi vartate /
evaṃ sādhane kaścidapi dravyaviśeṣo nāvasāyayituṃ śakyaḥ /
ayameva sarvato 'pakṛṣṭaparimāṇavānnāto 'pakṛṣṭaparimāṇo 'stīti sarvāntimatayā na pratipattuṃ kaścicchakyate /
kutaḥ kevalaṃ sākṣādvirodhāt /
parimāṇāpakarṣo 'nantaśca paryavasitaśceti hi vipratiṣiddhametat /
bhavitavyaṃ cāvasānena /
anyathā sarvasyāpyutkṛṣṭāpakṛṣṭaparimāṇasambhavena paramāṇormahattvanirākaraṇāsambhavāt /
evaśabdena virodhasyāparihāryatvaṃ sūcayati /
tadanenāpasiddhānto 'bhihito bhavati /


*7,332*

yadi cānantyamavadhīrya parimāṇāpakarṣatāratamyaṃ kvacidāśritamityeva pratijñārthaḥ syāt /
tathāpi na sisā(ṣā)dhayiṣitamavasānaṃ labhyata ityarthāntaratā syāt /
yathā'kāśāderutkṛṣṭaparimāṇaṃ dravyaṃ nāsti tathā paramāṇorapakṛṣṭaparimāṇaṃ dravyaṃ nāstīti tātparyārthaṃ iti cet /
satyam /
nāyamito labhyata iti ucyate /
parimāṇāpakaṣartāratamyaṃ kvacinniratiśayam parimāṇatāratamyatvātparimāṇotkaṣartāratamyavaditi vivakṣitamiti cet /
ko 'yamatiśayo nāma /
kimādhikyamuta nyūnatā /
atha sādhāraṇaṃ kiñcit /
ādye bādhaḥ /
dvitīye dṛṣṭāntasya sādhyavikalatā /
na tṛtīyaḥ /
tadabhāvāt /
śabdasāmyamātreṇānumānāpravṛtteḥ /
yathā'kāśādiparimāṇamubhayāvadhimanna bhavati /
tathā tryaṇukāvayavāvayavaparimāṇamapi sādhyamiti cenna /

hetvabhāvāt /
parimāṇatvasya ghaṭādiparimāṇe vyabhicārāt /
nityaparimāṇatvasyāśrayānityatāyā vakṣyamāṇatvenāsiddheḥ /
parimāṇakāṣṭhatvasya ca sādhyatvāt /
evaṃ tātparyāntarāṇyapi nirākāryāṇīti /


*7,337*

parimāṇotkarṣatāratamyasyānantatvaṃ dṛśyata ityuktam /
tatkena pramāṇenetyāśaṅkaya kālākāśeśvarādīni hi dravyāṇi paramamahattvayantīṣyante /
tatra kālākāśayostāvatparimāṇotkarṣasyānantyaṃ sākṣisiddhamityāha- kevalamiti //

kevalaṃ sākṣimānena kālo deśo 'pi nāntavān // MAnuv_2,2.68ab //

NYĀYASUDHĀ:
kevalaśabdena pramāṇāntarābhāvaṃ pratijānīte /
deśa ityākāśa ucyate /
nāntavānityanavadhikaparimāṇotkarṣavān /
dṛśyata iti vakṣyamāṇamatrāpi sambaddhayate /
kālākāśau hi kevalaṃ sākṣi(vedya)siddhāvityupapāditaṃ prathamādhyāye /
atastatparimāṇotkaṣarsyānavadhikatvamapi tenaiva gamyata iti /


*7,338*

parimāṇāpakarṣatāratamyasyāpyānantyaṃ dṛśyata ityuktam /
tatkena pramāṇenetyāśaṅkaya kālākāśayostāvatsākṣiṇaivetyāha- aparyavasitaśceti //

aparyavasitiścāṇordṛśyate sakṣiṇā dvayoḥ // MAnuv_2,2.68cd //

NYĀYASUDHĀ:
dvayoḥ kāle gagane ca /
aṇośca parimāṇāpakarṣatāratamyasya cetyarthaḥ /
aparyavasitiḥ ānantyam /

nanvetadanupayuktam /
paramāṇuparimāṇato 'pakṛṣṭaparimāṇasadbhāve pramāṇopanyāsasya kāryatve kālāvakāśayoḥ parimāṇotkarṣānantye pramāṇopanyāsasya prayojanābhāvāditi /
maivam /
nahi pareṇa sākṣādevamuktam /
kintu parimāṇotkarṣaparamparāvattadapakaṣarparamparāpi paryavasānavatīti /
tathāca kālākāśayoḥ parimāṇotkarṣāpakarṣaparamparāyāḥ paryavasānābhāve sākṣipramāṇopanyāsaḥ kathamasaṅgataḥ /
nanvastu kālākāśayoḥ parimāṇaprakarṣo 'navadhikaḥ /
tadapakarṣānantyaṃ tu katham /
vyāhatatvāt /
maivam /
sākṣisiddhatvāt /
pramite 'rthe virodhānavakāśāt /


*7,340*

kālādāvanavadhikaḥ parimāṇāpakarṣaḥ sākṣisiddha ityeva neṣyata iti cet /
kiṃ sākṣiṇā nāvagamyate, utāvagato 'pi na satyaḥ, athavā sākṣī nāma pramāṇaṃ nāsti /

ādyaṃ śaṅkate- yadīti //

yadi no sākṣigamyaṃ tan ... // MAnuv_2,2.69a //

NYĀYASUDHĀ:
taditi kālādeḥ parimāṇāpakarṣasyānantyaṃ sāmānyena parāmṛśati /
dūṣayati- mahattvamiti //

... mahattvaṃ kena gamyate // MAnuv_2,2.69b //

NYĀYASUDHĀ:
kālākāśayoriti vartate /
mahattvam anavadhikaḥ parimāṇotkaṣarḥ /
tarhīti śeṣaḥ /
ayamabhisandhiḥ /
kālādau parimāṇotkaṣarsyānantyamupetya hi pareṇa tadapakarṣānantyaṃ neṣyate /
tatra vaktavyam /
prakarṣānantyaṃ kena pramāṇenāvagamyata iti /
sākṣiṇeti cet /
apakarṣānantyamapi tadbalena kuto nāṅgīkṛtam /
tattena nāvagamyata iti /
sākṣiṇeti cet /
apakarṣānantyamapi tadbalena kuto nāṅgīkāryam /
tattena nāvagamyata ityuktamiti cet /
idamapi (tadapi)tena nāvagamyata iti vadantaṃ prati kimuttaram /
anubhavāpalāpo na yukta iti cet /
samaṃ prakṛte 'pi /
yathā hi kālāderutkarṣānavadhikatvamanubhave cakāsti /
tathāpakarṣānantyamapīti kimekatra pakṣapātena /
anyathaikāpalāpe dvitīyasyāpyapalāpo duruttaraḥ syāditi /


*7,341*

syādetat /
na kālādeḥ parimāṇotkarṣānantyaṃ sākṣisiddhamiti brūmaḥ /
kintu anumānagamyam /
tathāca na pratibandīgraha ityata āha- viśrāntiriti //

viśrāntistāratamyena dṛśyate hyanumānataḥ // MAnuv_2,2.69cd //

NYĀYASUDHĀ:
parimāṇotkarṣaparamparayā iti śeṣaḥ /
anumānata iti tṛtīyārthe tasiḥ /
nānumānena kālādāvanavadhikaparimārotkaṣarsiddhiḥ /
hi yasmāttāratamyenānumānena tadviśrāntirdṛśyate /
parimāṇotkarṣatāratamyaṃ iyattāvatparimāṇatāratamyatvāttadapakaṣartāratamyavaditi pratyanumānapratiruddhatvāditi yāvat /
naca dṛṣṭānto 'smākaṃ sādhyavikala iti vācyam /
apakarṣatāratamyasya antavattvamupetyotkarṣatāratamyasyānantyamanumimānasya parasyaivaṃ pratipakṣotprekṣā syādityucyamānatvāt /
tathāca sākṣiviruddhaṃ pratyanumānamiti vaktavyam /
kathaṃ tarhi sa eva kālādāvanavadhikaprakṛṣṭaparimāṇaṃ na sādhayediti /


*7,343*

astu tarhyāgamātkālādāvanavadhikotkṛṣṭaparimāṇasiddhiritayāśaṅkayāha- yadīti //

yadyāgamādanantaṃ tanmahattvamavagamyate /
anantameva cāṇutvaṃ kuto naivāvasīyate // MAnuv_2,2.70 //


NYĀYASUDHĀ:
āgamāt sa eṣo 'nanta ityādeḥ /
tanmahatvaṃ kālādiparimāṇotkarṣaḥ /
aṇutvaṃ parimāṇāpakarṣaḥ /
etadu(idamu)ktaṃ bhavati /
nāgamaḥ kālādyanantānāṃ svayaṃ pratipādayati /
tatpravṛtteḥ prāgeva sākṣiṇā tatpratibhāsāt /
kintvanuvāda evāyam /
pratipādakatve vā nāsmatprayojanaparikṣayaḥ /
yasmādāgamātkālādyutkarṣo 'navadhikaḥ pratīyate tasmādevāparṣānantyapratīteḥ /
anantaśabdo hyanavacchedamātramācaṣṭe /
sa ca yathā parimāṇotkarṣaviṣayo vyākhyāyate /
tathā tadapakarṣaviṣayo 'pi śakyate vyākhyātumiti /


*7,345*

parimāṇotkarṣavattadapakarṣasyāpi kālādāvānantyaṃ sākṣiṇā'gamena vā pratīyata eva /
tathāpi na tatsatyam /
nahi pratītatva(ti)mātreṇa satyatāniścayo 'tiprasaṅgāditi dvitīyaṃ nirākaroti- mahattveti //

mahattvāṇutvayornaiva viśrāntirupalabhyate // MAnuv_2,2.71ab //

NYĀYASUDHĀ:
kālādau parimāṇotkarṣāpakarṣayorviśrāntiriyattāvacchedo balavatpramāṇena naivopalabhyate /
atra mahattvagrahaṇaṃ dṛṣṭāntātharm /
idamuktaṃ bhavati /
yathā kālādau parimāṇotkarṣasyānantyaṃ sākṣyādyavagataṃ viparītagrāhakapramāṇābhāvātsatyameva /
tathā tadapakarṣasyāpi /
vinā bādhakena sākṣyādisiddhaṃ parimāṇāpakarṣānantya kālādāvasatyaṃ cettadutkarṣānantyamapya(kālādāva)satyaṃ syāt /
aviśeṣāt /
tataścāparicchinnaparimāṇatāṅgīkāro (bhajyeta) naṅkṣayeta /
atiprasaṅgastu bādhakābhāvenāpāsta iti /


*7,347*

nanvastyeva parimāṇāpakarṣasyānantyābhyupagame bādhakam /
tathāhi /
apakarṣo nāmālpatā /
ānantyaṃ cānalpatā /
naca viruddhayorviśeṣyabhāvaḥ sambhavati /
na hi bhavati pīto 'pīta iti /
ato bādhakasadbhāvātpratītamapyapakarṣānantyaṃ tyajyata ityata āha- anyadeveti //

anyadeva hyanantatvaṃ mahattvāṇutvayoḥ samam // MAnuv_2,2.71cd //

NYĀYASUDHĀ:
nānantatvaṃ nāmānalpatvam /
kintvanyadeva paricchedābhāvarūpam /
tasmātparimāṇotkarṣāpakarṣayoḥ samāno dharma iti yujyate /
atrāpi mahattvagrahaṇaṃ dṛṣṭāntameva /
yathā mahattvasya viśeṣaṇaṃ tathāṇutvasyāpīti /
yadyanantatvaṃ nāmānalpatvaṃ syāttadotkarṣasyāpi viśeṣaṇaṃ na syāt /
nahi tadeva tasya viśeṣaṇaṃ bhavati /
pītaḥ pīta ityadarśanāt /
atastatrānantyaṃ nāma paricchedābhāva iti svīkṛtya viśeṣaṇaviśeṣyabhāvaḥ samarthanīyaḥ /
tathā prakṛte 'pīti /
yathā hi parimāṇotkarṣo gaganādāvanadhikastathā tadapakarṣo 'pyanavadhika eveti viśeṣaṇaviśeṣyabhāvābhyupagame na ko 'pi doṣa iti /


*7,355*

ānantyaṃ nāmānalpatvādanyadityetatpratyayayituṃ dṛṣṭāntāntaramāha- bahutveti //

bahutvālpatvayoryadvat sāṅkhayāyāmupalabhyate /
ānantyam ... // MAnuv_2,2.72a-c //


NYĀYASUDHĀ:
yadvat yathā saṅkhayāyāṃ bahutvālpatvayorviśeṣaṇatayā'nantyamupalabhyate /
bahutvamanantamalpatvaṃ cānantamiti /
tathā prakṛte 'pīti /
yadyanantvaṃ nāmānalpatvaṃ syāt tadā na bahutvasya viśeṣaṇaṃ syāt /
tasyaiva tadviśeṣaṇatvāyogāt /
nāpyalpatvasya, virodhāt /
ataḥ avacchedābhāva evānantatvamityaṅgīkṛtya bahutvamalpatva(cānanta)cāparyavasitamiti viśeṣaṇaviśeṣyabhāvo boddhavyaḥ /
tathā parimāṇotkarṣāpakarṣayorapīti /


nanu ca nāstyeva saṅkhayāyāṃ bahutvālpatvayorānantyam /
bahutvasya parārdha eva paryavasitatvāt /
alpatvasya caika(ā)tvāvadhitvam /
yathoktam /
"sā caikatvādiparārdhaparyantā'; iti /
ataḥ kathamayaṃ dṛṣṭānta ityata āha- eketi //

... ekabhāgānāṃ tāvattvaṃ hyeva gaṇyate // MAnuv_2,2.72cd //


*7,356*

NYĀYASUDHĀ:
saṅkhayāmadhikṛtya hi gaṇitaśāstraṃ pravṛttam /
tatra ca kalāsavaṇarnaprabhāgabhāgānubandhabhāgāpavāhabhāgabhāgādiprakaraṇeṣvekabhāgānāṃ tāvattvamanavadhikatvaṃ gamyate hi yasmāttasmādavagamyate astyekatvādapyapakṛṣṭānavadhikā saṅkhayeti /
parārdhātparato 'pi saṅkhayāsadbhāvaḥ sphuṭa eveti nopapāditaḥ /
sambhavati hi pareṣāmapīśvarāpekṣābuddhayā paramāṇvādau parārdhātparato 'pi saṅkhayotpattiḥ /
tataḥ paraṃ saṃjñākaraṇaṃ tu gaṇakānāṃ prayojanābhāvāt /
etāmeva vipratipattimapanetaṃ saṅkhayādṛṣṭāntopādānaṃ kṛtamiti /


*7,357*

evaṃ kālākāśayoḥ parimāṇotkarṣāpakarṣānantyaṃ sākṣiṇā prasādhyeśvare tadāgamena sādhayati- aṇīyāṃśceti //

aṇīyāṃśca mahīyāṃśca bhagavānāgamoditaḥ // MAnuv_2,2.73ab //


*7,358*

NYĀYASUDHĀ:
"aṇoraṇīyānmahato mahīyānātmā'; ityāgamena bhagavānīśvaro 'ṇorapyaṇīyānmahato 'pi mahīyānuditaḥ /
naca tatrāṇumahacchabdābhyāṃ kiñcidvayavasthitamucyate /
viśeṣaṇābhāvāt /
tato yadyapakṛṣṭaparimāṇaṃ tatastato 'pyapakṛṣṭaparimāṇo yadyaccotkṛṣṭaparimāṇaṃ tatastato 'pyutkṛṣṭaparimāṇa ityuktaṃ syāt /
tathā ceśvaragatayo parimāṇotkarṣāpakarṣayoranavadhikatvameva labhyate /

nanvaṇīyānmahīyānityukta eva bhagavati parimāṇotkarṣāpakarṣayoḥ paryavasānātkathaṃ tayoḥ anavadhikatvamityata āha- aṇīyāniti //
aṇīyānmahīyānityuktayorapyaṇormahataśceti śabdaviṣayatvāditi /


*7,359*

nanvevaṃ sati svasmādapi svayamapakṛṣṭa utkṛṣṭaścetyāgatam /
ko netyāha /
yathā caitattathā vakṣyate /

śrutyantaraṃ ceśvare parimāṇotkarṣāpakarṣayorānantyaṃ pratipādayadastītyāha- ānantyeti //

ānantyavācakaḥ śabdo dvidhānantye 'pi mānatām // MAnuv_2,2.73cd //
yāti ... // MAnuv_2,2.74a //


NYĀYASUDHĀ:
"satyaṃ jñānamanantaṃ brahma'; iti brahmaṇa ānantyasya vācako 'nantaśabdastāvaddeśataḥ kālato vastutaścānantyamāha /
tatra deśānantyaṃ nāmānavadhikaparimāṇavattvam /
kālānantyaṃ nāmānavacchinnasattākatvam /
vastvānantyaṃ nāmāparicchinnasaṅkhayāguṇakarmavigrahavattvam /
tatra yadā parimāṇānantyasya vācakastadā dvidhānantye 'pi utkarṣāpakarṣābhyāmanantye 'pi mānatāṃ yāti /
na tūtkarṣānantyamātre viśeṣābhāvāditi /
nanvanekārthatvamanyāyaḥ /
ko 'tra nyāyavirodhaḥ /
nirarthakaśabdaprayogāyogāttāvadeko 'rtho 'ṅgīkāryaḥ /
dvitīyāṅgīkāre tu na kiñcidbījamiti kalpanāgauravam /
ucyate /
yatra hyekasminnarthe vyavasthite sati vṛthaivārthāntarāṅgīkārastatraivametat /
nacaivaṃ prakṛte /
anantaśabdo hi paricchedābhāvamāha /
paricche(daśca)do hi deśataḥ kālato vastutaśca bhavanyupagapadeva prāpnoti /
naca tatra kasyacinprāthamyamasti /
nāpyanyatamaparityāge kāraṇam /
evaṃ parimāṇāntye 'pyutkarṣaparigraho draṣṭavya iti /


*7,362*

nanvevaṃ kālato guṇataścānantyavācakasyānantaśabdasyālpakālatvamalpaguṇatvaṃ cārthaḥ syāt /
anyathālpaparimāṇavattvamapi na syāt /
aviśeṣāditi cet /
kimidaṃ kālato guṇataścālpatvamāpādyaṃ kimalpā eva guṇāḥ santi brahmaṇo na bahutarāḥ /
tathā alpakālīnaiva sattā na pracurakālīneti /
kiṃvā sarvakālagatasyālpakāle 'pyavasthitiḥ syāt /
mahāguṇasya cālpo 'pi guṇaḥ syāditi /

ādyaṃ dūṣayati- naiveti //

... naiva guṇālpatvaṃ kālātpatvaṃ ca mānagam // MAnuv_2,2.74ab //

NYĀYASUDHĀ:
guṇālpatvaṃ kālālpatvaṃ ca mānagam /
anantaṃ brahmeti śrutipratipādyaṃ naiva bhavediti gūḍhābhisandheḥ pratijñā /
hetumuttaratra vakṣyati /

dvitīyamāśaṅkayāṅgīkaroti- sarveti //

sarvakālagatasyālpakāle 'pi syādavasthitiḥ // MAnuv_2,2.74cd //
mahāguṇasya cālpo 'pi guṇaḥ syāditi ced bhavet // MAnuv_2,2.75ab //


NYĀYASUDHĀ:
iticedāpādyate /
tadbhavedetyarthaḥ /
atra guṇagrahaṇaṃ kriyāderapyupalakṣaṇam /
guṇakālayoryatheṣyamupādānaṃ prāthamyanirāsātharm /
tenoktakalpanāgauravaparihāraṃ sūcayati /


*7,364*

nanu yadi kālālpatvaṃ guṇālpatvaṃ cāṅgīkriyate /
kathaṃ tarhi naiva guṇālpatvamiti nirākaraṇamityato 'bhisandhimudghāṭayati- tāvattvameveti //

tāvattvameva naiva syād ... // MAnuv_2,2.75c //

NYĀYASUDHĀ:
alpatvamevetyarthaḥ /
ityuktaṃ prāgiti śeṣaḥ /
kuto na syāditi cet /
āpādakābhāvādityāha- deśe 'pīti //

... deśe 'pyetanna no matam // MAnuv_2,2.75c //
NYĀYASUDHĀ:
parimāṇe 'pītyarthaḥ /
etat tāvattvameva /
naḥ asmākam /
etaduktaṃ bhavati /
parimāṇaviṣaye 'smadīyaṃ śrutivyākhyānamupalabhya hi guṇakālayorapyetadāpādyate /
āpādakāntarābhāvāt /
naca parimāṇe 'smābhirevaṃ vyākhyāyate /
apakṛṣṭameva parimāṇamanavadhikamasti notkṛṣṭamiti /
dvidhānantye 'pītyuktatvāt /
ato nirmūlametadāpādanamiti /


*7,365*

nanvetadīśvarāderanavadhikotkṛṣṭāpakṛṣṭaparimāṇasamarthanamayuktam /
sūtrakāreṇa kvāpyanuktatvāt /
mahaddīrghavadveti sūtrasya vijātīyayorapi kāryakāraṇabhāvopapādanena vyadhikaraṇayorapyaparicchinnaparimāṇotkarṣāpakarṣayorupapādanena vā samarthayituṃ śakyatvādityata āha- mahata iti //

mahato 'lpatvamapi hi vyomavat prāha vedavit // MAnuv_2,2.76ab //

NYĀYASUDHĀ:
niravadhikaparimāṇotkarṣavato('pi) brahmaṇo 'lpaparimāravattvaṃ ca vyomaṃ dṛṣṭāntīkṛtya vyomavacceti sūtrakhaṇḍena prāha- sūtrakāraḥ /
ato brahmaṇo gaganasya vānavadhikaparimāṇarotkarṣāpakarṣasadbhāvastatsiddhānto bhavatyeveti /


*7,368*

kiñca yo 'rtho niravakāśapramāṇasiddho yadviparyaye cāniṣyaṃ sa sarvo 'pi siddhānta eva /
tatra kālākāśayorī(rapī)śvare cānavadhikaparimāṇotkarṣāpakarṣasadbhāvaḥ sākṣiṇā'gamena ca siddha ityuktam /
tadviparyaye bādhakamāha- yadīti //

yadyalpadeśasaṃsthānaṃ na sarvatrāpi no bhavet // MAnuv_2,2.76cd //

NYĀYASUDHĀ:
kālāderiti vartate /
sarvatrāpi saṃsthānamiti ca /
kālādīnāṃ sarvagatatvaṃ pareṇāpyaṅgīkṛtam /
sarvagatatvaṃ ca sarva(tra)deśe saṃsthānam /
tathāca yadi kālāderalpālpataradeśeṣu saṃsthānaṃ na syāt /
tadā sarvatrāvasthānamapi no bhavet /
kuta ityata āha- sthitasya hīti //

sthitasya hyalpadeśeṣu sarvagatvaṃ bhaved dhruvam /
ekatrāpyanavasthasya kuta evākhilasthatā // MAnuv_2,2.77 //


NYĀYASUDHĀ:
dhruvamityavadhāraṇe /
alpadeśeṣu sthitasyaiveti /
yathā khalvekaikaṃ varṇamuccārayata eva savardevoccāraṇam /
natvekamapi varṇamanuccārayataḥ, tathālpālpataradeśeṣu sthitasyaiva hi sarvadeśagatatvaṃ bhavet /
ekaikatrāpi deśe 'navasthitasyākhiladeśasthatā kuta eva bhavet /
anena yo yatsamudāyaṃ vyāpnoti sa tadekadeśānapi vyāpnoti(tyeva), yaścaikadeśānna vyāpnoti nāsau tatsamudāyamityanvayavyatirekau darśitau /


*7,370*

na kevalamalpālpataradeśasthatvābhāve sarvagatvābhāvaprasaṅgaḥ /
kintu śaśaviṣāṇādivatsattāpi na syādityāha- śūnyatvameveti //

śūnyatvameva tasya syād yasyaikatrāpi na sthitiḥ // MAnuv_2,2.78ab //

NYĀYASUDHĀ:
evaṃca kālādīnāmalpālpataradeśāvasthāne 'lpālpataraparimāṇavattvamapyavarjanīyamityanavadhikaparimāṇāpakarṣasiddhiḥ /
anavadhikotkarṣastu pareṇāpyaṅgīkṛta eveti na tadviparyaye bādhakamuktam /
sarvatrāpi no bhavedityeva vā draṣṭavyam /
nahi paramamahattvābhāve sarvagatatvaṃ sambhavati /
tathācāha-"vibhutvānmahānākāśaḥ'; ityādi /
alpālpataradeśaparyavasitasyālpālpataraparimāṇatvam /
na caivamākāśādīti cet /
tatkimākāśādi samuditarūpaṃ yena paryavasānāparyavasānaviṣayatvamaśnuvīta /
kintvekameva /
tacca yadyalpālpataradeśeṣu tiṣṭhettadā tattatparimāṇaṃ bhavatyeva (bhavedeva) /
yadi tava tatra sthitasya tattatparimāṇatvaṃ tadā ghaṭādāvapi tatprasaṅga iti cenna /
tasya sāṃśatvenānyathāsiddhatvāt /


*7,372f.*

nanu ca sarvamūrta(dravya)saṃyogitvameva sarvagatatvaṃ, na sarvatra saṃsthānam /
ākāśāderanāśritatvāt /
saṃyogaśca tattatparimāṇābhāve('pi bhavedeva /
nahi ghaṭo gaganena saṃyujyamāno bhavati paramamahānnāpi paramāṇunā saṃyujyamānaḥ paramāṇuḥ /
tatkasya hetoḥ /
saṃyogasya pradeśavṛttitvāditi /
maivam /
sarvaparimāṇānāmapyākāśe sattvātparamāṇunā ca ghaṭāṃśasyaiva saṃyogāt /
tathāhi /
viśeṣaśaktayā, nirbhedamapyākāśamanantāṃśopetam /
tatra anavadhikau parimāṇotkarṣāpakarṣau vyavasthayā vartete /
tataśca ghaṭo vitastiparimāṇenaivākāśena saṃyujyate /
svayaṃ ca tatparimāṇa iti ko doṣaḥ /
ghaṭāṃśa eva paramāṇusaṃyogo vartate, na ghaṭa iti kathaṃ ghaṭasya paramāṇutā /
tarhyākāśapradeśā evālpālpatarapradeśasaṃyogina iti, ta eva tattatparimāṇāḥ syurnākāśamiti cenna /
teṣāmapyākāśātmakatvāt /
anyathā saṃyogasya pradeśavṛttitvaṃ na syādvayāghātāditi /


*7,378*

kālādau parimāṇotkarṣāpakarṣayorānantyamupapādyopasaṃharati- ata iti //

ato nāṇutvaviśrāntirna mahattvasya ca kvacit // MAnuv_2,2.78cd //

NYĀYASUDHĀ:
kvacit kālādau traye /
yadvānumānadūṣaṇopasaṃhāro 'yam /
tataśca kālātītatvadṛṣṭāntadoṣāvaparihāryāviti /

kālākāśeśvareṣu parimāṇotkarṣāpakarṣayorānantyamastītyuktam /
na kevalaṃ teṣveva /
kintu prakṛtyādau sarvagate paramamahati dravyāntare 'pītyāha- ubhayeti //

ubhayānantyayuk tasmād yadi mukhyamahad bhavet // MAnuv_2,2.79ab //


*7,379*

NYĀYASUDHĀ:
tasmādiṣūktanyāyāt /
mukhyaṃ mahat paramamahat /


yadi kālāderapyānantyaṃ syāt /
kathaṃ tarhi satyaṃ jñānamanantaṃ brahmetyānantyaṃ brahmaṇo lakṣaṇatvenocyate /
na hyativyāptaṃ lakṣaṇaṃ bhavatītyata āha- tacceti //

tacca brahma paraṃ sākṣāt sarvānantyayutaṃ sadā // MAnuv_2,2.79c //

NYĀYASUDHĀ:
paramiti kevalārthe /
yadyapi kālādikamapyanantaṃ, tathāpi brahmaiva tadanantamityucyate /
kutaḥ /
sākṣāt parānapekṣayānantatvāt /
aparādhīnatvāpekṣayeti yāvat /
pakṣāntaramāha- sarveti //

... sarvānantyayutaṃ sadā // MAnuv_2,2.79d //

NYĀYASUDHĀ:
nāsyāṃ śrutāvānantyamātraṃ lakṣaṇatvenocyate /
kintu deśataḥ kālato guṇāditaśca /
tādṛśaṃ ca brahmaiveti na doṣaḥ /
yathoktam"deśataḥ kālataścaiva guṇataśca tridhā tatiḥ /
sā samastā harereva na hyanye pūrṇasadguṇāḥ'; iti /
pakṣāntaramanvācinoti- sadeti //
pūrveṇaiva sambandhaḥ /
tathāca kālakṣaṇeṣu deśato 'nanteṣvapi nātivyāptiriti /


*7,382f.*

paramāṇāvapi parimāṇāpakarṣatāratamyaviśrāntirnāstītyuktam /
tadasat /
parimāṇasya dravyāśrayatvāt /
paramāṇuto 'pyapakṛṣṭaparimāṇāśrayasya dravyasyābhāvāt /
maivam /
paramāṇubhāgānāṃ sattvāt /
naca teṣu viśrāntiḥ /
teṣāmapi (bhāgasattvāt) sabhāgatvāt /
aviśrāntabhāgaparamparā kutaḥ siddhetyataḥ sākṣiṇeti vaktuṃ sākṣī nāma pramāṇameva nāstīti vadato bādhakaṃ tāvadāha- yadīti //


*7,383*

yadi sākṣī svayambhāto na mānaṃ kena gamyate /
akṣajādeśca mānatvam ... // MAnuv_2,2.80a-c //


NYĀYASUDHĀ:
sākṣī nāma mānaṃ yadi neṣyate tadākṣajāderjñānasya mānatvam /
caśabdādbahiḥ kālākāśādikamantaḥsukhādikaṃ ca kena pramāṇena gamyate /
na kenāpi /
tadgrāhakasya pramāṇāntarasya abhāvāt /
naca tanmā bhūditi vācyam /

tadvayavahāravilayaprasaṅgāditi /

nanvastu sākṣiṇamanaṅgīkurvāṇasyedaṃ bādhakam /
sādhakaṃ (tu) kimityata āha- svayambhāta iti //
yastu svayaṃ prakāśamāne 'pi sākṣiṇi vipratipadyate so 'kṣajādermānatvaṃ sapramāṇakaṃ vastutvādghaṭavaditi prasaṅgasūcitenānumānena bodhanīyaḥ /
prasaktapratiṣedhaśca vakṣyamāṇanyāyena bhaviṣyati /
dhamirgrāhakapramāṇenaiva siddherna tatprāmāṇye pṛthak pramāṇaṃ vaktavyam /
ata eva mānamityuktam /


*7,385*

na sākṣiṇo 'nabhyupagame 'pyakṣajādijñānaprāmāṇyamaprāmāṇikaṃ prasajyate /
pravṛttisāmarthyena tajjātīyatvena vānumānena tatsiddherityata āha- anavastheti //

... anavasthāthavā bhavet // MAnuv_2,2.80d //

NYĀYASUDHĀ:
anyathā sākṣītarapramāṇavedyatvāṅgīkāre /
tarhi sākṣiprāmāṇyamapyanyena grāhyamityanavasthaiveti cenna /
tasya svaprakāśatvāditi /
tadidamuktaṃ svayambhāta iti /


*7,386*

kimato yadyevaṃ sākṣī nāma pramāṇamastītyata āha- ata iti //

ataḥ sarvapadārthānāṃ bhāgāḥ santyeva sarvadā /
sarvadikṣvapi sambandhād ... // MAnuv_2,2.81a-c //


NYĀYASUDHĀ:
sākṣita ityarthaḥ /
sarvapadārthānāṃ paramāṇostadbhāgānāṃ cetyarthaḥ /
santyeva iti siddhamiti śeṣaḥ /
yadvā sarvapadārthānāmityanenānumānamapi sūcayati /
paramāṇuḥ sabhāgaḥ padārthatvādghaṭavat iti /
nacāśrayāsiddhirdharmigrāhakavirodho vā /
sākṣiṇā paramāṇusiddheruktatvāt /
tena ca sabhāgatayaiva siddheḥ /
na caivamanumānavaiyarthyam /
pramāṇasamplavāṅgīkārāt /
sabhāgatvamātre vipratipannaṃ prati sārthakyācca /
anumānāntaramāha- sarvadeti //

yugapadityarthaḥ /
sarvadikṣu sthitairdravyaiḥ sambandhātsaṃyogādapi bhāgāḥ santītyavagamyate /
yadyapi sabhāgatvamātrasādhane saṃyogitvamātraṃ prayojakam /
gaganādīnāmapi bhāgāṅgīkāreṇa vyabhicārābhavāt /
tathāpi bahubhāgasādhanāya viśeṣaṇopādānam /
tathāhi /
paramāṇurdaśabhāgavānyugapaddaśamūrtasaṃyogitvāt (pa)ghaṭavaditi /


*7,390*

nanu dravyatvenaivālaṃ kiṃ saṃyogitvena /
(hetūcchittirūpa) vipakṣe bādhakasūcanārthamiti brūmaḥ /
tathāhi /
asti tāvatparamāṇoḥ paramāṇvantarasaṃyogaḥ /
anyathā dvayaṇukādyārambhānupapatteḥ /
na caikenaiveti niyamaḥ /
kāraṇākāraṇasaṃyogajasaṃyogaprakriyāyāmekaikasya paramāṇoḥ sajātīyavijātīyaparamāṇudvayena yugapatsaṃyogasyorarīkṛtatvāt /
pāṣāṇādimadhyavartinaḥ paramāṇoḥ parito 'sthitaiḥ paramāṇubhiḥ saṃyogābhāvādyanupapatteśca /
naca mūrtānāṃ yugapadekadeśāvasthānaṃ sambhavati /
pradeśavartinaśca saṃyogāḥ /
sākṣisiddhatvāt /
ghaṭādau taddarśanena ca paramāṇau(ṇāvapya0tadanumānācca /
tathāca yadi paramāṇuranekāṃśo na syāt, tadā yugapadanekairna saṃyujyateti /

nanu saṃyogasya pradeśavṛttitvaṃ nāma svātyantābhāvasamānadeśatvameva /
natu ghaṭasaṃyogo ghaṭāvayave vartata iti /
tatkathaṃ bhāgābhāve saṃyogānupapattiriti /
maivam /
pratyakṣādisiddhasya avayavṛttitvasya parityāgenāprāmāṇikavyāhatāṅgīkārasyānucitatvāt /
vakṣyate caitat /


*7,399*

nanu paramāṇuḥ sāvayava iti svavyāghātasya mukhyamudāharaṇam /
yo hi sarvataḥ apakṛṣṭo yataḥ paramāṇurnāsti taṃ paramāṇumācate /
tasya sāvayavatve 'vayavino 'vayavānāmapakṛṣṭaparimāṇatvāvaśyambhāvātkathaṃ na vyāhatirityata āha- avibhāga iti //

... avibhāgaḥ parāṇutā // MAnuv_2,2.81d //
NYĀYASUDHĀ:
syādayaṃ virodho yadīdaṃ paramāṇupadapravṛttinimittaṃ syāt /
nacaivam /
sāvayavatayā sākṣisiddhe tadasambhavāt /
kintu avibhāgaḥ parāṇutā paramāṇuśabdapravṛttinimittam /
tathāca kuto vyāghāta iti /
nanvavibhāga iti kathamidaṃ vijñāyate /
sarvathā vibhāgalakṣaṇaguṇābhāva iti cenna /
guṇāderapi paramāṇutvaprasaṅgāt /
dravyatve satīti viśeṣaṇādadoṣa iti cenna /
asambhavāt /
yatkiñcidvibhāgābhāvābhiprāye merumandarayorapyaṇutvaprasaṅgāt /
avayavavibhāgābhāvo 'bhimata iti cenna /
maivam /
yasya vibhinnāvayaveṣu satsvapi teṣāṃ vibhāgo na kadāpi bhavitumarhati sa paramāṇuriti vyākhyānāt /
etenāvayavaparamparāvi(śrāntyabhā)śramābhāve 'navasthetyapi parāstam /
mūlakṣayābhāvasya sūcitatvāt /


*7,407*

yadvā vibhidyate vibhajyate iti vibhāgaḥ /
tadabhāvaḥ paramāṇuteti /
yataḥ svāvayavaṃ vinā svatantramanavayavarūpamapakṛṣṭaparimāṇaṃ (vastu)nāsti sa paramāṇuriti yāvat /


*7,413*

nanvevamavayavaparamparāviśrāntyabhāve 'nantāvayavārabdhatvāviśeṣātsarṣapamahīdharayoḥ parimāṇāviśeṣaḥ syāt /
naca kāraṇasaṅkhayāviśeṣe 'pi tatparimāṇapracayaviśeṣātsarṣapamahīdharayoḥ parimāṇaviśeṣa iti vācyam /
avayavānantyasāmye tayorapyanupapatteriti /

ucyate /
kimayaṃ prasaṅgaḥ, utānumānam /

ādye hyayamarthaḥ /
yadi sarṣapamahīdharāvaviśrāntāvayavaparasparau syātāṃ tadā anantāvayavārabdhau prasajyeyātāt /
tathāca samaparimāṇau bhavetāmiti /
tatrobhayatrāpi vyāptyabhāvaḥ /
yadaviśrāntāvayavaparasparaṃ tadanantāvayavārabdham /
yaccaivaṃ tattulyaparimāṇamiti /
kinnāma bhavatopalabdham /
kiñcāvayavaparamparāviśrāntyabhāva te sarve 'pi sambhūyānantāḥ syuḥ /
saṣarpamahīdharārambhakāṇāmānantyaṃ tu kutaḥ /
ata eva dvitīyaprasaṅgasyāpādakāsiddhiḥ /
etenāvayavaparamparāviśrāntyabhāve samasaṅkhayāvayavārabdhatvaṃ tataścāvayavaparimāṇādiviśeṣābhāve parimāṇāviśeṣaḥ syāditītyapi parāstam /
vyāptyasiddheḥ /
samasaṅkhayāvayavārabdhatvāsiddheśca /

dvitīye tvidamuktaṃ syāt /
sarṣapamahīdharau nānantāvayavārabdhau visadṛśaparimāṇatvāt /
vimatau nāviśrāntāvayavaparamparau anantāvayavānārabdhatvāditi /
ādye siddhasādhanam /
nahi sarṣapāderavayavaparamparāviśrāntyabhāvādinānantāvayavārabdhatvamaṅgīkṛtam /
kintu sambhūtānāmanantatvam /
tadabhāvasādhane māṃ prati dṛṣṭāntābhāvaḥ /
guṇādau sādhanābhāvāt /
dvitīyasya tvaprayojakateti /


*7,417*

syādetat /
sarṣapāvayavaparamparāyā niravadhikatve mūrtānāṃ samānadeśatvānupapattau sarṣapāvayavairjagati vyāpte viśvavyāpī sarṣapaḥ syāditi mahīdharasyānavakāśa evetyāpādanārthaṃ iti cenna /
pārthivaparamāṇūnāmanantatve 'pisa mūrtāntarāvakāśadarśanāt /
sarṣapo yāvantaṃ deśamavaṣṭabhya vartamāno dṛśyate tāvatyevānavadhikāyā api tadavayavaparamparāyā avasthānācca /
ata eva hi ākāśādīnāmapyanavadhikamaṃśaparamparāmupetya tatra parimāṇāpakarṣānantyamupapāditam /


*7,418*

nanu mā bhūtsākṣātsarṣapamahīdharārambhakāṇāṃ samasaṅkhayatvam , tathāpyavayavaparamparāyā viśrāntyabhāve sambhūtāvayavānāṃ samasaṅkhayatvātparimāṇabhedo na syādi(tyucyata iti)ti cenna /
ānantye 'pi tāratamyasambhavāt /
anantā hi pārthivaparamāṇavo 'nantāścāntyaviśeṣāḥ /
naca te samasaṅkhayāḥ /
tathā satyāpyaparamāṇuṣu tadabhāvāpātāt /
tathā sarvakalpeṣu saṃsāriṇo 'nantāḥ /
tathāpyapavargavaśāttāratamyamupeyameva /
evamanekamudāharaṇamiti /


*7,421*

yadetatsūtrakṛtā parimāṇāsamavāyikāraṇaviṣaye dūṣaṇamuktam /
tadupalakṣaṇamātram /
anyatrāpyasamavāyikāraṇe svayaṃ dūṣaṇānyūhanīyānītyāśayavāndravyāsamavāyikāraṇasaṃyogaviṣaye anyathāpratipattiṃ nirākaroti- tatsaṃyogāditi //

tatsaṃyogādaniyatāt padārthānāṃ janirbhavet // MAnuv_2,2.82ab //

NYĀYASUDHĀ:
avayavasaṃyogo dravyāsamavāyikāraṇamiti vadanto 'pi vaiśeṣikādayaḥ paramāṇukāryotpattau dvayoreva sajātīyayoreva paramāṇvoreva saṃyoga(syāsamavāyikā)sya kāraṇatvamityādyacakṣate /
tadaśraddheyam kinnāma teṣāṃ kāraṇānāmaniyatāduktaniyamarahitātsaṃyogātpadārthānāṃ dravyāṇāṃ janirbhavet /
kiñcitkāryaṃ dvayoḥ paramāṇvoḥ saṃyogādupajāyate /
taddvayaṇukamucyate /
kadācit trayāṇāṃ tattryaṇukaṃ caturbhiḥ paramāṇubhirārabdhaṃ ca(tacca)turuṇukam /
evamanyadapi /
tathā kiñcitsajātīyayoḥ paramāṇvoḥ saṃyogātkiñcidvijātīyayoḥ /
evaṃ kiñcitparamāṇvoreva saṃyogātkiñcitparamāṇudvayaṇukayorityādi /
evaṃ dvayaṇukakāryotpattaśavapyaniyamo draṣṭavyaḥ /


*7,422*

kuta iti cet uktaniyame pramāṇābhāvādityāha- dvayoreveti //

dvayoreva tu saṃyoga iti kenāvasīyate // MAnuv_2,2.82cd //

NYĀYASUDHĀ:
tuśabdo viśeṣārthaḥ /
tena sajātīyayoḥ paramāṇvoriti niyamo labhyate /
saṃyogaḥ ādikāryasyāsamavāyikāraṇamiti śeṣaḥ /
kena pramāṇenetyākṣepe /
upalakṣaṇametat /
trayāṇāmeva dvayaṇukānāmityapi draṣṭavyam /
nanu sāvayavasyānekasaṃyogaḥ sambhavati /
paramāṇustu niravayava iti dvayoreveti niyamasiddhirityuktottaram /
niravayavatve dvayorapi saṃyogo na sambhavati /
saṃyogasyāṃśavṛttitvāt /


*7,423*

nanu sajātīyasaṃyoga evārambhaka iti niyamo na niṣpramāṇakaḥ /
paramāṇukārye gandhādyutpattereva tatra pramāṇatvāt /

tathā hi /
pārthivāpyaparamāṇubhyāṃ yadyekaṃ kāryamutpadyate tadā tadagandhamasnehamāpadyeta /
pārthivataijasābhyāmutpannamagandharūpamutpadyeta /
ekasya gandhāderanārambhakatvāt /
ato gandhādyutpattyaiva sajātīyasaṃyogasyārambhakatvasiddhirityata āha- kāraṇasyeti //

kāraṇasya guṇāstena bhaveyuḥ kāryagā api // MAnuv_2,2.83ab //

NYĀYASUDHĀ:
teneti //
dvayoreveti niyamābhāvenetyarthaḥ /
syādetadvijātīyārambhakatve bādhakam /
yadi dvayoreva paramāṇvoḥ saṃyogaḥ kāryārambhaka iti niyamaḥ pramāṇavānsyāt /
na caivam /
tathāca bahūnāṃ paramāṇūnāṃ vijātīyānāṃ saṃyogātakāryārambhe kāraṇagatā gandhādayo guṇāḥ (sadvitīyāḥ) sajātīyāḥ santaḥ (kāryagāḥ) kāryagatagandhādyārambhakā api bhaveyuḥ, ko doṣaḥ /


*7,430*

nanvaniyamavādinā dvayasaṃyogasyārambhakatvaṃ tāvadiṣyate /
tatra vijātīyayorārambhakatve kārye gandhādyanutpattiḥ prasajyata iti cenna /
ekaikasyāpi gandhāderārambhakatve bādhakābhāvāt /
apekṣaṇīyāntarābhāvātsantotpattiprasaṅgo bādhaka iti cenna /
kāryadravyotpatterapekṣaṇīyatvāt /
samavāyikāraṇābhāve kāryānutpādāt /
anyathānekagandhādyabhyupagame 'pi samāno doṣaḥ /

etacca paramatarītyoktam /
vastutastu yataḥ kāraṇānyeva kāryākāreṇotpadyante tena kāraṇaguṇā eva kāryagā bhaveyuḥ /
tataśca vijātīyārambhakatve ko doṣaḥ /
evaṃ tarhi pṛthivītvādijātisaṅkaraḥ syāditi cet /
tataḥ kim /
vyavahāravilopaḥ syāditi cenna /
"vaiśeṣyāttu tadvāde'; iti parihariṣyamāṇatvāt /
tathāpi sampratipannasajātīyārabdha(kārya)dṛṣṭāntena vipratipannānāmapi sajātīyārabdhatvamanumāsyata iti cenna /
vijātīyārambhakatvasya sākṣyādipramāṇasiddhatvena bādhāt /


*7,432*

syādetat /
yadi bahūnāṃ paramāṇūnāṃ saṃyogasyārambhakatvaṃ syāt /
nacaivam /
ārambhakasaṅkhayāpakarṣatāratamyaṃ kvacidviśrāntam /
tāratamyatvāt parimāṇatāratamyādityanumānenārambhakasaṅkhayāpakarṣasya kvacidviśrāntisiddhāvekasyārambhakatve santatotpattyādiprasaṅgāttryādikalpane gauravād dvayoreva paramāṇvoḥ saṃyogo dravyārambhaka iti niyamasiddherityata āha- tāratamyeti //

tāratamyena sarve 'pi mahāntaścāṇavo yataḥ // MAnuv_2,2.83cd //

*7,432f.*

NYĀYASUDHĀ:
yataḥ kāraṇāttāratamyena sarve 'pyarthā mahāntaścāṇavaśca samathirtāḥ tataḥ parimāṇatāratamyavaditi dṛṣṭāntasya sādhyavikalatvāt dvayoreva tu saṃyoga itrata kenāvasīyata iti sambandhaḥ /
kiñcānenaiva nyāyena dvayaṇukadvayasaṃyogasyāpyārambhakatvaṃ kiṃ neṣyate /
bahutvābhāve kāryamahattvānupapattiprasaṅgāditi cenna /
yatastāratamyena sarve 'pi mahāntaścāṇavaśca samarthitāḥ tena dvayaṇukamahattvāttadutpattyupapatteḥ /
paramāṇudvayārabdhakāryadṛṣṭāntena sarvatrānumāne tvatiprasaṅga iti /


*7,434f.*

astvevamuktaniyameṣu pramāṇābhāvastathāpyaniyamasṛṣṭau kiṃ mānamiti cet /
sākṣī tāvat /
loṣṭhādikāryāṇāmaniyatasaṅkhayairvijātīyaivirsadṛśaiścārambhadarśanenānumānaṃ ca /
āgamāścātra bahulaṃ bhavanti /
taddarśanaṃ bhrāntiriti cet /
kiṃ niyamagrāhakapramāṇavirodhādevamucyate /
uta kevalayā vaiśeṣikādikalpanayā virodhāt /


*7,435*

ādyaṃ dūṣayati- naceti //

naca tatproktasṛṣṭau tu mānaṃ ... // MAnuv_2,2.84ab //

NYĀYASUDHĀ:
sajātīyābhyāmeva dvābhyāmeva paramāṇubhyāmevetyādiniyamavatyāṃ tatproktasṛṣṭau tu mānaṃ nāsti tat sākṣyādisiddhasyāsmadabhimatasṛṣṭiprakārasya bādhakaṃ syāt /
tathācoktam (prāk) /

dvitīyaṃ dūṣayati- kevaleti //

... kevalakalpanā /
kathaṃ sākṣimitasyāsya śaknuyād vāraṇe kvacit // MAnuv_2,2.84b-d //


NYĀYASUDHĀ:
nirmūletyarthaḥ /
sākṣītyupalakṣaṇam /
asya aniyamārambhasya /
kalpanāmātrasya prāmāṇikanivārakatve 'tiprasa(ṅga iti)ṅgāditi bhāvaḥ /


*7,437*

atra tatproktasṛṣṭāviti sāmānyato vadatānyadapi tatkalpitamaprāmāṇikamiti sūcitam /
tathāhi"prakṛtemarhānmahato 'haṅkāro 'haṅkārātkrameṇākāśādīni mahābhūtāni'; ityetāṃ śrutyādiprasiddhāṃ prakriyāmapahāya vāyvādīnāṃ caturṇāmanyonyānapekṣaiva sṛṣṭirvyutkrameṇa cābhihitā /
vinaiva bādhakena"ākāśādvāyurvāyoragniḥ'; ityādipañcamī bhāktī svīkṛtā /
atyantāsata eva ca janiraṅgīkṛtā /
sarvāpi sṛṣṭiḥ samavāyyādikāraṇatrayādhīnābhyupagatā /
tatra samavāyikāraṇaṃ samavāyāprāmāṇikatvasya vakṣyamāṇatvādayuktam /
ata evāsamavāyikāraṇamapi /
tadadhīnanirūpaṇatvācca tallakṣaṇasya /
samavāyinimittayorativyāpteśca /
tathāhi /
tantupaṭayoḥ utpannasya dvitvasya paṭaḥ samavāyikāraṇam /
sa ca dvitvasamavāyikāraṇe tantau samavetatvāt samavāyikāraṇapratyāsannaḥ /
samavāyikāraṇatayāvadhṛtasāmarthyaśca /
śarīrātmanorutpannasya dvitvasyāpekṣābuddhirnimittam /
sā ca dvitvasamavāyikāraṇātsamavetatvānnimittatvāccoktalakṣaṇasampannā /
samavāyikāraṇapratyāsannatayā sāmarthyāvadhāraṇamabhi(hi)matam /
naca tathā prakṛta iti cet /
tathāpi vyāpyabuddhervyāpakabuddhiṃ prati viṣayabuddherdharmādharmayośca sukhaduḥkhe pratyasamavāyikāraṇatvāpatteḥ /
nahyanyagataṃ vyāpyabuddhayādyanyagatasya vyāpakabuddhayādernimittaṃ bhavati /
ātmani pradeśabhedānneti cenna /
ādyādiśabdānāṃ dvitīyādiśabdasamavāyikāraṇatvābhāvāpatteḥ /
ekākāśagatatvena tatsambhave prakṛte 'pi samānam /


*7,440*

evamanyatrāpyativyāptirūhanīyā /
saṅketo 'yamācāryasya /
ato nātīvātra nirbandhaḥ karaṇīya iti cet /
evaṃ tarhi nimūlaiveyaṃ prakriyeti siddhameva /


*7,447*

pākajaprakriyāṃ cāprāmāṇikamaṅgīkurvanti /
ta(tra)cca vakṣyata ityalam /


*7,448*

nanu paramāṇudvayaṇuke eva tāvanna sākṣisiddhe kutastadīyārambhaprakāraḥ /
tatkathamuktaṃ sākṣimitasyeti /
tatrāha- yadīti //

yadi sākṣimitaṃ naitan ... // MAnuv_2,2.85a //

NYĀYASUDHĀ:
etaditi //
paramāṇvādikam /
tarhi tadaprāmāṇikamevāpadyata iti śeṣaḥ /
syādetat /
yadyapi mahattvābhāvānna paramāṇvādikaṃ cakṣurādergocaraḥ /
bahissvātantryānmanaso 'pi /
āgamādi tu nānumānādbhidyate /
bhede 'pyatīndriye saṅketānupapatternāgamasya viṣayaḥ /
tathāpyanumānaṃ tatra (pramāṇaṃ) bhaviṣyati /
tatkathaṃ paramāṇvādeḥ sākṣivedyatvābhāve 'prāmāṇikatvāpattirityata āha- neti //

... nānumā tatra vartate // MAnuv_2,2.85b //

NYĀYASUDHĀ:
kathamiti cet /
kiṃ paramāṇvādikameva pakṣīkṛtya tatsādhyate /
utānyat /


*7,451*

ādye tatpramāṇāntarataḥ siddhaṃ na vā /
pakṣadvaye doṣamāha- pakṣīkartumiti //

pakṣīkartumaśakyatvāt kuta evānumā bhavet // MAnuv_2,2.85cd //

NYĀYASUDHĀ:
siddhatve pakṣalakṣaṇābhāvādasiddhatve nyāyāviṣayatvātparamāṇvādeḥ pakṣīkartumaśakyatvāt tatpakṣīkāreṇānumā dūranirasteti /

nanu pakṣīkaraṇāsambhave kathamanumānānupapattirityata āha- yatreti //

yatra nāsti padanyāsaḥ kastaṃ viṣayamāpnuyāt // MAnuv_2,2.86ab //

NYĀYASUDHĀ:
yathā tathetyadhyāhartavyam /
yatra yadviṣaye /
viṣayaṃ deśam /
yathā hi viṣayaprāpteḥ padanyāsaḥ kāraṇam /
sthāṇvasthāṇusaṃyogasyāsthāṇukriyāhetu(ka)tvāt /
ataḥ padanyāsābhāve viṣayaprāptirapi nāsti /
tathānumotpattau pakṣīkaraṇaṃ kāraṇam /
nahi parvatādirvā vahnayādirvā anumānasya viṣayaḥ /
kintu tatsambandhaḥ /
naca sambandhijñānena vinā sambandhajñānaṃ sambhavati /
ataḥ pakṣīkaraṇābhāve nānumānotpattiḥ sambhavatīti /


*7,452*

dvitīyamapi nirākaroti- pakṣīkartumiti //
dvayaṇukaṃ hi pakṣīkṛtya paramāṇuranumātavyaḥ /
kāryamevātra pramāṇamityuktatvāt /
taccedānīmapyasiddhamiti pakṣīkartumaśakyatvātkuta eva tatkāraṇaparamāṇvanumā bhavet /

anumitaṃ dvayaṇukaṃ pakṣīkṛtya paramāṇuranumāsyata iti cenna /

tadapi hi paramāṇuṃ pakṣīkṛtya yadi sādhyate tadokta eva doṣa ityāha- pakṣīkartumiti //
adyāpyasiddhasya paramāṇoḥ pakṣīkartumaśakyatvātkuta eva tatkāyardvayaṇukānumā bhavet /
nanvaṇuparimāṇatāratamyaṃ kvacidviśrāntaṃ parimāṇatāratamyatvānmahatparimāṇatāratamyavadityanumānena paramāṇusiddhirbhaviṣyatīti cenna /
vikalpānupapatteḥ /
aṇuparimāṇaśabdena kiṃ parimāṇāpakarṣo 'bhidhīyate, kiṃvā paramāṇuparimāṇam, yadvā dvayaṇukaparimāṇam, yadi vobhayaparimāṇam /
nādyaḥ /
dūṣitatvāt /
uttarapakṣatrayaṃ dūṣayati- pakṣīkartumiti //
paramāṇudvayaṇukayorasiddhau tatparimāṇasyāpyasiddheḥ /
ekaikatra tāratamyasyābhāvācceti bhāvaḥ /


*7,452f.*

yadidaṃ jālasūryamarīcisthaṃ sarvataḥ sūkṣmatamaṃ raja upalabhyate tattryaṇukamityucyate /
tadidaṃ mahat, cākṣuṣadravyatvāt, ghaṭavat /
kāryaṃ ca mahattve sati cākṣuṣatvāt mahatve sati kriyāvatvādvā /
sāvayavaṃ ca kāryadravyatvāt /
tadavayavāśca dvayaṇukanāmānaḥ /
te 'pi kāryāḥ sāvayavāśca, mahaddravyārambhakatvāt tantuvat /
yaśca tadavayavaḥ sa eva paramāṇuḥ tadavayavakalpanāyāṃ pramāṇābhāvādbādhakasadbhāvācca /
ato 'numānenaiva paramāṇudvayaṇukasiddhirityata āha- pakṣīkartumiti //
pratyakṣasya tryaṇukasyaiva paramāṇutvasambhavena tatkāryatvasāvayavatvasādhānāya pakṣīkartumaśakyatvātkuta eva dvayaṇukaparamāṇvoranumā bhavet /


*7,455*

mahattvātkathamasau paramāṇuriti cenna /
mahattvāsiddheḥ /
cākṣuṣadravyatvāttatsiddhiriti cenna /
kasyacidamahato 'pi cākṣuṣatve bādhakābhāvāt /
mahattvaṃ ca dravyacākṣuṣatāyāṃ kāraṇamiti cet /
satyam /
kvacidanyadapi kāraṇaṃ kalpayiṣyate /
gauravaṃ tathā sati syāditi cenna /
dharmikalpanāto dharmamātrakalpanāyāḥ laghutvāt /
astu vā mahattvam /
tathāpyaṇutvena tasya samāveśe ko virodhaḥ /
kāryatvasādhanaṃ cāprayojakam /
mahato 'pyātmanaḥ pratyakṣavaccākṣuṣatvopapatteḥ /
paramamahattvābhāvena kriyāsambhavācca /
mahattvasya kāraṇabahutvaṃ kāraṇamiti cenna /
nityatvopapatteḥ /
cākṣuṣamahattvānneti cenna /
bādhakābhāvāt /
ata eva kāryadravyatvamasiddham /
santu vā tadavayavāsta eva paramāṇava iti teṣāṃ punaravayavasādhanāya pakṣīkartumaśakyatvātkuta evānumā bhavet /
nanu mahaddravyārambhakatvātte 'pi sāvayavā eveti cenna /
niravayavasya ma(hā)haddravyārambhakatve bādhakābhāvāt /
bahutvenaiva mahattvārambhopapatteḥ /
dravyārambhe sāvayavatsyānupayogāt /
santu vā dvayaṇukāvayavāste 'pi kutaḥ paramāṇavaḥ /
mahaddravyārambhakatvena teṣāmapi sāvayavatvānumānāt /
anavasthā bādhiketi cenna /
tadavayavānāṃ tadavayavāvayavānāṃ vā niravayavatvena tadviśrānteḥ /
kathaṃ ceyamanavasthā dūṣaṇam /
merusarṣapādīnāṃ samaparimāṇatvāpattistu dūṣitā /
ghaṭādikāryānutpattiriti cenna /
sāvayavasyaiva nityatvopapatteḥ /
yathoktam /
avibhāgaḥ pa(raṇu)ramāṇuteti /


*7,460*

evaṃ paramāṇudvayaṇukayoranumānataḥ siddhimapākṛtya prasaṅgādākāśādiparimāṇotkarṣānantyasyānumānikatvaṃ na yujyata iti yaduktaṃ tatprapañcayati- deśāntareti //

deśāntarādiśabdaśca śaśaśṛṅgādiśabdavat // MAnuv_2,2.86cd //

NYĀYASUDHĀ:
yo 'yaṃ yojanādiparicchinno deśaḥ sampratipannaḥ, sa svataḥ sthūlena deśāntareṇa yukto deśatvāddhastādideśavadityādyanumānaiḥ khalvākāśādiparimāṇotkarṣānantyaṃ sādhanīyam /
ta ete deśāntarādiśabdāḥ /
deśāntarādisādhakānumānaprayogāḥ /
śaśaśṛṅgādiśabdavat śaśaśṛṅgādisādhakānumānaprayogaistulyaṃ vartante /
anenaiva prakāreṇa śaśaśṛṅgādikamapyanumātuṃ śakyata iti yāvat /
śabdamātramevaitat /
na tvanumānamiti sūcayituṃ śabdā ityuktam /
na kevalamākāśādīnāṃ parimāṇotkarṣānantyānumānaṃ pratipakṣaparāhatam /
api tu sampratipannāni sarvaśṛṅgviśṛṅgāntaravanti śṛṅgatvādgośṛṅgavat /
vimatāḥ sarve putrāḥ putrāntaropetāḥ putratvāddevadattaputravaditi śaśaśṛṅgādisādhakānumānābhāsasamānayogakṣemaṃ cetyarthaḥ /


*7,461f.*

na vayamevamākāśādiparimāṇotkarṣānantyamanumimīmahe /
yenātiprasaṅgaḥ syāt /
kintu vipratipanno deśaḥ svataḥ sthūlena sadṛśena sajātīyena vā dravyāntareṇa yukto deśatvāddhastādideśavat /
so 'pyevaṃ so 'pyevam /
evaṃ kāle 'pyanumātavyam /
nacaivaṃ śaśaśṛṅgānumānaṃ śakyam /
tasyātyantāsato 'nupalabhyamānasya gavādiśṛṅgeḥ sādṛśyasājātyayorabhāvāt /
naca ākāśāderapyekaikatvātsādṛśyādyabhāvaḥ /
aupādhikabhedena tadupapatterityata āha- sadṛśaṃ ceti //


*7,462*

sadṛśaṃ ca sajātīyaṃ nāsmatpakṣe kimeva hi // MAnuv_2,2.87ab //

NYĀYASUDHĀ:
sampratipannadeśādinā sadṛśaṃ sajātīyaṃ (cā)vāsmatpakṣe gaganādiparimāṇotkarṣānantyamanabhyupagacchatāṃ pakṣe kimeva na bhavati /
kintu bhavatyeveti /
tathāca sampratipannadeśasya tataḥ sthūlenātmanā sadṛśena sajātīyena vopetatvasya siddhatvātsiddhasādhanatā syāt /
ākāśādiparimāṇotkarṣānantyāsiddherarthāntaratā ceti /
sampratipannadeśasyeśvarādimattvaṃ bādhitaṃ sambandhābhāvāditi cenna /
deśāntareṇāpi sambandhābhāvāt /
etena śaśaviṣāṇādisādhakānumāne 'pi bādhābhidhānaṃ parāstam /
deśāntarānumāne 'pi sāmyāt /
tadevaṃ paramāṇudvayaṇukayorākāśādiparimāṇotkarṣāntyasya ca sākṣisiddhatāmanaṅgīkṛtya kevalānumānavedyatvasvīkaraṇamanupapannamityuktam /


*7,464*

evamāgamamanādṛtyeśvaradharmādyanumānamapyayuktamiti prasaṅgādāha- yenaiveti //

yenaiva ca prakāreṇātyasiddhamanumīyate /
tenaiva śaśaśṛṅgādeḥ śakyamastitvakalpanam // MAnuv_2,2.87c-f //


NYĀYASUDHĀ:
atyasiddhamityanenāgamānādaraṃ darśayati /
śaśaśṛṅgāderityaprāmāṇikasyopalakṣaṇam /
etacca tatra tatra leśato darśitam /


*7,471*

na(ca) śaśaśṛṅgādyanumānapratibandīgrastatvamātreṇaiteṣāmanumānānāmaprāmāṇyaṃ yuktam /
tathā sati dhūmānumānasyāpyaprāmāṇyaprasaṅgāt /
tatrāpi hi śakyate vaktuṃ yadi dhūmavattvātpavarto 'gnimāṃstadā paśutvācchaśo 'pi viṣāṇavānyasyāditi /
athocyeta /
tulyayogakṣematve hi pratibandīgrahaḥ /
anyathātiprasaṅgāt /
nacātra tulyayogakṣematā dhūmānumānasya vyāptyādisāmarthyasahitatvāt /
śaśaśṛṅgādyanumānasya tadabhāvāditi /
samametatprakṛte 'pi /
prastutānumānānāmapi vyāptyādimattvādityata āha- pratyakṣamiti //

pratyakṣamāgamo vāpi bhaved yatra niyāmakaḥ /
saiva vyāptirbhavenmānaṃ nānyā sandigdhamūlataḥ // MAnuv_2,2.88 //



*7,471f.*

NYĀYASUDHĀ:
vāśabdaḥ samuccaye /
apiranumānasya samuccayārthaḥ /
niyāmako grāhakaḥ /
mānam anumānamānatvopayoginī /
anyā pratyakṣādyagṛhītā /
sandigdhamūlataḥ sandigdha(gdhā)vyabhicāratvataḥ /
avyabhicāro hi sāhityasya vyāptitve mūlam /
tatra pratyakṣagṛhītā vyāptiryathā dhūmasyāgninā /
āgamagṛhītā yathā /
brāhmaṇo na hantavya iti /
anumānagṛhītā yathā /
vyatirekiprayoge /
etaduktaṃ bhavati /
pratyakṣādyavadhṛtaṃ hi vyāptyādi anumānamānā(natā)ṅgam /
na svayamātrasiddham /
sandigdha(gdhā)vyabhicā(ra)ritvāt /
samayānāṃ sandigdhamūlatvācca /
vidyate ca dhūmādyanumānānāṃ pramāṇāvadhṛtaṃ vyāptyādīti na pratibandīgrahamātreṇa tadbhaṅgaḥ /
na paramāṇvādyanumānānāmiti pratibandīgrastatvādaprāmāṇyameva /
nanu vyāptyādyabhāve kiṃ pratibandīgraheṇa /
tata evāprāmāṇyasiddheriti /
satyam /
pratyakṣādyanavadhṛtavyāptyāderapi prāmāṇye 'tiprasaṅgo vā tadaprāmāṇye dṛṣṭānto vā pratibandīgraheṇa dyotyata ityadoṣa iti /


*7,474*

satyametatpratyakṣādyavadhṛtaiva vyāptiranumānaprāmāṇyopayoginīti /
sā ca dhūmānumāvatparamāṇvādyanumāneṣvapyastyeva /
dhūmasyāgnineva mahadārambhakatvādīnāmapi sāvayavatvādinā sāhityadarśanādityata āha- saheti //

sahadarśanamātreṇa na vyāptiravasīyate // MAnuv_2,2.89ab //

NYĀYASUDHĀ:
na dhūmādīmāpyagnyādibhiḥ sahadarśanamātreṇa vyāptiravasīyate /
yena mahadārambhakatvādīnāmapi sāvayavatvādibhistato 'vasīyeta /
tathā satyagnyādīnāṃ dhūmādibhirapi vyāptyadhyavasāyaprasaṅgāt /
sahadarśanamātrasya tatrāpi sattvāt /
vyabhicārānupalambhe sati sāhityadarśanaṃ vyāptyadhyavasāyaheturiti cet /
kiṃ sakaladeśakālaniṣṭho 'nupalambhaḥ, kiṃ vā tadviśeṣaniṣṭhaḥ /

nādyaḥ /
asmadādyaśakyatvāt /
na dvitīyaḥ /
atiprasaṅgāditi /


*7,475*

kathaṃ tarhi vyāptyadhyavasāyaḥ syādityata āha- yadaiveti //

yadaivāvyatirekasya hyakṣajaṃ vāgamo bhavet /
tannirdhāritayuktirvā vyāptiḥ saivāparā nahi // MAnuv_2,2.89c-f //


NYĀYASUDHĀ:
avyatireke sādhyābhimatavyatirekeṇāsattve /
asya sādhanābhimatasya dharmasya yuktervyāptiniścayahetutve 'navasthā (syā)nāt /
tadvayāpterapi yuktyantareṇa niścetavyatvādityata uktam-

tannirdhāriteti //
vyāptiśabdo 'dhyāhāryaḥ /
tena pratyakṣeṇāgamena vā nirdhāritavyāptiketyarthaḥ /
aparā sāhityadarśanamātranibandhanā na hi /

ayamarthaḥ /
niyataḥ sambandho hi vyāptirna sambandhamātram /
niyamaśca vyabhicārābhāvaḥ /
ataḥ sāhitya iva vyabhicārābhāve 'pi pramāṇapravṛttau vyāptisiddhiḥ /
nacaitadaśakyam /
anumityanudaye sarvavyavahāravilopaprasaṅgena kāryadarśanādeva tatsiddheḥ /
prakārastu cintyate /
tatra dhūmasyāgninā sambandhastāvatpratyakṣeṇāvagamyate /
paricitadeśakālayorvyabhicāraśca nāvagamyate /
deśāntarādigate tu vyabhicāre sandeho 'vaśiṣyate /
sa ca na tāvadvayabhicāracihnadarśanajanyaḥ /
kintu bhūyaḥsahacaritatayā dṛṣṭā adṛṣṭavyabhicārā api dharmā vyabhicāriṇo dṛṣṭāḥ /
dharmaścāyamityevamutpadyate /
tatra yadyayametatsahavṛttisvabhāvastadānyatrāpi sahaiva varteta /
svabhāvasyānapāyāt /
yadi cāsahavṛttisvabhāvastadātrāpi na saha varteta /
asahavṛttisvabhāvasyāpi sahavṛttirnimittāntarāyattā cedatropalabhyeta /
sahavṛttisvabhāvasyāpi nimittāntarādvayabhicāro bhaviṣyatīti tu nirbījā śaṅkāṃ nodetyeva /
sarvavyavahārābhāvaprasaṅgāt /

tadevaṃ mīmāṃsāsahakṛtaṃ pratyakṣaṃ dhūmasyāgnisambandhaṃ gṛhṇadvayabhicārābhāvamapyākalayatīti vyāptimavadhārayatyeva /
anumānāgamābhyāṃ tu vyāptigrahaprakāraḥ su(gama)graha eveti /


*7,479*

nanvanenaiva nyāyena mahadārambhakatvādīnāmapi vyāptiniścayasambhavātkathaṃ paramāṇvādāvanumānāpravṛttiriti cenna /
pakṣetaratvasyopādhitvasambhavena vyabhicārābhāvāniścayāt /
atha tasyopādhitvaṃ nāstītyucyeta dāta bādhakamāha-
anyatheti //

anyathā saptamarasabhavo 'pyanumayā'patet /
aniṣṭāni ca sarvāṇi hyanumā kāmacāriṇī // MAnuv_2,2.90 //



*7,479f.*

NYĀYASUDHĀ:
pakṣetaratvasyopādhitāmanādṛtya pramāṇāntarāsahakṛtenaivānumānena paramāṇvādisiddhayabhyupagama ityarthaḥ /
madhuro raso lavaṇādirasapañcakavyatiriktarasānyonyābhāvavān rasatvāllavaṇādityādyanumayā /
aniṣyāni ca sarvāṇi dahanaśaityādīnyāpateyuḥ /
kutaḥ /
yasmādevaṃvidhānumā kāmacāriṇī /
nanu ca saptamarasāderanupalambhādibādhitatvātpakṣetaratvopādhiduṣṭatvamanumānānāmiti cetsamaṃ prakṛte 'pi /
paramāṇvāderapyanupalambhabādhitatvāt /
ayogyaṃ taditi cet /
tulyaṃ saptamarasādāvapi /
anumānaprāmāṇye saptamarasādisiddhāvayogyatvaṃ kalpyam /
kalpite ca tasminnanumānaprāmāṇyasiddhirityanyonyāśrayatvamiti cet /
etadapi tādṛgeva /
anupabhogyasya saptamarasādeḥ kalpane gauravamiti cet /
samādhisāmyam /
pramite na gauravaṃ doṣa ityetadapi samānam /
tasmātparamāṇvādeḥ sākṣivedyatvamaṅgīkṛtya pratibandī mocanīyeti kathaṃ na tasya sākṣivedyatvamiti /


*7,482*

samavāyābhyupagamāc ca sāmyād anavasthiteḥ | BBs_2,2.13 |

// oṃ samavāyābhyupagamācca sāmyādanavasthiteḥ oṃ //

oṃ ubhayathāpi na karmātastadabhāvaḥ oṃ //
iti sūtram /
tat"nityameva ca bhāvāt'; ityāgāmisūtravyākhyānenaiva vyākhyātaṃ bhaviṣyatīti manvānastadapahāya hetvantareṇa vaiśeṣikādisamayamapākurvan(t)"samavāyābhyupagamācca sāmyādanavasthiteḥ'; ityetatsūtraṃ vyācaṣṭe- kāryeti //

kāryakāraṇayoścaiva ... // MAnuv_2,2.91a //

NYĀYASUDHĀ:
samavāya īryata iti vakṣyamāṇamatrāpi sambaddhayate /
anena samavāyapratipādakaṃ pareṣāṃ"iheti yataḥ kāryakāraṇayoḥ sa samavāyaḥ'; iti sūtramarthato 'nuvadati /
atra kāryakāraṇaśabdāvayavāvayavivācakau /
tau copalakṣaṇaparāviti sūcanārthaścaśabdaḥ /
evaśabdaḥ samavāyasyehapratyasiddhatvaṃ sūcayati /


*7,484*

tadetatsvayameva vivṛṇoti- guṇāderiti //

... guṇādeḥ pañcakasya ca /
bhinnasyaiva tu sambandhaḥ samavāyo 'nya īryate // MAnuv_2,2.91b-d //


NYĀYASUDHĀ:
guṇādeḥ pañcakasyeti guṇāvayavikriyāsāmānyaviśeṣaṇāmityarthaḥ /
caśabdena guṇyādipañcakasya ceti samuccinoti /
nanu guṇaguṇyādikamabhinnaṃ bhinnābhinnaṃ vā tatkiṃ samavāyenetyata uktam- bhinnasyaiveti //
tuśabdo viśeṣārthaḥ /
na yayoḥ kayościdguṇaguṇinoḥ samavāyaḥ kintvayutasiddhayoreveti /
sa guṇaguṇyādisvabhāva eva cenna padārthāntarasiddhirityata uktam- anya iti //
īryate vaiśeṣikādibhiḥ, ato 'pi taddarśanamayuktamiti śeṣaḥ /

ayamarthaḥ /
vaiśeṣikādayo 'vayavāvayavinorguṇaguṇinoḥ kriyākriyāvatorjātivyaktayoḥ viśeṣanityadravyayoratyantabhedamabhyupagamyātyantabhinnameva samavāyākhyaṃ sambandhamabhyupagacchanti /
tato 'pyanupapannabhāṣiṇa iti /


*7,486*

nanu ca guṇaguṇyādīnāmatyantabhedastāvadvayapadeśabhedādipramāṇasiddhaḥ /
anyathā stambhakumbhādīnāmapyatyantabhedo na syāt /
asti ceha tantuṣu paṭaḥ, iha paṭe rūpamiha mūrte karmeha gavi gotvamiha nityadravye viśeṣa ityabādhitaḥ pratyayaḥ /
na cehedamiti pratyayo vinātiriktena sambandhenopapadyate /
iha kuṇḍe badarāṇīti pratyayasya saṃyogapūrvakatvadarśanāt /
sa cāyamayutasiddhayoḥ sambandha iti saṃyogādbhidyate /
yutasiddhayorhi sambandhaḥ saṃyogaḥ /
dravyamātravṛttiśca /
tadevaṃ pramitasya samavāyasyābhyupagame kathamayuktavāditvaṃ vaiśeṣikādīnāmityata āha- bhinnatveti //

bhinnatvasāmyatastasya tābhyāṃ yogo bhaved dhruvam // MAnuv_2,2.92ab //

NYĀYASUDHĀ:
bhinnatvasāmyata ityupalakṣaṇam /
ihapratyayasāmyataścetyapi draṣṭavyam /
tasya samavāyasya /
tābhyām avayavāvayavyādisambandhibhyāṃ saha /
yogaḥ sambandhaḥ /

etaduktaṃ bhavati /
iha tantuṣu paṭa ityādipratyayaḥ sambandhapūrvako 'bādhitehapratyayatvādiha kuṇḍe badarāṇīti pratyayavaditi samavāyamanumimānena yo 'bādhitehapratyayaḥ sa sambandhapūrvaka iti vyāptiravaśyamaṅgīkaraṇīyā /
vidyate ceha tantupaṭayoḥ samavāya ityabādhitehapratyayaḥ /
tena samavāyasyāpi tantupaṭābhyāṃ samavāyo 'bhyupagantavya eva syāt /
na cābhyupagamyate /
atastatra anaikāntikamanumānamiti /

nanu tantupaṭayoḥ samavāyaḥ siddho na vā /
siddhaścetkimuttarakālabhāvinānaikāntyena /
nacetkvanaikāntyam /
maivam /
āpātataḥ pratīte sambandhe vyabhicāraṃ dṛṣṭvā parāvṛtterāvaśyakatvasya vivakṣitatvāt /


*7,487*

nanvatra bhinnatvasāmyaṃ kimarthamupanyastam /
nahi bhinnatvaṃ hetūkṛtamiti /
satyam /
abādhitatvadyotanārthaṃ bhinnatvagrahaṇam /
vibhinnavastvabhāve khalviha pratyayo bādhitaḥ syāt /
iha tantupaṭayoḥ samavāya iti pratyayo 'pi sambandhapūrvaka eva tantupaṭasamavāyasyaitatkāraṇatvāditi cenna /
ādhārādheyatayā pratīyamānayoḥ sambandhasya pareṇa sisādhayiṣitatvāt /
anyathā sthāṇuśyenayoḥ saṃyoga ityatra samavāyāsiddhiprasaṅgāt /
indriyārthasannikarṣādinā siddhasādhanatāpatteśca /


*7,489*

nanvanavasthiteriti sūtraṃ katham /
ittham /
yadi vyabhicāraparihārāya samavāyasyāpi samavāyāntaramupeyate /
tadānavasthitiriti /

iha kecitsamavāyaṃ pratyakṣamācakṣāṇāḥ, yata iti ca viṣayasaptamīṃ vyācakṣāṇāḥ tatsthemne anumānamācakṣate /
teṣāmihapratyayasya sambandhapūrvakatvaṃ nāma tatpratītipūrvakatvameva /
tanmate sphuṭaivānavasthā /

ye tu pratyakṣatāṃ nābhyupagacchanti /
sambandhasya sattāmātreṇehapratyayakāraṇavatvamāhusteṣām, avasthitiḥ siddhāntaḥ tadvirodho 'navasthitiḥ ityanavasthitiśabdo 'pasiddhāntavācī vyākhyāyate /

yadveha kuṇḍe badarāṇītivatsambandhasya pratītyaivehapratyayakāraṇatvādatrāpi pratītimāpādyānavasthaiva vaktavyā /
kuṇḍabadarasaṃyogasya yogyatayā avarjanīyatayā pratītirnehapratyayakāraṇamiti kuta eṣā kalpanā /
sattāmātreṇehapratyayakāraṇatvopapattau pratīterapi kāraṇatvakalpakābhāvāditi cenna /
satyapi saṃyoge kutaścidvayavadhānādapratīyamāne nehabuddhirbhavati /
bhavati cāsatyapi saṃyoge tadviparyayādityanvayavyatirekayoḥ kalpakābhāvāt /
svasvāmibhāvādayo 'pi hi jñātā eva sambandhanimittavyavahārahetavo dṛṣṭā nānyathā /
na te sambandhā adviṣṭhatvāditi cenna /
saṃyogasyāpyadviṣṭhatāyā vakṣyamāṇatvāt /
kiñcaivaṃ samavāyo 'pi na sambandhaḥ syāt /
tasyānāśritatvābhyupagamāt /

nanvevaṃ tarhi nānaikāntyāt anavasthaiva bādhitatvenābādhitehapratyayatvasya tatrāvṛtteriti cenna /
anavasthāyāḥ sādhyabādhakatvena sādhanābādhakatvāt /
sādhyabādhenaiva sādhanabādhanābhyupagamasya vyāptiniścayottarakālīnatvāt /
tantupaṭayoḥ samavāya iti pratītirapi sambandhapūrvikaiva /
kintvaropita evāsau sambandha iti cenna /
anavasthānistārāt /
āropitasambandhapūrvakatvaṃ hi sambandhāropapūrvakatvameva, pratītau ceyamanavasthokteti kathaṃ (tannirastā)nistāraḥ /
kiñcaivaṃ vadatā sattayaiva sambandhasya kāraṇatvamiti mataṃ tyaktaṃ syāt /


*7,490*

api cābādhito 'pīhapratyayo yadi sambandhāropamātreṇa bhavettadā tantupaṭādāvapi kinna bhavediti samavāyāsiddhiḥ /
kvacitsiddhasya kvacidāropaḥ kutrāpyabhāve tadasiddhiriti cenna /

sthāṇuśyenayoḥ sambandhasya sattvāt /
anyathā samavāye 'pi samavāyāntarārope na syātsamavāyāntarasya kvāpya(sattvāt)sambhavāt /

samavāye bheda evāropyate na samavāyāntaramiti cenna /
tāvanmātreṇehapratyayāyogāt /
sambandhisambandhabhāvo 'pyāropyata iti cenna /
tarhi tantupaṭādāvapi tadāropamātreṇehapratyayopapattau kiṃ samavāyeneti /


*7,497*

nanu samavāye 'pīhedamiti pratyayaḥ samavāyādhīna eva /
nacāpasiddhānto 'navasthā vā /
tasyaiva samavāyasya svanirvāhakatvāt /
ya eva hi samavāyo 'vayavādiṣvavayavyādīnāṃ sambandhaḥ, sa evāvayavāvavyādiṣvātmanā sambandha ityāśaṅkate- sa iti //

sa svanirvāhakaścet syād ... // MAnuv_2,2.92c //

NYĀYASUDHĀ:
saḥ avayavāvayavyādisamavāyaḥ /
evaṃ tarhi kiṃ samavāyena, dravyasyaiva svanirvāhakatvopapatteriti pariharati- dravyameveti //

... dravyameva tathā na kim // MAnuv_2,2.92d //

NYĀYASUDHĀ:
tarhīti śeṣaḥ /
tathā svanirvāhakatvāt /

*7,498*

kiṃ kasmāt /
ayamāśayaḥ /
yadīhedamiti buddhirnāvaśyaṃ svātiriktasambandhasāpekṣā /
kvacitsvanirvāhakatvāt /
tarhi dravyaguṇādīnāmihedamiti pratyayo 'pi nātiriktasambandhādhīno 'ṅgīkāryaḥ /
dravyasyaiva svanirvāhakatayāpi tadupapatteriti /

samavāyaḥ sambandhātmakatvāt svanirvāhakaḥ, na dravyamiti cenna /
tadasiddhau sambandhatvasyāpyasiddheḥ /
saṃyogasyāpi svanirvāhakatāpatteśca /
tasyānityatvānneti cenna /
samavāyanityatvasyāsiddheriti /


evaṃ dravyādguṇādīnāmatyantabhede 'pi na tatsambandhaḥ samavāyalakṣaṇo 'paraḥ siddhayati /
samavāyavaddravyasyaiva svanirvāhakatvopapatteḥ kalpanālāghavā(tva)ccetyuktam /
idānīṃ guṇādīnāṃ dravyādatyantabhedābhāvācca na samavāyasiddhirityāśayavāṃstadatyantabhede paropanyastānhetūnapākartuṃ tāvadupodghātamāha- viśeṣa iti //


*7,499*

viśeṣastadgatatvādiryadyabhinne 'vasīyate /
guṇakriyādirūpasya niṣedhaḥ kena hetunā // MAnuv_2,2.93 //


NYĀYASUDHĀ:
abhinne samavāya iti śeṣaḥ /
avasīyate aṅgīkriyata iti yāvat /
guṇakriyādirūpasya viśeṣasyeti śeṣaḥ /
kena hetunā na kenāpi /

idamuktaṃ bhavati /
samavāye tāvadavayavāvayavyādigatatvamaṅgīkṛtam /
"āśritatvaṃ cānyatra nityadravyebhyaḥ'; iti vacanāt /
nacānityadravyagurakarmasāmānyaviśeṣaṇāmiva samavāyasya tadgatatvaṃ nāma samavāyalakṣaṇavṛttiḥ sambhavati /
tasyābhinnatvāt /
atastadgatatvaṃ (nāma) samavāyasvarūpamevetyaṅgīkartavyam /
paratantratayopalabdhistadgatatvamiti cenna /
tasyāḥ samavāyadharmatvānupapatteḥ /
tadviṣayatvāttaddharmatvamiti cenna /
viṣayatvasyāpi samavāyasvarūpā(tva)natirekāt /


*7,500f.*

evamastitvābhidheyatvajñeyatvasambandhatvādayo 'pi samavāye 'bhyupagatāḥ, na samavāyasvarūpādbhidyante /
bhedaṃ hi teṣāṃ samavāyena sambandho vaktavyaḥ /
anyathā kathamete tatra syuḥ /
naca sambandho yuktaḥ, saṃyogasya guṇatvena dravyamātravṛtteḥ, samavāyasya cābhinnatvāt /
tatra pṛcchāmaḥ /
samavāyasya tadgatatvādidharmāṇāṃ cābhede kathamaparyāyaśabdavācyatvaṃ, dharmadharmibhāvaḥ, ṣaṣṭhīprayogo, jñātatvājñātatvam, ekatvānekatvamityādi yujyata iti /
nahya(cā)tropacārādikalpanā yuktā /
mukhyaprayogāderadarśanāt /
na tadgatatvādi samavāyatanmātraṃ, yenānupapāttaḥ syāt /
kintu samavāyābhinnamapi tadviśeṣātmakatmakam /
ato vyapadeśabhedādi yujyate /
viśeṣasya bhedapratinidhitvādityevāgatikataya tatra samādhirabhidhānīyaḥ /
tathāca yadyabhinne 'pi samavāye tadgatatvādiviśeṣo 'ṅgīkriyate tadā guṇakriyādikamapi dravyasvarūpameva sadviśeṣātmakaṃ bhavatu na tu tanmātram /
samavāyadharmāstaviśeṣāḥ, guṇādayastu na dravyaviśeṣā ityatra viśeṣahetvabhāvād iti /


*7,504*

kimato yadyevamityata āha- dravyameveti //

dravyameva tato 'nantaviśeṣātmatayā sadā /
nānāvyavahṛterhetur ... // MAnuv_2,2.94a-c //


NYĀYASUDHĀ:
samavāyadharmavadguṇādīnāṃ dravyaviśeṣatvādityarthaḥ /
anantaśabdo yatra yāvanto vyavahārāḥ tāvatāmupalakṣakaḥ /
nānāvyavahṛteḥ vyapadeśabhedādirityarthaḥ /
etaduktaṃ bhavati /
guṇaguṇyādeḥ atyantabhede siddhe hi tatsambandhaḥ samavāyaḥ siddhayati /
guṇaguṇyādyatyantabhedastu na prāmāṇikaḥ /
tathāhi na tāvattatra pratyakṣaṃ pramāṇaṃ, gavāśvādivadanupalambhāt /
ato guṇaguṇināvatyantabhinnāvaparyāyaśabdavācyatvāt /
ghaṭapaṭavadityādyanumānameva vaktavyam /
taccānaikāntikam /
samavāyasya taddharmāṇāṃ (ca) bhedābhāve 'pyaparyāyaśabdavācyatvādanyathāsiddhaṃ ca /
yathā samavāye tadgatatvādidharmāṇāṃ bhedabhāve 'pi viśeṣaparanāmakātsvabhāvaviśeṣādevāparyāyaśabdavācyatvādikamupapādanīyam /
gatyantarābhāvāt /
tathā guṇaguṇyādīnāma(tyantā)bhede 'pi guṇādīnāṃ dravyaviśeṣatve(na dra)taddravyameva /
viśeṣaśaktayaivāparyāyaśabdavācyatvādivyavahāraheturbhaviṣyati /
tathāca vipakṣe bādhakābhāvādaprayojakatvaṃ hetūnāmiti /


*7,506*

yadvā viśeṣastadgatatvādirityanenaiva guṇaguṇyādyatyantabhedasādhakānāṃ hetūnāmanaikāntyāprayojakatve varṇite /
yadi tadgatatvādidharmābhinne samavāye tadgatatvādiviśeṣo 'bhyupeyate /
viśeṣaṇaiva ca vyavahārā nirvahiṣyante /
tadā vyapadeśabhedādihetūnāṃ vyabhicārānyathāsiddhibhyāṃ ābhāsatvātkena hetunā dravyasya guṇakriyādirūpasya guṇakriyādisvarūpatvasya niṣedhaḥ (kariṣyate) kriyate /
guṇaguṇyādyatyantabhedaḥ kena hetunā sādhayiṣyata iti yāvat /
anyathāsiddhimeva prakaṭayannupasaṃharati- dravyameveti //
samavāyavaditi vakṣyamāṇamatrāpi sambaddhayate /
yathā samavāyasya tadgatatvādiviśeṣātmatayā vyapadeśabhedādivyavahārahetutvam /
tathā dravyameva ghaṭādikaṃ guṇakriyādyanantaviśeṣātmatayā nānāvyavahṛterheturbhavatīti /


*7,507*

nanvaupacārikatvaṃ vā bhrāntimūlatvaṃ vā vyavahārāṇāmaṅgīkṛtya hetūnāṃ dūṣaṇaṃ śakyam /
tatkiṃ viśeṣāṅgīkāreṇa /
naivaṃ śakyam /
aupacārikatvādau hi kadācinmuktau vyavahāraḥ syāt /
na hi tīrādau sadā gaṅgādivyavahāro 'sti /
nacaivaṃ prakṛte sadaivāparyāyaśabdavācyatvādeḥ sattvāt /
yadāpyabhedabodhāya rūpameva ghaṭa iti vā vijñānaṃ brahmeti vā vyavahriyate tadāpi na paryāyatāmupetya, tathānanubhavāt /
ato vaktavyamevātra nimittam /
tadidamuktam- sadeti //


*7,508*

nanvanantaviśeṣātmakamekameva dravyamiti vyāhatamiti cet /
kiṃ mātā vandhyetivatsākṣādvirodhaḥ, kiṃvā kṛtakaṃ nityamitivadvayāptyā /
nādyaḥ /
yato 'nantatvaṃ saṅkhayāviśeṣaḥ, ekatvaṃ cābhedaḥ /
na dvitīyaḥ /
yatrānekatvaṃ tatrāvaśyaṃ bheda iti vyāptau hi sa syāt /
na caivam /
bhedapratinidhinā viśeṣeṇaiva anekatvasaṅkhayānirvāhādityāha- anantatvamiti //

... anantatvaṃ viśeṣataḥ // MAnuv_2,2.94d //

NYĀYASUDHĀ:
īśvarākhyadravyaviśeṣaṇāmanantatvamanyatrānekatvamiti draṣṭavyam /
atrāpi samavāyavaditi sambaddhayate /
eka eva hi samavāyo 'nekadharmātmako 'ṅgīkriyate /


*7,509*

nanvayaṃ nānāvyavahāranirvāhaheturviśeṣo yadi dravyātmaiva kathaṃ tarhi (taddravya)dravyasya viśeṣaḥ syāt /
tadīyatāyā bhedavyāptatvāt /
maivam /
vināpi bhedena tatpratinidhinā viśeṣaṇaiva viśeṣasya tadīyatopapatteḥ /
evaṃ tarhi tasyāpi viśeṣasya viśeṣatvasiddhaye viśeṣāntaramaṅgīkartavyamityanavasthetyata āha- viśeṣaśceti //

viśeṣaśca viśeṣī saḥ svenaiva samavāyavat // MAnuv_2,2.95ab //

NYĀYASUDHĀ:
yathā samavāyaḥ svenaiva samavāyī, na sambandhāntareṇetyabhyupagamyānavasthā pareṇa parākriyate /
tathā sa dravye 'nekavyavahāranirvāheturviśeṣaśca svenaiva viśeṣī na punarviśeṣāntareṇa /
ato na kaściddoṣa iti /
samavāyavadityupalakṣaṇam /
sattāntyaviśeṣavaccetyapi draṣṭavyam /
yathā dravyaguṇakarmasu sadvayavahārahetuḥ sattā svenaiva satī svīkṛtā /
yathā ca nityadravyeṣvatyantavyāvṛttipratyaye heturantyo viśeṣaḥ svenaivātyantavyāvṛttastathaiveti /


*7,510*

athāpi syāt /
guṇaguṇyādibhedamabhyupagacchatā mayā ihedamiti vyavahāranirvāhāya samavāyo 'ṅgīkriyate, tasya cānavasthāparihārāya svanirvāhakatvam /
abhedaṃ(abhyu)cābhyupagacchatā tvayāparyāyaśabdavācyatādisiddhaye viśeṣo 'ṅgīkriyate, tasya cānavasthānirāsāya svanirvāhakatvamiti pakṣadvaye samāne ko viśeṣo 'bhedapakṣe, yena sa parigṛhyate /
samavāyasyāprāmāṇikatvamiti cet /
samaṃ viśeṣe 'pi /
aparyāyavyavahārādinā sa siddha iti cet /
tarhi samavāyo 'pīhedamityādinā siddha iti tulyam /
tadanaikāntikamityuktamiti cet /
aparyāyavyavahārādikamapi ghaṭapaṭāvanaikāntikamiti samānam /
astu tarhi guṇaguṇyādibhede vyavahārādisakamapi ghaṭapaṭādavanaikāntikamiti samānam /
astu tarhi guṇaguṇyādibhede pramāṇābhāvo viśeṣa iti cenna /
abhede 'pi pramāṇābhāvāt /
gavāścādivadvivekenānupalambho abhede pramāṇamiti cet /
tarhi vyapadeśabhedādi bhede pramāṇamastīti samādhisāmyam /
tadvayabhicārānyathāsiddhibhyāṃ nirastamiti cet /
abhedapramāṇamapi tādṛgeva /
tasyāpi kṣīranīrādau vyabhicārāt /
ayutasiddhatvenānyathāsiddheśca /
tasmānnimitto 'yamabhedapakṣapāta ityata āha- kalpaneti //

kalpanāgurutādoṣāt padārthāntaratā nahi // MAnuv_2,2.95cd //

NYĀYASUDHĀ:
padārthāntarā guṇaguṇyādīnāmiti śeṣaḥ /
yadyapi bhedābhedapakṣayoḥ svanirvāhakasamavāyaviśeṣāṅgīkāreṇa sāmyaṃ, tathāpi bhedapakṣe kalpanāgurutādoṣāt guṇaguṇyādīnāṃ padārthāntaratā nāṅgīkriyate /
kalpanālāghavādabheda evopeyata iti /

kathaṃ bhedavāde kalpanāgauravamityata āha- kalpayitveti //

kalpayitvā ṣaṭ padārthān sābhāvānapi kevalam /
ekasmin sa viśeṣaścet kiṃ pūrvaṃ tasya vismṛtiḥ // MAnuv_2,2.96 //


NYĀYASUDHĀ:
kevalamityetat ṣaḍityanenaikasminnityanena ca sambaddhayate /
ekasmin samavāye, saḥ vicitravyavahārahetuścedaṅgīkriyata iti śeṣaḥ /
kiṃ kasmāt /
pūrvaṃ dravya ityarthaḥ /
tasya viśeṣasya /


*7,513*

ayamabhisandhiḥ /
vyapadeśabhedādipramāṇabalamavambya vaiśeṣikādibhirdravyādayo bhāvapadārthāḥ ṣaḍeva /
abhāvo 'pi saptama iti kalpitam /
samavāye pratītaṃ tadgatatvādikaṃ tu na samavāyātiriktam /
kintu svabhāvabhedāparanāmnā viśeṣeṇaiva tatra vyapadeśabhedādyutpattiriti ca /
tatrāntato 'pyaṅgīkatarvyena vyapadeśabhedādinirvāhakeṇa viśeṣeṇaiva dravye 'pi tannirvāho vaktavyaḥ /
saptapadārthīnirūpaṇaṃ na kartavyam /
yadvā dravyavatsamavāye 'pi tadgatatvādīnāṃ bheda eva svīkāryaḥ /
teṣāṃ ca dravyādiṣvantarbhāvāsambhave saptapadārthaniyamastyājyaḥ /
viśeṣakāraṇena vinā

kvacidbhedasya kvacidviśeṣasyābhyupagame kathaṃ kalpanāgauravaṃ na syāt /
tadabhāve vābhedavāde kathaṃ kalpanālāghavaṃ na bhavediti /
bhedapratītyapratītibhyāṃ viśeṣa ityādi tu nirākariṣyate /
atra dvidhākalpanapradarśanārthenaiva pūrvārdhena samavāye viśeṣasyāṅgīkartavyatāpi samathirtā veditavyā /
ata eva kevalaśabdasambandhaḥ /
saptaiva hi padārthāḥ /
naca teṣu samavāyadharmāṇāmantarbhāvaḥ sambhavatīti viśeṣā eva taira(te ')ṅgīkartavyā iti /


*7,516*

na kevalaṃ sarvathāṅgīkāryeṇa viśeṣeṇaiva guṇaguṇyādivyapadeśabhedādyupapattau dravyabhedamaṅgīkṛtya samavāya(eva) ekasminviśeṣābhyupagame kalpanāgauravamiti bhedamatamapahāyābhedapakṣapātaḥ kriyate /
kintu samavāye pramāṇābhāvādapi /


*7,517*

tathā hi /
na tāvattatra pratyakṣaṃ pramāṇam /
kuṇḍadadhnoḥ saṃyoga itivattantupaṭayoḥ samavāya ityapratīteḥ /
sambandhapratītireva tatpratītiriti cenna /
tasyā asammateḥ /

etenāyaṃ tantupaṭasambandhapratyayaścakṣurjanyo 'nanyathāsiddhatadanvayavyatirekānuvidhāyitvātpaṭapratyayavat /
ayaṃ tantupaṭayoḥ sambandho yogajadharmājanyajanyasākṣātkāraviṣayastantupaṭasambandhatvādetattantupaṭāntarasaṃyogavaditi samavāyapratyakṣatāsādhanamapyapāstam /
tantupaṭasambandhatatpratyayayoḥ asiddhayā'śrayāsiddheḥ /
sambandhāpratītau śuklaḥ paṭa iti sāmānādhikaraṇyapratītirna syāt /
daṇḍīkuṇḍalītyādau tasya tatpūrvakatvadarśanāditi cenna, samavāyo 'stītyādau vyabhicārāt /


*7,521f.*

nāpyanumānam /
ihedamiti pratyayasya dūṣitatvāt /
iha bhūtale ghaṭābhāva iti pratyaye vyabhicārācca /
bhāvamātraviṣayatvena viśeṣaṇādadoṣa iti cenna /
abhāvavadbhāve 'pyupapattau anyathāsiddheḥ /
iha ghaṭe jñānamiti pratyaye vyabhicārāparihārācca /
bādhito 'yamiti cenna /
anyathāpratyayānupalabdheḥ /
etena jātyādigocaro viśiṣṭavyavahāraḥ sambandhiniyato bhāvamātraviṣayābādhitaviśiṣṭavyavahāratvātsaghaṭaṃ bhūtalamiti vyavahāravadityapāstam /
jñāto ghaṭaḥ, asti samavāyaḥ ityādau vyabhicārāt /


*7,522*

ete tantava etatpaṭasambaddhā etadāśrayatvādbhūtalavat, ayaṃ paṭa etattantusambaddha etadāśritatvādetadāśritatṛṇādivadityapyasat /
tantupaṭayorāśrayāśrayibhāvāsiddheḥ /
iha tantuṣvayaṃ paṭa iti vyavahārasiddhatatpratyāttatsiddhiriti cenna /
iha samavāye 'stitvamityādau vyabhicārāt /

bhūtalarūpādayo bhūtalasambaddhā bhūtalaviśeṣaṇatvāt ghaṭavadityapi, bhūtalaviśeṣaṇe jñāne vyabhicārādayuktam /

iha tantuṣa paṭa ityādipratyaya etañjanakasaṃyogatvarahitasambandhajanya ihetipratyayatvādiha kuṇḍe badarāṇīti pratyayavat /
naceha bhūtale ghaṭābhāva iti pratyaye vyabhicāraḥ tatrāpi cakṣurbhūtalasaṃyogādijanyatvasya sattvāt, ityapi na yuktam, ayaṃ paṭa etajjanakatanturahitopādānajanyaḥ paṭatvātpaṭāntaravadityābhāsasamānayogakṣematvāt /

rūpādayaḥ sambandhavantaḥ prameyatvādghaṭavadityapyanupapannam, samavāyābhāvayorvyabhicārāt /
tatrāpi viśeṣaṇaviśeṣyabhāvābhyupagamānneti cenna, tasya pareṇa sambandhatvānaṅgīkārāt /
aṅgīkāre vā tenaivārthāntaratvāt /
matubarthasyābhāvādbādhitaviṣayatvācca /

samavāyaḥ svenaiva sambandhī (ityādi) syāditi nirastam /

idaṃ cakṣuretajjanyasaṃyogajñānatvarahitasambandhajñānajanakaṃ cakṣuṣṭvādanyacakṣurvat, ahaṃ manniṣṭhasaṃyogajñānatvarahitasambandhajñānavānātmatvādātmāntaravat, ayaṃ kāla idānīntanasaṃyogajñānatvarahitasambandhajñānavānkālatvādanyakālavat ityādīni, ābhāsasamānayogakṣematvāt, viśeṣaṇaviśeṣyabhāvādinārthāntaratvāccāpāstāni /

saṃyogatvaṃ sambandhavyāvṛttam jātitvādgotvavaditi siddhasādhanam /
jāteḥ prativyaktiniyatatvasya vakṣyamāṇatvenaikasya saṃyogatvasya saṃyogāntarādvayāvṛtteḥ, viśeṣaṇaviśeṣyabhāvādito vyāvṛtteśca /
vivādādhyāsitā mṛt ghaṭasambaddhā dravyatvādākāśavaditi ca ghaṭāntarasaṃyogenārthāntaram /
etadghaṭasambaddheti nirdeśe 'pyetadghaṭasambandhamalabdhvā vinaṣṭadravye 'naikāntikam /
tatrāpi paramparāsambandho 'stīti cet /
tarhi siddhasādhanam /
mṛtsaṃyuktabhūtalasya ghaṭasaṃyuktatvāt /


*7,523*

tantupaṭau nityasambaddhau dravyatvādākāśavaditi, dṛṣṭāntasya sādhyavikalatvādapāstam /
saṃyogaḥ svavyatiriktasambandhādbhinnaḥ prameyatvādghaṭavadityatra svavyatiriktapadena svānyonyābhāvavivakṣāyāṃ siddhasādhanatā /
ekasya saṃyogasya saṃyogāntarādbhinnatvāt /
saṃyogatvarahitatvavivakṣāyāmaprasiddhaviśeṣaṇatvam /
viśeṣaṇaviśeṣyabhāvādinā tatsamādhāne tenaiva siddhasādhanam /

ayaṃ saṃyoga etadanyasaṃyogatvarahitasambandhānyo meyatvādghaṭavat ityādyāśca, ābhāsasamānayogakṣematvādupekṣaṇīyāḥ /
tadevaṃ samavāye pramāṇābhāvānna bhedapakṣo 'ṅgīkriyate /


*7,531*

nanūktamatrābhedapakṣo 'pi tarhi nāṅgīkāryo viśeṣe pramāṇābhāvāditi tatrāha- yeneti //

yena pratyakṣasiddhena vyavahāro 'khilo bhavet /
bhāvābhāvavibhāgena yaṃ vinā na kathañcana /
etaddṛśe viśeṣe 'smin ko dveṣo vādināṃ bhavet // MAnuv_2,2.97 //


NYĀYASUDHĀ:
pratyakṣasiddhenetyanena pratyakṣasiddha iti labhyate /
yenākhilo vyavahāro bhavet /
yaṃ vinā na bhavedityanvayavyatirekābhyāṃ viśeṣakāryatvaṃ vyavahārasya darśayatā vyavahārānyathānupapattiśca viśeṣe pramāṇaṃ tadanaṅgīkāre vyavahārocchedaprasaṅgaścetyuktaṃ bhavati /
akhila ityasyaiva vivaraṇaṃ bhāvābhāvavibhāgena vidhiniṣedhabhedena(iti) /
dvividhastāvaditi śeṣaḥ /


*7,532*

nanu bhedapakṣe 'pi samavāyabhyupagamenākhilo 'pi vyavahāro ghaṭiṣyate /
atyantābhede 'pi vyāvṛttisvīkāreṇa bhedābhedābhyāṃ tu sutarām /
tatkiṃ viśeṣeṇetyata uktam- kathañcaneti //


etādṛśe sarvavyavahāranirvāhahetau ko dveṣaḥ kinnimittānupāditā /
pramāṇābhāvo hyanupādānanimittam /
sati pramāṇe nānupādānanimittamastītyarthaḥ /
mā bhūdvayavahāra ityata uktam- vādināmiti //
upalakṣaṇaṃ caitat /
jñātṛṇāṃ cetyapi draṣṭavyam /
viśiṣṭaviṣayābhijñābhivadanalakṣaṇo hyatra vyavahāraḥ prakṛtaḥ /


*7,534*

kiñcāvayavāvayavyādibhede pramāṇābhāvācca taṃ parityajyābhedapakṣo 'ṅgīkriyate /
nanūktamatrābhede 'pi pramāṇaṃ nāstīti /
tatrāha- abhedeneti //

abhedena pratītiśca kāryakāraṇapūrvake /
abhāvānte padārthe 'smin saviśeṣāvasīyate // MAnuv_2,2.98 //



*7,534f.*

NYĀYASUDHĀ:
ihāpi kāryakāraṇagrahaṇenāvayavyavayavāvucyete /
pūrvaśabdena guṇaguṇyādikam /
abhāvaśabdenānyonyābhāvo gṛhyate /
tasyaiva dharmyabhinnatvāt /
yadvābhāvataddharmāvanenopalakṣyete /
avasīyate sākṣiṇā /
tathāhi /
tantupaṭādiviṣayā buddhiratyantabhinnaghaṭapaṭādiviṣayabuddhito vilakṣaṇānuvyavasīyate utāvilakṣaṇā /
na tāvaddvitīyaḥ /
pratītyapalāpānupapatteḥ /
ādye kathamabhedapratītirnāstīti śakyaṃ vaktum /
sambandhena vi(śe)śiṣyata iti cenna /
kuṇḍabadarapratītito 'pi vailakṣaṇyānubhavāt /
sambandhinorayutasiddhatvāttatheti cenna /
ādhārādheyabhāvenāvasthānasamaye tasyākiñcitkaratvāt /
atastantupaṭayoḥ kuṇḍabadarayośca bhede sambandhe ca samāne kālāntarabhāvinaḥ sambandhavināśādeḥ sambandhivibhāgādervā pratyakṣapratītiṃ pratyupayogā(yogā)bhāvādvailakṣaṇyaṃ nānubhūyeta /
anubhūyate ca tantupaṭādibuddhiḥ kuṇḍabadarādibuddhevirlakṣaṇetyabhedaviṣayaiva sāvasīyate /


*7,537*

kiñca paṭotpatteḥ prāgyāvantaṃ deśamavaṣṭabhya tantavastiṣṭhanti paṭo 'pi tāvantameva /
naca mūrtayoḥ samānadeśatvaṃ yujyate /
tena jñāyate tantvabhinnaḥ paṭa iti /
nacāvayavāvayavino rūparasādi(vat)dvaitamanubhūyata ityādyabhedapramāṇaṃ svayamūhanīyam /


*7,539f.*

nanvabhedaścetpratyakṣeṇaivekṣyate /
tadā kathaṃ śuklaḥ paṭaścalati(paṭa) ityādisāmānādhikaraṇyādivyavahāraḥ /
tasya daṇḍī kuṇḍalītivadbhedaviṣayatvāt /
nahi pratītivirodhī vyavahāro bhavatītyata uktam- saviśeṣeti //
viśeṣeṇa viṣayeṇa upetā /

ayamarthaḥ /
yatra kevalamabhedaḥ pratīyate na tatra sāmānādhikaraṇyavyavahāro bhavati /
yathā ghaṭaḥ kalaśa iti /
atra tvabhedaḥ pratīyamāno viśeṣeṇa sahita eva pratīyate /
viśeṣaśca bhedapratinidhiḥ sāmānādhikaraṇyavyavahāraṃ prasūta iti /


*7,541*

nanvabhedapratītimabhibhūya viśeṣapratītiḥ svakāryaṃ kathaṃ kuryāt, karoti cedabhedapratītirapi viśeṣapratītimabhibhūya svakāryaṃ kathaṃ na syāt /
maivam /
nahi pratītirastītyeva vyavahāraḥ kintu prayojane 'pi sati /
prayojanaṃ ca sāmānādhikaraṇyavyavahāreṇaiva bahulaṃ lokavedayoḥ /
yadā tvabhedavyavahāraḥ prayojanavāṃstadā so 'pi dṛśyata eva yathā vijñānamānandaṃ brahmetyādi /


*7,542*

yadvā viśeṣaḥ pratyakṣārthāpattisiddha ityuktam /
tatkathamityataḥ pratyakṣasiddhatāṃ tāvadupapādayati- abhedeneti //
anuktasamuccayārthaścaśabdaḥ /
padārtha ityekavacanaṃ jātiviṣayam asti yatastasmātsā saviśeṣāvasīyata iti yojanā /
tataścāyamarthaḥ /
asti tāvadavayavāvayavyādipadārthasārthe 'bhedena pratītiḥ /
kuṇḍabadarādipratītito 'syā vyāvṛttatayādhyavasāyāt /
naca abhedamantareṇa vyāvṛttiheturasti /
ato 'sati nimittāntare sammatabhedavastvantarapratītito vyāvṛtteyamabheda eva viśrāmyatīti /
asti ca tathāpi sāmānādhikaraṇyādivyavahāraḥ /
tatra yadīyamabhedamātraviṣayā syāttadā na sāmānādhikaraṇyādivyavahāraṃ kuryāt /
ghaṭaḥ kalaśa iti vyavahārādarśanāt /
tato jñāyate 'dhiko 'pi viṣayo 'syā vidyata iti /
naca bhedo 'sāviti vācyam /
bhedābhedavāde 'pyanto viśeṣasyāṅgīkāryatvāt /
tathā ceyamabhedapratītirindriyajā saviśeṣāvasīyata iti /


*7,544*

prāguktaṃ samavāye viśeṣo 'ṅgī(kartavya)kriyata iti tanna tāvadeva /
kintu sarveṣvapi padārtheṣviti darśayanviśeṣasya vyavahārānyathānupapattisiddhatāṃ copapādayati- sāmānyādīti //

sāmānyādipadārtheṣu tanniṣṭhatvādayo 'khilāḥ /
kathaṃ dharmā nivāryante vastvaikye 'pi hi vādibhiḥ // MAnuv_2,2.99 //


NYĀYASUDHĀ:
tanniṣṭhatvādayo vyaktiniṣṭhatvādayaḥ /
kathamityākṣepe /
vastvaikye 'pi dharmaikye 'pi /
kuto na nivāryata ityata uktam- vādibhiriti //
avisaṃvādivyavahārasiddhatvāditi yāvat /

etadeva prapañcayati- kāryasyeti //

kāryasya tattanniṣṭhatvaṃ guṇādervyāpitādikaḥ /
kathaṃ viśeṣo naivāsti ... // MAnuv_2,2.100a-c //


NYĀYASUDHĀ:
asti tāvadavayavino 'vayavaniṣṭhatvaṃ nāma dharmaḥ /
guṇānāṃ keṣāñcidrūpādīnāmāśrayavyāpitvam keṣāñcitsaṃyogādīnāṃ pradeśavṛttitvam, rūpādīnāmudbhūtatvam, sarveṣāṃ caturviṃśatitvam karmaṇaśca āśrayavyāpitvamanityatvaṃ pañcatvaṃ mūrtaniṣṭhatvam, sāmānyasyāpi dravyaguṇakarmaniṣṭhatvam, nityatvamanugatatvam, dvividhatvamityatibahulo 'yaṃ padārthadharmasamūhaḥ /
na cāyamāśrayato bhinna eveti yuktam /
asti ca dharmadharmyādivyavahāraḥ /
tantuṣu paṭaḥ, pa(gha)ṭo na bhavati gha(pa)ṭa ityādiḥ /
sa cāyamatyantābhede 'nupapadyamānaḥ svopapādakaṃ viśeṣamavagamayatīti sarvapadārtheṣu kathaṃ viśeṣo naivāsti /


*7,546*

satyam /
santyeva dravyādiṣu saptasvapi padārtheṣu te te dharmāḥ /
kinnāmāśrayato bhinnā eva /
tathāca tatsambandhanibandhanatayaivopapadyamāno vyavahāraḥ sarvapadārtheṣu na viśeṣamākṣeptumalamityāśayena śaṅkate- sa ceti //


*7,547*

... sa ca dharmo 'paro yadi // MAnuv_2,2.100d //

NYĀYASUDHĀ:
na kevalaṃ guṇādi dravyādito bhinnam /
kintu saḥ tattanniṣṭhatvādidharmaśca aparaḥ svāśrayādbhinno yadyaṅgīkriyata ityarthaḥ /
nirākaroti- ṣaḍiti //

ṣaṭpadārthātirekaḥ syāt ... // MAnuv_2,2.101a //

NYĀYASUDHĀ:
tarhi dharmāṇāṃ ṣaḍbhyaḥ padārthebhyo 'tirekaḥ syāt /
tathāca ṣaḍeva padārthā sati niyamo bhajyeteti /


nanu svāśrayato vibhinnā api dharmā na ṣa(ḍbhyaḥ)ṭpadārthebhyo 'tiricyante /
kintu ta evānyonyaviśeṣaṇībhūtā dharmā ityucyante /
yathā'ha"yadyapi dharmāḥ ṣaṭpadārthebhyo na vyatiricyante /
kintu ta evānyonyāpekṣayā dharmadharmiṇaśca bhavanti'; itrata /
anyatrāpi"teṣāṃ dharmāsta eva parasparaṃ viśeṣaṇībhūtāḥ'; iti /
tatkathaṃ niyamabhaṅga iti /
maivam /
tanniṣṭhatvādīnāṃ ṣaṭsu padārtheṣvantarbhāvayitumaśakyatvāt /
tathāhi /
"āśritatvaṃ cānyatra nityadravyebhyaḥ'; ityabhyupagataṃ kāryadravyaguṇakarmasāmānyaviśeṣasamavāyānāmavayavādiniṣṭhatvaṃ na tāvaddravyādikam /
guṇādivṛttyanupapatteḥ /
nāpi samavāyaḥ tasya svavṛttyanupapatteḥ /
kiñcādhāryādhārabhūtayoḥ sambandhaḥ samavāya iṣyate /
tathāca kathaṃ sa evādhāritvamādhāratvaṃ ca syāt /
tathā rūpādīnāmāśrayavyāpitvaṃ na dravyādiṣvantarbhavati /
teṣāṃ guṇavṛtttivāsambhavāt /
samavāyastūktarītyā nirastaḥ /
api ca vṛttitvamātraṃ samavāyaḥ /
vyāpyavṛttitvaṃ tvatiriktaṃ nirvaktavyar(vācya)m /
kṛtsne svāśraye samavāyastaditi cenna /
dravyasyāsamuditatvena kṛtsnatvādyanavakāśāt /
svabhāvena sahānavasthānaṃ vyāpyavṛttitvamiti cenna /
tasyāpyantarbhāvyatvāt /
abhāvo 'sāviti cenna /
nirākariṣyamāṇatvāt /


*7,552*

evaṃ saṃyogādīnāṃ pradeśavṛttitvaṃ nirastam /
udbhūtatvaṃ ca na jātiviśeṣaḥ /
rūpatvādinā parāparabhāvānupapatteḥ /
yadi hi rūpatvaṃ paraṃ syāttadā sparśasyodbhūtatvaṃ na syāt /
yadi codbhūtatvaṃ paraṃ bhavettadā sarvamapi rūpamudbhūtamiti cakṣurāderapi pratītiḥ syāt /


*7,553*

caturviṃśatitvaṃ ca na saṅkhayā, guṇānāṃ nirguṇatvāṅgīkārāt /
upacāro 'yamiti cenna /
nimittābhāvāt /
na tāvadekātharsamavāyo nimittam /
dravye caturviṃśatitvaniyamābhāvāt /
pratyekaṃ rūpādiṣu tatprasaṅgācca /
aparyāyacaturviṃśatiśabdavācyatvamiti cenna /
śabde 'pi caturviṃśatitvābhāvāt /
caturviṃśatipuruṣoccāritāparyāyaśabdavācyatvamiti cenna /
badhirādīnāṃ rūpādiṣu saṅkhayāvyavahārābhāvaprasaṅgāt /
evamanyeṣāmapi dharmāṇāmantarbhāvo nirasanīyaḥ /


*7,556*

kaścidāha /
dharmapadārtho 'bhāve 'ntarbhavatīti /
tadasat /
niṣedhabuddhibodhyatvābhāvāt /
abhāve 'bhāvānaṅgīkāreṇa taddharmāṇāmabhāvatvāyogācca /
dravyādiṣaḍlakṣaṇaśanyatamarāhityamabhāvatvam /
natu niṣedhabuddhibodhyatvamiti cenna /
lokapratītimavadhūya svakalpanādaraṇe dravyameva bhāvāstallakṣaṇarahito 'bhāva ityapi kalpanāprasaṅgāt /
atastattanniṣṭhatvādayo dravyādidharmāstadātmāna evāṅgīkāryāḥ /
tathācāha"bhāvasya svarūpamevāvasthābhedenāstitvaṃ jñeyatvamabhidheyatvaṃ cocyate'; iti /
naca viśeṣamapahāyāvasthābhedaḥ śakyanirūpaṇaḥ /


*7,557*

nanu dharmā dharmito bhinnā eva /
nacoktadoṣaḥ /
naiyāyikādibhiḥ paramāṇvārambhavādibhiḥ ṣaḍeva padārthā iti niyamasyānaṅgīkṛtatvāt /
dharmapadārthasya pṛthagaṅgīkṛtatvācca /
tathāca bhinnadharmasaṃsargavaśātsarvavyavahāropapattau na tadanyathānupapattyā viśeṣasiddhirityata āha- padārtheti //

... padārthāniyame 'pi hi /
dharmasya dharmasantānādanavasthākaro bhavet // MAnuv_2,2.101b-d //


NYĀYASUDHĀ:
padārthānāṃ ṣaḍeveti niyamābhāvapakṣe 'pi hi yasmāddharmasya dharmasantānādanavasthāyā ākaro bhavedayaṃ pakṣaḥ, tasmāddharmadharmāṇāmāśrayābhede 'vaśyamaṅgīkārye tatra dharmadharmyādivyavahārānyathānupapattyā viśeṣo 'ṅgīkaraṇīya iti yojyam /
khaniḥ ākaraḥ /


*7,558*

etaduktaṃ bhavati /
dharmapadārthaṃ dravyādibhyo bhinnamabhyupagacchanpraṣṭavyaḥ /
astitvādidharmeṣvapyastitvādikamasti na vā /
neti pakṣe 'nubhavavirodhaḥ /
astitvaṃ na jñeyaṃ nābhidheyamiti svakriyāvirodhaśca /
anyathā dravyādiṣvapi tadabhāvāpattiḥ /
ādye tadāśrayato bhinnamabhinnaṃ vā /
ādye tatrāpyastitvādyantaramityanavasthā syāt /
dvitīye tvasti tāvattatrāpi dharmadharmyādivyavahāraḥ /
sa cānupapadyamāno viśeṣaṃ gamayatīti /
kiñca dharmagatā dharmā yadi āśrayābhinnāstadā kiṃ dravyādigatāstitvādidharmairaparāddham /
yena te dravyādito bhidyeran /
yogakṣemasāmyāt /
tatasteṣāmeva dravyādyabhede sati punarvyavahārānyathānupapattyā dravyādiṣveva viśeṣasiddhiḥ (iti) /


*7,560*

nanvastyeva dravyādidharmeṣvastitvādiṣvapyastitvādikam /
taccāśrayato bhinnameva /
nacaivaṃ dharmasyānavadhikadharmasantānādanavasthādoṣaḥ /
utpattijñaptipratibandhakatvābhāvenādoṣatvāt /
yathā'huḥ"mūlakṣayakarīṃ prāhuranavasthāṃ hi dūṣaṇam'; iti /
yadarthamuttarottarānusaraṇaṃ tanmūlamutpattirjñaptirvā /
tato bhinnanimittatayopapadyamāno vyavahāro na viśeṣamākṣeptumalamityata āha- sāmānyasyāpīti //

sāmānyasyāpi sāmānyaṃ guṇasyāpi guṇo hyataḥ /
nāṅgīkṛtaḥ ... // MAnuv_2,2.102ac //


NYĀYASUDHĀ:
sāmānyasya gotvādeḥ, sāmānyaṃ sattālakṣaṇam /
guṇasya ca rūpādeḥ, saṅkhayāpṛthaktavādiguṇaḥ ata anavasthābhayādeva hi nāṅgīkṛtaḥ /

ayamāśayaḥ /
sāmānyasyāpi sāmānyaṃ tāvatpareṇa nāṅgīkṛtam /
tathā guṇasyāpi guṇo nāṅgīkṛtaḥ /
tatkasmāditi vaktavyam /
na tāvatpratītyabhāvāt /
sadgotvaṃ caturviṃśatiguṇā rūpādrasaḥ pṛthagiti pratibhāsasya durapahnavatvāt /
naca na sadgotvamityādi bādhakamasti yena pratītasyāpi parityāgaḥ /
gotvaṃ na sattāvadaparasāmānyaśūnyatvādviśeṣavat, guṇā na guṇavanto 'dravyatvātkriyāvadityādibādhakamastīti cenna /
vipakṣe bādhakābhāvenāprayojakatvāt /
dṛṣṭāntayoḥ(śca)sādhyavikalatvācca /
yadi gotvādau sattā syāttadā sattāyāmapi syāt /
tathā cātmāśrayatvamiti cenna /
sattāntaratvopapatteḥ /
kiñca pratīteḥ kimātmāśrayatā kariṣyati /
anyathā prameyatvādīnāṃ kevalānvayitvaṃ na syāt /
ātmāśrayabhayādyataḥ prameyatvādivyāvṛttiḥ tasyaiva vipakṣatvāt /
uktaṃ ca"kathaṃ svavṛttiriṣyā cedyathānyatreti gṛhyatām /
pramāṇaṃ śaraṇaṃ vṛttau na bhinnābhinnateyatā'; iti /
guṇānāmapi guṇavattve dravyalakṣaṇayogāddravyatāpattiriti cenna /
pratītimanuruddhaya lakṣaṇāntarasya kartavyatvāt /
tasmātsāmānye sāmānyaṃ guṇe ca guṇaḥ anavasthābhayādeva nāṅgīkriyata ityeva vaktavyam /
yathā'ha"vyakterabhedastulyatvaṃ saṅkaro 'thānavasthitiḥ /
rūpahānirasambandho jātibādhakasaṅgrahaḥ'; iti /
nacānavacchinnā sāmānyaparamparā guṇaparamparā cotpattijñaptipratibandhe hetuḥ /
tathāca yathā sā dūṣaṇaṃ tathā prakṛtāpi dūṣaṇameva /
na cetsāpi na syāditi sāmānyāderapi sāmānyādyaṅgīkāryaṃ syāt /
yadi kathañcijjñaptipratibandhakatvaṃ tatra vyutpadyeta /
tarhi vayamapyatra tadvyutpādayiṣyāma iti /


*7,565*

yadi kaścidvaiyātyādbrūyāt /
astyeva sāmānyasyāpi sāmānyaṃ guṇasyāpi guṇo nirbādhapratītisiddhatvāt /
utpattijñaptyapratibandhahetoranavasthāyā doṣatvāyogāt /
ato naitannyāyena dharmaparamparānavasthābhayānnivāraṇīyeti /
tatrāha- sa ceti //

... sa ca yadi nānavasthā kvacid bhavet // MAnuv_2,2.102cd //

NYĀYASUDHĀ:
sa ca guṇasyāpi guṇaḥ /
caśabdātsāmānyasyāpi sāmānyaṃ yadyaṅgīkriyate tadā brūmo nānavasthā kvacidbhavediti /


*7,566*

ayamāśayaḥ /
evaṃ vadankvacidanavasthādūṣaṇamaṅgīkaroti na veti vācyam /
nacet dūṣaṇāntaramapi nāṅgīkuryāt /
aviśeṣāt /
tathāca kathāyāṃ nādhikārī syāt /
nādyaḥ /
dharmasāmānyaguṇānavasthāyā adūṣaṇatve vimatāyā api dūṣaṇatvāyogāt /
viśeṣahetorabhāvāt /


*7,567*

nanvaparyavasitaparamparāmātrasāmye 'pi yatrotpattyādipratibandhakatvaṃ tatra dūṣaṇatvam /
yatra yadabhāvastatrādūṣaṇatvamiti cet /
kimarthamutpattyādipratibandhakatvamanusaraṇīyam /
anavasthā hi tarkaviśeṣaḥ /
tarkaścāniṣyaprasañjanam /
utpattyādipratibandhaścāniṣyaḥ /
prāmāṇikaparityāgarūpatvāt /
utpattyādeḥ prāmāṇikatvāt /
atastadapratibandhe tarkatvāyogātkathaṃ dūṣaṇāntaram /
evameva dūṣaṇatve 'tiprasaṅga ita cet /
kiṃ prāmāṇikaparityāga evāniṣya utāprāmāṇikasvīkāro 'pi /
nādyaḥ /
niyāmakābhāvāt /
dvitīye kathaṃ na prakṛtānavasthā dūṣaṇam /
atyantabhinnadharmaparamparāyā apyaprāmāṇikatvāt /
athāprāmāṇikasvīkāro na dūṣaṇam /
tarhi prāmāṇikaparityāgo 'pi na (dūṣaṇaṃ) syāditi nānavasthā kvaciddūṣaṇaṃ bhavet /
athāniṣyāpattiheturanavasthādūṣaṇam /
na punaraniṣyarūpeti cenna /
aniṣyarūpaivānavasthā dūṣaṇam /
natvaniṣyāpattiheturityapi vaktuṃ śakyatvena kvacidaṅgīkṛtāpyanavasthā na dūṣaṇaṃ bhavet /
tasmātprāmāṇikaparityāgāprāmāṇikaparigraharūpā vā taddheturvānavacchinnaparamparānavastheti vācyam /
ata eva nātiprasaṅgaḥ /
tathāca dharmaparamparāyā apyanavasthātvenābheda evāṅgīkāryaḥ /
evaṃ coktanyāyena vyavahārānyathānupapattyā viśeṣasiddhiriti /


*7,570*

api ca yo dharmadharmiṇorbhedaṃ samavāyaṃ cāṅgīkṛtyābhedaṃ viśeṣaṃ cāvajānāti tenānavasthāto bibhyatā guṇasāmānyayorguṇasāmānyapratītirevāpalapanīyā /
vinaiva bādhakena bhrāntirvā vācyā /
pratītyapalāpādito vā bibhyato 'navasthā syādityekaṃ sandhitsato 'nya(tpra)ccyavate /
abhedaṃ viśeṣaṃ cāṅgīkurvatāṃ tu nedaṃ dūṣaṇadvayamato 'pi tatpakṣapāta ityāśayavānāha- asmatpakṣa iti //

asmatpakṣe guṇādyāśca tadvanto hi viśeṣataḥ /
ananyatvānnānavasthā ... // MAnuv_2,2.103a-c //


NYĀYASUDHĀ:
dharmadharmiṇoḥ saviśeṣābhedavādināṃ pakṣa ityarthaḥ /
guṇādyā guṇāḥ sāmānyāni ca /
tadvanto guṇavantaḥ /
sāmānyavanti ca /
tena caturviṃśatiguṇāḥ sadgotvamityādipratītivirodho nāstīti śeṣaḥ /
ananyatvāt dharmadharmiṇoriti śeṣaḥ /
aprāmāṇikāparyavasitaparamparārūpā hyeṣā /
ananyatve kathaṃ tadvṛttamiti tadavasthaḥ pratītivirodha ityata uktam- viśeṣato hi tadvanta iti //
bhedasambandhakāryakārī hi viśeṣa iti /


*7,571*

evamavayavāvayavyādīnāmabhedo 'tra nirūpitaḥ /
idānīṃ kvacidbhedābhedāvapi bhavata iti tadapavādamāha- bheda iti //

... bhedo nāśe bhavet tathā // MAnuv_2,2.103d //

NYĀYASUDHĀ:
yadvā yadyavayavyādayo 'vayavādyabhinnāḥ /
kathaṃ tarhi satsvevāvayavādiṣu vinaśyantītyata āha- bheda iti //


tathāśabdaḥ samuccaye /
avayavādiṣu satsvevāvayavyādīnāṃ nāśe bhedo 'bhedaśca bhavedityarthaḥ /
atra nāśa ityupalakṣaṇam /
yatra satsvevāvayaveṣvavayavino 'bhāvaḥ sati guṇini guṇasyābhāvastatra bhedābhedāvityādi draṣṭavyam /
anyathā yatrāvayavāvayavyādīnāṃ yugapadvināśastatra bhedābhedāvuktau na syātām /

idamuktaṃ bhavati /
satyapi tasminnasattvādityanena hetunāvayavyādīnāmavayavādibhyo bhedamātraṃ vā sādhyate 'tyantabhedo vā /
ādye siddhasādhanatā bhāgāsiddhiśca /
tathāhi /
satyapyu(tyu)pādāne kadācidupādeyamasat /
yathā paṭaḥ /
evaṃ satyapi dravye kecidguṇā asanto yathā pākajādayaḥ /
tathā satyapyā(tyevā)śraye kāścitkriyā asatyo yathā paṭacalanādayaḥ /
jātiśca kācitsati jātimatyasatī /
yathā brāhmaṇam /
tatra bhedābhedayoraṅgīkārādbhedasādhanaṃ siddhaviṣayam /
gaganatadbhāgayorīśvarādyāśritajñānādiguṇakriyājātiṣvabhāvādbhāgāsiddhatvaṃ hetoḥ iti /
na dvitīyaḥ /
kālātyayāpadiṣṭatvāt /
abhedasya prāgupapāditatvādupapādayiṣyamāṇatvācceti /


*7,573*

syādetat /
yathā bhedasādhakānāṃ vyapadeśabhedādīnāṃ viśeṣāśrayeṇaivānyathāsiddhiruktā /
tathā satyapi tasminnasattvasyāpi viśeṣaṇaiva nirvāhaḥ kriyatām /
kiṃ bhedābhedābhyupagamena /
maivam /
viśeṣasya bhedakāryavyavahāramātranirvāhakatvena vināśaṃ pratyanirvāhakatvāt /
sakalabhedakāyarkāritve viśeṣo bheda eva, na tatpratinidhiḥ syāt /
kiñcānekāśritasyāvayavino dvitvādeścāśrayeṇātyāntābhede satyāśrayaṇāmapi parasparamabhedaḥ prasajyate /
tatparihārārthaṃ tāvadavaśyaṃ tatra bhedo 'ṅgīkaraṇīyaḥ /
nacāvacchedakena vinā bhedābhedabhūmeḥ saṅgrahaḥ syādityayāvadāśrayabhāvitvameva grāhyam /
tatrāpi viśeṣa eva saṅkaraṃ vārayiṣyatīti tu nirastam /
kiñca pramāṇānusāriṇakṣa vyavasthā natu svecchānusāriṇī /
pramāṇaṃ tu bhedābhedāvavagāhata iti vakṣyate /
nanu anityadravyāśritā ekatvādayo 'pi guṇāḥ kiṃ bhedavantasteṣāmapi dravyakāryatayā taduttarakṣaṇabhāvitvāditi /
maivam /
uktottaratvāt /
uktaṃ hyetat /
upādānadravyaṃ guṇavadupādeyatayā pariṇamata iti /


*7,576*

nanu bhedābhedāvekatra viruddhau /
tatkathamayāvadāśrayabhāvināmavayaviguṇakamarsāmānyānāmavayavādibhirbhedārbhedābhyupagama ityata āha- viśeṣameveti //

viśeṣameva saṃśritya ... // MAnuv_2,2.104a //

NYĀYASUDHĀ:
bhedābhedāvekatra bhavata iti sambandhaḥ /
avadhāraṇaṃ kālādibhedavyāvṛttyartham /


*7,577*

kathaṃ viśeṣāśrayaṇe virodhaśāntirityata āha- virodha iti //

... viśeṣo balavān yataḥ // MAnuv_2,2.104b //

NYĀYASUDHĀ:
balavānbhedakāryakāraṇa iti śeṣaḥ /
tato viśeṣaṃ samāśrityaikatra bhedābhedau bhavata ityanvayaḥ /
ayamarthaḥ /
bhedo hi virodhaśāntihetuḥ /
tathāhi /
kvacidāśrayabhedo yathā madhurāyāṃ devadattasadbhāvaḥ srughne tadabhāvaḥ /
kvacitkālābhedo yathā madhurāyāmeva devadattasya bhāvābhāvau /
kvacitpratiyogibhedo yathā gavayo goghaṭābhyāṃ sadṛśo visadṛśaśceti /
bhedapratinidhiśca viśeṣa ityuktam /
ataḥ kathamasau bhedābhedāvekadaivaikatraiva nāvasthāpayediti /


evaṃ tarhyatiprasaṅgaḥ /
sarvatra viśeṣamāśritya virodhasyotsādayituṃ śakyatvādityata āha- dṛṣṭīti //

dṛṣṭipramāṇataścaiva ... // MAnuv_2,2.104c //


*7,577f.*

NYĀYASUDHĀ:
dṛṣṭiśca tatpramāṇaṃ ca /
pramāṇabhūtā dṛṣṭirityarthaḥ /
tato bhedābhedau na viruddhāviti sambandhaḥ /
caśabdo viśeṣeṇa saha dṛṣṭeḥ samuccaye /
na svecchāmātreṇa bhedābhedāvityupetya viśeṣeṇa virodhābhāvo 'bhidhīyate /
yenātiprasaṅgaḥ syādityevaśabdaḥ /
uktaṃ tāvadavayavāvayavyādyabhedagrāhiṇī dṛṣṭirasti /
sambaddhavastubuddhito vilakṣaṇatayānuvyavasāyāt /
asti ca bhedagrāhiṇī satyapi tasminnasattvāditi hetujanitā dṛṣṭiriti /
nacaite bādhyabādhake /
anyatarānanuvṛttiprasaṅgāt /
nāpi pratipakṣabhūte /
pratipattṛṇāmubhayodāsīnatāpatteḥ /
caivam na /
ato dvayorapi prāmāṇyataśca bhedābhedayoravagatayonar virodhaḥ /
tadidamuktam- pramāṇata iti //


*7,579*

nanu bha(va)vetāṃ bhedābhedavekatraivaikadeva pramitau /
tathāpi kathaṃ virodhaśāntirityata āha- virodha iti //

... virodho darśane katham // MAnuv_2,2.104d //

NYĀYASUDHĀ:
sahadarśane sati kathaṃ virodho vaktuṃ śakyate /
sahadṛṣṭau viruddhau ceti vipratiṣiddhamiti bhāvaḥ /

etadeva vivṛṇoti- virodho hīti //

virodho hyavirodhaśca yato darśanamānagau /
tato dṛṣṭe virodhastu sadbhirāpādyate katham // MAnuv_2,2.105 //



*7,579f.*

NYĀYASUDHĀ:
sarvatra parasparaparihāreṇaiva sattvadarśanaṃ mahānavasthānalakṣaṇavirodhe pramāṇam /
kvacitsahadarśanaṃ cāvirodhe /
anyasyānirūpaṇāt /
ataḥ sahadṛṣṭe bhedābhedalakṣaṇe vastudvaye virodhaḥ kathamucyeta /
sahadarśane hyavirodhaḥ syāt /
punarvirodhakathane vyāghātānivāraṇāditi /
hiśabdena śītoṣṇādau rūparasādau ca virodhāvirodhayordarśanaikapramāṇatvaṃ nidarśayati /
tuśabdasya dṛṣṭe tviti sambandhaḥ /
sadbhirvidvadbhirityupahāsaḥ /
vaiśeṣikādayo hi saṃyogavibhāgaśabdātmaviśeṣaguṇānāṃ tatraiva tadaiva bhāvābhāvāvupetya sahadarśanādvirodho nāstīti vadantaḥ punaratra sahadarśane 'pi virodhamudbhāvayantaḥ svavyāhatabhāṣiṇaḥ svoktavismaraṇaśīlāḥ svadṛṣṭipakṣapātinaḥ kathaṃ santaḥ syuḥ /
sarvatrāsahadṛṣṭayoryadi kaścidāgrahamātreṇa sahāvasthānaṃ manyate taṃ pratyeva virodhodbhāvanaṃ kriyate- nānyatheti //


*7,581*

dharmadharmiṇorbhedābhedau kvaciditi saṅkṣepeṇoktam /
tatkiṃ sarveṣvapi dravyeṣūta keṣucidevetyapekṣāyāmāha- abhinna iti //

abhinno bhagavān svena tadanyena vibhedavān // MAnuv_2,2.106ab //

NYĀYASUDHĀ:
bhagavāniti cetanamātropalakṣaṇam /
svena svāvayavaguṇakriyādibhiḥ /
tadanyena prakṛtijīvajaḍātmanā prapañcenetyevaṃ vyavasthitāveva bhedābhedau na tvekaviṣayāvityarthaḥ /
ayāvaddravyabhāvidharmairbhedābhedau kuto na syātāmityata āha- nityā iti //

nityā dharmāstadīyāstu sarve 'smānnaiva bhedinaḥ // MAnuv_2,2.106cd //

NYĀYASUDHĀ:
tuśabdo 'vadhāraṇe /
asmāt kāraṇam /
asmāt bhagavataḥ /
dvitvādisaṅkhayāvyatiriktā iti śeṣaḥ /


*7,583*

kva tarhi bhedābhedāvityata āha- sāmastyeti //

sāmastyocchedino 'nyatra dharmā ubhayarūpakāḥ /
bhāve ... // MAnuv_2,2.107a-c //


NYĀYASUDHĀ:
anyatra parameśvarāt /
jaḍe vastunīti yāvat /
satyeva dhamirṇi sāmastyenocchedavanto ye dharmāste ubhayarūpiṇo bhinnābhinnā ityarthaḥ /
abhibhavavyāvṛttyarthaṃ sāmastyetyuktam /
yadvā sāmastye dravyasyāvikalatve nāśābhāve 'pi ye ucchedina iti vyākhyeyam /
kiṃ svasadbhāvavelāyāmabhedino 'sadbhāvavelāyāṃ bhedina ityevaṃ kālabhedena bhedābhedāvityata uktam- bhāva iti //
svasadbhāvadaśāyāmevobhayarūpakā ityarthaḥ /
vinaṣṭasyāsattvena bhedacintānavakāśāt /
prāgatyantābhede vināśāsambhavācca /
kuto bhinnābhinnā ityata āha- ta eveti //

... ta eva cocchedāt tadanye ca samastaśaḥ // MAnuv_2,2.107cd //

NYĀYASUDHĀ:
pratyakṣabalena ta eva dharmisvarūpabhūtā eva ucchedāt satyeva dharmiṇyasattvāddhetostadanye /
caśabdau mithaḥ samuccayārthau /
samastaśa ityayāvaddravyabhāvivivakṣayoktam /


*7,584*

yaduktaṃ yāvadavayavabhāvino 'vayavino 'vayavairatyantābhedo 'yāvadavayavabhāvinastu bhedābhedāviti /
tenānyadapi codyaṃ parihṛtamityāha- aṃśāṃśinoriti //


*7,585*

aṃśāṃśinorabhedena tvaṃśasaṃyoga eva hi /
aṃśino nānavasthāto yadyapyaṃśeṣvaviśramaḥ // MAnuv_2,2.108 //


NYĀYASUDHĀ:
tathā hi /
sarvadikṣvapi sambandhāditi yadaṃśataḥ saṃyoga ityuktaṃ tadayuktam /
anavasthāpatteḥ /
ghaṭasaṃyogo hi ghaṭāṃśasaṃyogapūrvakaḥ /
so 'pi tadaṃśasaṃyogapūrvakaḥ /
naceyaṃ niraṃśe paramparā viśrāmyatīti vācyam /
aṃśaparamparāyā aviśramasyāpyaṅgīkṛtatvāt /
ataḥ pūrvapūrvasaṃyogānutpattāvuttarottarānutpattiprasaṅgādaṃśataḥ saṃyoga iti niyamo nopapadyata iti /
tadidamasaṅgatam /
yadyapyaṃśata eva saṃyogo yadyapi cāṃśeṣvaṃśaparamparāyā aviśramastathāpyaṃśāṃśinorabhede naivāṃśasaṃyoga eva hi yasmādaṃśinaḥ saṃyogo 'to nānavastheti /


*7,586*

ayamabhisandhiḥ /
syādiyamanavasthā yadi sarvatrāṃśata eva saṃyoga iti vadatāmasmākamaṃśinaḥ saṃyogoṃ'śasaṃyogenaiva jāyata ityabhiprāyaḥ syāt /
nacaivam /
kintu yo yasya aṃśinaḥ saṃyogaḥ sa tadaṃśe vartate /
niraṃśasya tu saṃyogaḥ kva nāma vartatām /
ataḥ paramāṇvoḥ saṃyoge sati tadvṛttyarthamaṃśo 'ṅgīkaraṇīya iti /
na hyevaṃ sati kācidanavasthāsti /
anavasthitakāryakāraṇabhūtāsiddhasaṃyogaparamparāśrayaṇābhāvāt /
etāvattu bhavet /
ghaṭasaṃyogaḥ syāt /
pramāṇavirodhācca /
ghaṭasaṃyogo ghaṭavṛttirapi ghaṭasaṃyogaḥ syāt /
pramāṇavirodhācca /
ghaṭasaṃyogo ghaṭavṛttistadguṇatvāttadrūpavaditi /
ghaṭāṃśavṛttiḥ saṃyogo na ghaṭasaṃyogaḥ tadanyavṛttitvāt /
paṭasaṃyogavaditi /
etadapyanavakāśam /
aṃśāṃśinorabhedasya sādhitatvāt /
atiprasaṅgo hi tadā syādyadi paṭavadghaṭāṃśo 'pi ghaṭādatyantabhinnaḥ syāt /
abhede tu kvātiprasaṅgaḥ /
anumānasyāpyādyasya siddhasādhanatā /
aṃśavṛttereva ghaṭavṛttitvāt /
aṃśāvṛttitve sati ghaṭavṛttitvasādhane dṛṣṭāntaḥ sādhyavikalaḥ syāt /
dvitīyastu hetuḥ svarūpāsiddho 'nyathāsiddho veti /
yadi ghaṭasaṃyogo ghaṭāṃśe vartate tarhi ghaṭāṃśasaṃyogaḥ kva vartata iti cet /
anena (eva) nyāyena tadaṃśe so 'pi tadaṃśa iti brūmaḥ /
nacaivamanavasthā /
sarve 'pyaṃśisaṃyogāstattadaṃśavṛttaya ityatretarāpekṣāyā abhāvāt /


*7,588*

evaṃ tarhi paramāṇuvṛttirapi saṃyogo ghaṭasaṃyogaḥ syāditi cet /
ko netyāheti /
aṃśasaṃyoga eva hyaṃśinaḥ saṃyogo 'to nānavasthetyuktamanavasthāparihāraṃ vivṛṇoti- ekasminniti //

ekasmin jāta evānyaḥ saṃyogo jāyate yadi /
anavasthā tadaiva syāt saṃyogaikye bhavet kva sā // MAnuv_2,2.109 //


NYĀYASUDHĀ:
avayavaparamparāyā aviśramamabhyupagamyaikaikasminnavayavasaṃyoge jāta evānyo 'vayavasaṃyogo jāyata iti yadyaṅgīkurmastadaivānavasthā syāt /
saṃyogaikye avayavisaṃyogaḥ kriyāto jātastadavayave vartate, avayavavṛtteḥ saṃyogādaparo 'vayavinaḥ saṃyogo nāstīti vāde tu, kva sānavastheti /


etenaitadapi nirastam /
yadāhuḥ /
saṃyogastrividho 'nyatarakarmajobhayakarmajasaṃyogajabhedāt /
tatrānyatarakarmajo yaḥ kriyāvatā niṣkriyasya, yathā sthāṇoḥ śyenena /
ubhayakarmajastu viruddhadikkriyayoḥ sannipāto, yathā mallayoḥ /
saṃyogajastu saṃyogaḥ kāraṇākāraṇasaṃyogātkāryākāryasaṃyogo, yathā hastatarusaṃyogātkāyatarusaṃyoga iti /

nahi hastatarusaṃyogātiriktaḥ kāyatarusaṃyogo 'sti /
yenāsau tajjanyaḥ syāt /
pramāṇābhāvāt /
kintu hastakarmaṇā janito hastavṛttiḥ saṃyoga eva hastakāyayorabhedātkāyasaṃyogo bhavati /

ata eva hastasyāśucisaṃyoge kāyakṣālanādividhayo 'pyupapadyate /


*7,591*

ata eva vibhāgajo 'pi vibhāgo nirastaḥ /
dvividhaṃ hi tamācakṣate /
kāraṇākāraṇavibhāgātkāraṇavibhāgācceti /
tatrādyo yathā /
hastataruvibhāgātkāyataruvibhāgaḥ /
dvitīyo yathā /
dvitantukāvayave tantau karmotpannaṃ tasya tantvantarādvibhāgaṃ karoti /
vibhāgāttantvoḥ saṃyogo naśyati /
tato dvitantukavināśaḥ /
tata idānīṃ tantvorvartamāno vibhāgaḥ sakriyasyāvayavasya dvitantukasaṃyuktākāśādideśādvibhāgaṃ karotīti /

tatrādyastāvadanupapannaḥ /
hastataruvibhāgātiriktasya kāyataruvibhāgasyānupalambhāt /
hastakarmaṇā janito hi vibhāgo hastakāyayorabhedāddhastakāyaguṇo bhavati /
ata eva vivādādhyāsito vibhāgo na karmāsamavāyikāraṇakaḥ karmaikārthāsamavetatvāt /
śabdavaditayasiddhatayā nirastam /


*7,592*

dvitīyastvanupapannataraḥ /
tantukarmaṇaiva tantostantvantarādākāśādideśācca vibhāgotpattyupapattau kramakalpanānupapatteḥ /
anyathāṅgulikarmaṇāṅguleraṅgulyantarādeva vibhāgo bhavati ākāśādideśāttu vibhāgādeveti syāt /

nanvaṅgulikarma aṅgulivibhāgamākāśādivibhāgaṃ ca karoti /
tayorvibhāgayoraviruddhatvāt /
tantukarma tu tantvantaravibhāgamākāśādivibhāgaṃ (ca) na kartumarhati /
tayorvibhāgayoḥ dravyārambhakasaṃyogavirodhitvāvirodhitvarūpavirodhāt /
nahyaviruddhātkāraṇādviruddhakāryotpattiḥ sambhavatīti /
maivam /
ekasmādeva karmaṇaḥ saṃyogavibhāgajananābhyupagamāt /
tantukarmarā dravyārambhakānārambhakatantvantarākāśasaṃyogajanmāṅgīkārācca /
anyathā kāraṇākāraṇasaṃyogajasaṃyogavatkāraṇamātrasaṃyogajo 'pi saṃyogaḥ svīkāryaḥ syāt /


*7,595*

nanu saṃyogasya na svarūpato virodho 'sti /
yato dravyānārambhakadravyasamaveta eva saṃyogo dravyānārambhakaḥ /
dravyānārambhakaṃ ca dravyaṃ saptavidham /
ārabdhadravyamantyāvayavisparśarahitaṃ vinaśyadavasthaṃ vinaśyadavasthasaṃyogaṃ niṣphalārambhaṃ vijātīyaṃ ceti /
tataḥ karmaṇaiva saṃyogadvayajanmopapattiriti /
eyaṃ tarhi vibhāgayorapi ko virodhaḥ /
dravyārambhānārambhaprayuktatvādvirodhapratīteḥ /
tantudvayavibhāgajanakaṃ tantukarma na tantvākāśavibhāgajanakaṃ dravyārambhakasaṃyogavirodhivibhāgajanakakarmatvāt /
dravyānrārambhakasaṃyogavirodhivibhāgajanakakarmavat ityābhāsasamānayogakṣematvāt /
tantukarma na tantvantaravibhāgajanakaṃ karmatvāt sampratipannakarmavadityapi prayogasambhavāt tatra pramāṇabādha iti cet /
samamanyatrāpi /
vibhāgadvayayaugapadyānubhavāt /
tantukarma ākāśavibhāgajanakaṃ karmatvāditi pratipakṣaśca /
ākāśavibhāge vibhāgena kartavye karmaṇo nimittatvābhyupagamātsiddhasādhanamiti cenna /
janakaśabdasyāsamavāyyarthatvāt /


*7,600*

etena vimataṃ karma dravyārambhakasaṃyogavirodhitadavirodhivibhāgajanakaṃ na bhavati karmatvāditi nirastam /
vimataṃ karma dravyārambhakānārambhakasaṃyogārambhakaṃ na bhavati karmatvāt /
śyenakarmavadityābhāsatulyatvātsatpratipakṣatvācca /
yadākāśavibhāgajanakaṃ karma na taddravyārambhakasaṃyogavirodhivibhāgajanakaṃ yathāṅgulikarmeti vyāptestantukarmaṇo gaganavibhāgajanakatve tantvantaravibhāgajanakatvaṃ na syāditi cennana /
yadyatpradeśavibhāgajanakaṃ na bhavati na tattatpradeśasthadravyavibhāgajanakamiti vyāpterākāśadeśavibhāgājanakatve tantvantarādapi vibhāgajanakaṃ na syāditi pratiprasaṅgasambhavāt /


*7,601*

kiñca tantorākāśavibhāgo yadi vibhāgajo na tu karmajastadā sakarmakasyevākarmakasyāpi kuto na syāt /
vibhāgasyobhayatrāpi sāmyāt /
uttaravibhāge karma nimittakāraṇamityato neti cenna /
ādyavibhāgajananenaivopakṣīṇasya kāraṇatvānavadhāraṇāt /
avadhāraṇe vāsamavāyitvasya anivāraṇāt /
anyathā tallakṣaṇasyātivyāpterityalaṃ vistareṇa /


*7,604*

evaṃ chalatvenānavasthāprasaṅgaṃ nirākṛtya prakārāntareṇa nirākaroti- aṃśa iti //


aṃśisaṃyogasyāṃśavṛttitvadṛṣṭeśca nānavasthādoṣa ityarthaḥ /
dṛṣṭatve kathamadoṣatvamityata āha- dṛṣṭa iti //

aṃśe saṃyogadṛṣṭeśca ... // MAnuv_2,2.110a //

NYĀYASUDHĀ:
āpādake 'rthe dṛṣṭe sati sā anavasthitiḥ kā na dūṣaṇamiti yāvat /
etaduktaṃ bhavati /
yadyaṃśataḥ saṃyogaḥ syāttadānavasthā syāttataśca saṃyogābhāva evāpadyeta /
nacāsau yuktaḥ /
tasmānnāṃśataḥ saṃyoga iti hi viparyaye paryavasānaṃ kartavyam /
anavasthāyāstarkatvāt /
viparyayāparyavasāyinaśca tarkābhāsatvaniyamāt /

... dṛṣṭe kā sānavasthitiḥ // MAnuv_2,2.110b //

NYĀYASUDHĀ:
atrāṃśataḥ saṃyoge na bhavatīti ko 'rtho yadyaṃśisaṃyogasyāṃśasaṃyogapūrvakatāniyamo nāstīti /
tarhyevamiti vadāmaḥ /
yadyaṃśisaṃyogoṃ'śavṛttirna bhavatīti /
tanna /
ghaṭādyaṃśisaṃyogasya tadaṃśavṛttitāyāḥ pratyakṣadṛṣṭatvena viparyayaparyavasānasya bādhitatvāt /
ghaṭasaṃyogo ghaṭa eva vartate /
kintvavyāpyavṛttitvāttadaṃśavṛttirivāvabhāsata iti cet /
keyamavyāpyavṛttitā nāma anyā aṃśavṛttitvāt /
svābhāvasamānādhikaraṇatvamiti cenna /
viruddhatvāt /
dṛṣṭatvādavirodha iti cenna /
kimaṃśabhedena bhāvābhāvau dṛśyete uta ghaṭa eveti sandehāt /
na hyaviruddhaviṣayatve sati viruddhaviṣayatāṅgīkartumucitā /
upādhibhedādavirodha iti cet /
ke ta upādhayaḥ /
aṃśā eveti cet /
ta eva santu tarhi saṃyogāvābhāvāśrayāḥ kimaṃ(śi)śavṛttitvena viruddhena aṅgīkṛtena /
aṃśāṃśinorabhedenātiprasaṅgasyāpāstatvāditi /


*7,609*

pratitarkaparāhatatvāccātiprasaṅgo 'yamityāha- yadīti //

yadyaṃśago na saṃyogaḥ kāryeṣu prathimā katham // MAnuv_2,2.110cd //

NYĀYASUDHĀ:
yadi kāraṇānāṃ saṃyogastadaṃśavṛttirna syāttadā tadārabdheṣu kāryeṣu kāraṇāpekṣayā parimāṇotkarṣo na syādityarthaḥ /

ayamabhisandhiḥ /
kāraṇaparimāṇāpekṣayā kārye parimāṇotkarṣastāvatsarvatra pracayajanyaḥ /
dvitūlake tathā darśanāt /
pracayahīnatūladvayajanyarajjudravye tadabhāvopalambhācca /
pracayaśca kāraṇayoḥ praśithilaḥ saṃyogaḥ /
praśithilatā ca saṃyogasya keṣucidaṃśeṣu vṛttiḥ keṣucidavṛttireva /
nānyā /
anirūpaṇāt /
tataḥ saṃyogasyāṃśavṛttitvābhāve pracayo 'sau na bhavatīti kāraṇābhāvādutkṛṣṭaparimāṇotpādo na syāditi /


*7,610*

astvanyasya saṃyogo yathātathā /
prastute paramāṇau saṃyogasyāṃśavṛttitvābhāve nātiprasaṅga iti cenna /
anvayavyatirekābhyāṃ kāraṇaparimāṇotkṛṣṭasya kāryaparimāṇasya pracayākhyāṃśavṛttisaṃyogajatvāvadhāraṇātkāraṇābhāve ca kāryābhāvaniyamātparamāṇusaṃyogasyāṃśavṛttitvābhāve tatkārye dvayaṇuke paramāṇuparimāṇādutkṛṣṭaparimāṇaṃ notpadyetetyasyaiva bādhakasya sattvāt /
nanvidamiṣyāpādanam /
paramāṇuto dvayaṇuke parimāṇotkarṣābhāvādityata āha- paramāṇoriti //

paramāṇoraṇornāsti mahattetyadbhutaṃ vacaḥ // MAnuv_2,2.111ab //


*7,611*
NYĀYASUDHĀ:
paramāṇuparimāṇādaṇodvaryaṇukasya mahattā parimāṇotkarṣo nāstīti vaco 'dbhutaṃ svavyāhataṃ pramāṇaviruddhaṃ cetyarthaḥ /
ayamāḍhyo 'yaṃ paramāḍhya itivadaṇuparamāṇuśabdābhyāmeva parimāṇatāratamyāvagatestadabhāvavacanaṃ svavyāhataṃ bhavati /
dvitantukaparimāṇavada(saṃmṛdi)samuditāvayavajanyadravyaparimāṇatvena dvayaṇukaparimāṇasya paramāṇuparimāṇādutkarṣasyānumānāvagatvācceti /

nanu yat kāraṇaparimāṇajanyamutkṛṣṭaparimāṇaṃ tadeva pracayajanmay /
tryaṇukaparimāṇavaddvayaṇukaparimāṇamapi kāraṇaparimāṇajanyaṃ na bhavati /
kintu kāraṇasaṃkhyājanyameva /
tatkathaṃ paramāṇoḥ pracayābhāve dvayaṇuke parimāṇotkarṣānutpādāpādanamityata āha- aṇūnāmiti //

aṇūnāṃ prathimāpekṣāṃ vinaiva tṛyaṇuke 'pi saḥ /
paramāṇormahattvaṃ ca vinetyetad vacaḥ katham // MAnuv_2,2.111c-f //


NYĀYASUDHĀ:
dvayaṇukānāṃ parimāṇotkarṣāpekṣāṃ vinaiva saṃkhyāmātreṇa tryaṇuke sa parimāṇotkarṣo jāyate /
tathā paramāṇormahattvaṃ parimāṇotkarṣaṃ vinā kevalasaṃkhyayā dvayaṇuke parimāṇotkarṣo jāyata ityetadvacaḥ kathaṃ ghaṭate /
mahaddīrghavadveti nirastatvāditi bhāvaḥ /
cāpiśabdāvitaretarasamuccaye /
atra parimāṇamātragrahaṇe kartavye prathimeti mahattvamiti coktirvisadṛśaparimāratvasyānapekṣāhetoḥ nirākaraṇaṃ smārayitumiti /


*7,613*

aṃśāṃśinoratyantābhedo bhedābhedau ceti yaduktaṃ tadviśadayati- aṃśina iti //

aṃśino 'ṃśairabhedo 'yamaṃśena tu bhidābhidā // MAnuv_2,2.112ab //

NYĀYASUDHĀ:
yathā gaganāderyāvadaṃśabhāvinoṃ'śinaḥ svāṃśairatyantābhedastathā paṭāderaṃśino 'pi sarvairaṃśaiḥ atyantābhedaḥ ekaikāṃśena tu bhidābhidā /
ayamityuttaravākyena sambaddhayate /

nanvetadayuktam /
sarvatantubhāve 'pi kadācitpaṭasyābhāvāt /
khaṇḍite bhedābhedasvīkārāt /
ata ekenaiva sarvairapi paṭasya bhedābhedāvevopacitau /
tathācoktaṃ brahmatarke /
"tantubhyo 'nyaḥ paṭaḥ sākṣātkasya dṛṣṭipathaṃ gataḥ /
ananyaścettantubhāve paṭābhāvaḥ kuto bhavet'; iti /
ucyate /
vyatiṣaṅgaviśiṣṭā hi tantavo 'vagamyate /
naca tadbhāve kadāpi paṭābhāvaḥ /
tasmādvayatiṣaṅgaviśeṣaviśiṣṭaiḥ sarvatantubhiḥ paṭasyātyantābheda eva /
avivakṣitavyatiṣaṅgaiḥ sarvatantubhistu bhedābhedāveveti na kaścidvirodhaḥ /

nanvevaṃ tarhi vyatiṣaktatantuvyatirekeṇa paṭābhāve paramāṇupuñjavādāpattiriti /
maivam /
yathā hi guṇānāṃ dravyābhede('pi) na dravyaṃ nirguṇam /
yathā ca pareṣāṃ sāmānyādāvatiriktasattābhāve('pi) nāsattvam /
tathā vyatiṣaktatantava eva paṭastathāpi na paṭābhāvaḥ /
kintu sati vyatiṣaktāstantavaḥ paṭaśca /
sa ca tebhyo na bhidyate iti /
kathametaditi cet /
viśeṣaśaktayaiveti brūmaḥ /


*7,616*

nanu vyatiṣaktasarvatantubhyo 'pi paṭasya bhedo 'ṅgīkāryaḥ /
tantuvyatiṣaṅgānantaraṃ paṭasya jāyamānatvāt /
kathaṃ caikaikatantunābhedaḥ ekaikatra paṭabuddhayabhāvādityata āha- sarveti //

sarvapratyakṣaviṣayaḥ kathameva hyapohyate // MAnuv_2,2.112cd //

NYĀYASUDHĀ:
ukto 'yamarthaḥ sarvapratyakṣaviṣayo yasmāttasmātkathamevāpodyate /
etaduktaṃ bhavati /
asti tāvadvayatiṣaktasarvatantūnāṃ paṭasya cābhede pratyakṣam /
tatpratīteḥ sambaddhavastudvayapratītivailakṣaṇyasya sākṣisiddhatvāt /
naca bhede pramāṇamasti /
yena so 'pi svīkariṣyate /
jāyatāṃ nāma tantuvyatiṣaṅgaṃ paṭamācakṣmahe /
kintu vyatiṣaṅge sati yattantūnāṃ viśiṣṭaṃ rūpam /
nacaikaikatantuparityāge sarvatantavo nāma santi /
atastatrāpyastyevābhedapratītiḥ /
ekaikatra paṭabuddhayabhāvastu bhedamākṣipati /
natu pratyakṣasiddhamabhedamapavadatīti /


*7,621*

athāpi syāt /
avayavyādīnāmavayavādibhirabhedo nopapadyate /
eko hyavayavyaneke cāvayavāḥ /
tadabhede 'vayavānāmapyabhedo 'vayavino vā bhedaḥ prasajyeta /
tathā guṇāśca kecidanekāśritāḥ /
ekaiva hi saṃyogvayaktirdvayordvayorvartate /
tathā vibhāgavyaktirapi /
saṅkhayā ca dvividhā /
ekatvānekatvabhedāt /
tatraikatvasyaikadravyagatatve 'pi dvitvādikamenekāśritam /
evaṃ pṛthaktavamapi dvividham /
ekapṛthaktavamanekapṛthaktavaṃ ca /
tatraikapṛthaktavasyaikadravyavṛttitve 'pi dvipṛthaktavādikamane(kadravyāśri)kāśritameva /
evaṃca guṇānāṃ guṇinaikye saṃyogādyāśrayānekadravyābhedo vā saṃyogādibhedo vā'padyeta /
sāmānyaṃ caikamanekāśritam /
tasya vyaktayabhede vyaktīnāmapyabhedaḥ sāmānyasya vā bhedaḥ prasajyetetyataḥ saṃyogavibhāgapṛthaktavānāṃ tāvadanekāśritatvaṃ nāstītyāha- saṃyogaśceti //

saṃyogaśca vibhāgaśca bhedaścaiva pṛthak pṛthak // MAnuv_2,2.113ab //

NYĀYASUDHĀ:
bheda iti pṛthaktavamucyate /
caśabdā itaretarayoge /
pṛthakpṛthageva ekaikadravyāśritā evetyarthaḥ /
tataścaikena guṇenābhinnatve dravyayorapyabhedaḥ syādityatiprasaṅgasyāpādakāsiddhiḥ /
anekadravyābhinnatve guṇasyāpi bhedaḥ syādityasyeṣyāpattirdūṣaṇamityuktaṃ bhavati /


*7,624*

nanu ghaṭapaṭasaṃyogavibhāgabhedā ghaṭapaṭasambandhitayānubhūyate /
tatkathamekaikāśritāḥ /
tathātve caikaikasminneva saṃyuktādipratyayaprasaṅga ityata āha- anyonyeti //

anyonyapratiyogena hyubhayorapi dṛśyate // MAnuv_2,2.113cd //

NYĀYASUDHĀ:
pratiyogaḥ pratiyogitvam /
anyonyasya pratiyogo 'nyonyapratiyogaḥ /
yatsaṃyogādirubhayorapi dṛśyate tadanyonyapratiyogena hi nimittena /
atrobhayorapītyanekopalakṣaṇam /
bhedasya bahusambandhitayāpi pratīteḥ /
etaduktaṃ bhavati /
ghaṭapratiyogikaḥ saṃyogādiḥ paṭe 'sti /
tathā paṭapratiyogiko ghaṭe 'sti /
tasmādubhayasambandhitayā pratibhāso 'tiprasaṅgābhāvaśca yujyata iti /


*7,625*

syādetadyadi saṃyogādīnāmekaikavṛttitve pramāṇaṃ syāt /
tadeva nāstītyata āha- anyonyeti //
pṛthak pṛthagevetyanuvartate /
anyonyapratiyogena hetunā saṃyogādikamubhayorapi pṛthak pṛthageva hi dṛśyate /

ayamarthaḥ /
paṭo ghaṭena saṃyukto ghaṭādvibhakto ghaṭādbhinna iti paṭadharmaḥ saṃyogādigharṭapratiyogikatayā pratīyate /
yaśca yatpratiyogiko nāsau taddharmaḥ /
yathā sthavirapratiyogikamaparatvaṃ na sthaviradharmaḥ /
tasmānnāyaṃ saṃyogādirghaṭadharmaḥ /
evaṃ ghaṭadharmaḥ saṃyogādiḥ paṭapratiyogitayopalabhyamāno na paṭadharmo bhavitumarhati /
tathāca pṛthak pṛthageva saṃyogādiranekadharmo 'vagamyata iti /


*7,626*

nanvastu saṃyogavibhāgayoriyaṃ gatiḥ /
natu pṛthaktave /
yaddhi ghaṭātpaṭaḥ pṛthak paṭācca ghaṭaḥ pṛthagityanyonyapratiyogikatayā pratīyate tadekapṛthaktavaṃ pṛthak pṛthagevābhyupagamyate /
yattu bhinnāvimau bhinnā ime iti pratīyate tadanekapṛthaktavamanekāśritameva pratiyogyanirūpyasyaikāśrita(śraya)tve mānābhāvādityata āha- bhinnā iti //

bhinnā iti tu bhedānāṃ samudāyo hi dṛśyate /
yathaiva ca padārthānām ... // MAnuv_2,2.114a-c //


NYĀYASUDHĀ:
ime bhinnā ityādipratītau bhedānāṃ samudāyo 'nekatvaṃ hi dṛśyate /
katham /
yathaiva ca padārthānām /

etaduktaṃ bhavati /
yathā hi śuklā ime paṭā ityādipratītāvaneke paṭā anekāni ca tadviśeṣaṇāni śauklayānyavabhāsante /
tathā bhinnā ima ityādipratītāvapyaneke padārthā aneke ca bhedāḥ prakāśante ityabhyupagantavyam /
naca viśeṣapramāṇamasti /
yenātrānyo vidhirbhaviṣyatīti /

etena saṃyuktāvimāvityādipratītirapi vyākhyātā veditavyā /


*7,628*

nanvanayorbhedo 'mīṣāṃ bheda iti pratītāvanekāśritaṃ pṛthaktavamupalabhyate /
tatkathametaditi cet /
kimatrānekasya dharmitayāvabhāsaṃ pramāṇayasi, uta dharmasyaikatvāvabhāsam, utobhayāvabhāsam /
pakṣatraye 'pyuttaramāha- anayoriti //

... anayorbheda ityapi // MAnuv_2,2.114d //
ito 'muṣyāmuto 'pyasya bhedo dṛṣṭo dvidharmikaḥ // MAnuv_2,2.115ab //


NYĀYASUDHĀ:
asyāmapi pratītāvito ghaṭādamuṣya paṭasyāmutaḥ paṭādamuṣya ghaṭasya bheda ityevaṃ dvidharmiko bhedo dṛṣṭaḥ /
tathācānekasya dharmitve 'pi dharmasyaikatvāvabhāsāsammaternānenābhimatārthasiddhirityuktaṃ bhavati /
anenaivānayoḥ saṃyoga ityādipratītirapi vyākhyātā draṣṭavyā /

nanu vacanaliṅgā hi vakturabhiprāyāḥ /
bheda iti caikavacanaṃ prayujyate /
tena anumīyate 'syāṃ pratītāveka eva bhedo dvidharmiko dṛṣṭa iti /
tasmādanyonyapratiyogikānekadharmikānekabhedaviṣayatvaṃ pratīterna vaktuṃ śakyamityata āha- tatreti //

tatraikavacanaṃ yattad viprāṇāṃ bhojanaṃ yathā // MAnuv_2,2.115cd //


*7,629*

NYĀYASUDHĀ:
tatra anayorbheda ityādivākye, bhedadvaye vā /
bhojanamityekavacanaṃ yathā tathetyarthaḥ /
etena ekavacanena pratīterekārthaviṣayatvānumāne 'naikāntikatvaṃ samudāyaviṣayatvenānyathāsiddhiścetyuktaṃ bhavati /
avayavinastvekatve 'pi na kaściddoṣaḥ /
ākāśasya svāvayavairabhedavadavayavānāmapyabhedasya aṅgīkṛtatvāt /
paṭasya ca yādṛśena tantusamudāyenātyantābhedo 'bhihitaḥ sa eka eva /
vyatiṣaktānāṃ tantūnāṃ viśiṣṭākāro hyasau /
sa cāgantukatvāttantubhyo bhinnābhinna eva /
ekaikena tantunā sarvaiścabhede 'pi bhedasyāpi vidyamānatvānnānyonyābhedaprasaktiriti svayamevohyatāmiti noktam /


*7,631*

nanvevaṃ tarhi saṃyogāderapyekaikāśritatvaṃ na vaktavyam /
ayāvaddravyabhāvitvena bhedābhedābhyāmevoktākṣepasamādhānāditi /
satyam /
tathāpi vastusthitiriyamuktetyadoṣaḥ /
api cājasaṃyoge nāyaṃ samādhiḥ sambhavati /
sa eva nāsti pramāṇābhāvāditi cenna /
paramāṇoḥ ākāśādisaṃyogāṅgīkārāt /
so 'pi paramāṇukarmaja iti cenna /
prāgasayogaprasaṅgāt /
aṃśabhedānneti cenna /
svābhāvikasyānabhyupagamāt /
aupādhikasya ca nirākariṣyamāṇatvāt /

kiñcākāśamīśvareṇa saṃyujyate dravyatvādghaṭavat /
naca mūrtatvamupādhirviśeṣaṇavaiyarthyāt /
paricchinnaparimāṇavattvenaivālam /
paricchinnatvaviśeṣaṇaṃ tu vyarthameva /
ākāśamīśvareṇa na saṃyujyate amūrtatvādrūpavaditi cenna /
adravyatvasyopādhitvāditi /


*8,1*


idānīṃ sāmānyasyaikaikāśritatvamāha- nastvādikamiti //

naratvādikamapyevaṃ ... // MAnuv_2,2.116a //

NYĀYASUDHĀ:
evaṃ saṃyogādivadekaikavṛttītyarthaḥ /
sāmānyamapīti vaktavye brāhmaṇatvāderayāvaddravyabhāvitvenāpi tatra parihāraḥ sambhavatīti jñāpayituṃ naratvādikamityuktam /
upapādanaṃ ca naikaprakāramiti yogavibhāgaḥ /
kuto naratvādikaṃ prativyaktibhinnamityata āha- tattaditi //

... tattaddharmatayeyate // MAnuv_2,2.116b //

NYĀYASUDHĀ:
yathāhi nareṣūpalabhyamāneṣu tadīyaṃ rūpādikaṃ pratiniyatamupalabhyate /
tathā naratvādikamapi tattanniyatadharmatayaiveyate dṛśyate iti pratyakṣamuktam /
yadvā yo 'nekāśrito dharmo nāsāvekaikapratītau pratīyate, yathā dvitvādi /
pratīyate ca naratvādikamekaikapratītāvato nānugatamityanumānamanena sūcayati /


*8,4*

kiñca naratvādikaṃ nānekānuvṛttaṃ dharmatvādrūpādivat /
asyābhāsoddhāraṃ karoti- neti //

na sarvadharma eko 'sti ... // MAnuv_2,2.116c //

NYĀYASUDHĀ:
sarvadharmaḥ anekavṛttidharmaḥ /
tena dharmatvaṃ na bhagnavyāptikamiti śeṣaḥ /
pakṣadharmatā tu sphuṭaiveti /


nanvanekatvasaṅkhayā tāvadanekāśritā /
ekaikasmindvitvādeḥ /
śaṅkitumapyaśakyatvāt /
nahi dvitvādikamekaikapratītau pratīyate /
naca pratiyoginirūpyam /
dharmitayaivānekeṣāmanubhavāt /
ato dharmatvahetostatrānaikāntyamityata āha- samudāyastviti //

... samudāyastu bhinnagaḥ // MAnuv_2,2.116d //

NYĀYASUDHĀ:
samudāyo 'nekatvaṃ bhinnago 'nekāśritaḥ /
satyamanekatvasaṅkhayānekāśritā /
tathāpi tadanyatvena hetuviśeṣaṇādadoṣa iti bhāvaḥ /
sā cāpekṣābuddhijanyatvādayāvaddravyabhāvinī bhinnābhinneti nāśrayayorabhedāpattiḥ /


*8,6*

prābhākarāstvāhuḥ /
sādṛśyaṃ tāvadekamanekānugataṃ, tatra dharmatvahetovyarbhicāraḥ naca vācyaṃ sāmānyameva sādṛśyamataḥ pakṣe vyabhicāracodaneyamanupapanneti /
jātisaṅkaraprasaṅgāt /
asti hi kayościdaśvarāsabhavaktayoḥ sādṛśyaṃ, tatra yadi sādṛśyamaśvatvātparam tadā sarveṣāmapyaśvānāṃ rāsabhasādṛśyaṃ syāt /
yadi cāparaṃ tadā rāsabhavyaktāvapyaśvatvaṃ syāt /
evaṃ rāsabhatve 'pi vācyam /
na sādṛśyamaśvarāsabhavṛtti brūmaḥ /
kintu tadavayavṛtti /
dravyaguṇāvayavakarmavṛttīni sāmānyādeva hi sādṛśyanāmanyabhyupagacchāmo 'to na jātisaṅkaradoṣa iti cenna /
gaurgavayena sadṛśītyādivyavahārāṇāmamukhyatvaprasaṅgāt /
naca sāmānyaṃ pratiyoginirūpyam /
tannirūpyaṃ ca sādṛśyamiti sphuṭo 'nayorbheda ityata āha- etādṛśaṃ ceti //

etādṛśaṃ ca sādṛśyaṃ padārtheṣu pṛthak pṛthak // MAnuv_2,2.117ab //

NYĀYASUDHĀ:
bhavatu sādṛśyaṃ sāmānyato bhinnaṃ tathāpi tatpadārtheṣu pṛthak pṛthageveti na tena dharmatvahetorvyabhicāraḥ /
etādṛśamiti tatroktahetvatideśaḥ /
nahi sādṛśyasyānekavṛttitve pramāṇasyānena sādṛśyamasyānena śuklāvimāvityādivadupapatteḥ /
anayoḥ sādṛśyamityādeścāsyānena sādṛśyamasyānena sādṛśyamityupapatteḥ /
ekavacanasyā (ca) viprāṇāṃ bhojanamityādivadupapannatvatpratiyogino dharmitvāsambhavācca /
ekāśritatve 'pi pratiyoginirūpyatvenaikaikapratītāvapi apratītisambhavācceti /


*8,10*

naratvādisāmānyasya prativyaktibhinnatve 'numānāntaramāha- ekasminniti //

ekasmin sa vinaṣṭe 'pi yato 'nyatraiva dṛśyate // MAnuv_2,2.117cd //

NYĀYASUDHĀ:
ekasminnare naṣṭe tadāśritaṃ naratvaṃ tāvannaṣṭam /
tathāpi sa naratvalakṣaṇo dharmo 'nyatra narāntare dṛśyata eva yato 'to 'pi naratvādikamityuktena sambandhaḥ /
yadvā vinaṣṭaṃ vināśaḥ saha vinaṣṭena vartata iti savinaṣṭaṃ tasminvināśavatīti yāvat /
athavā'śrayeṇa saha vinaṣṭaṃ savinaṣṭaṃ tasminniti yojanā /
ayamatra prayogaḥ /
naṣṭānaṣṭavarti naratvaṃ bhedavat viruddhadharmāśrayatvācchāyā'tapavat /
nacāsiddho hetuḥ /
naṣṭāśrayasya naratvasya naṣṭatvāt /
anyasya tu dṛśyamānatvena avinaṣṭatvāt /
yadvedaṃ naratvaṃ vinaṣṭānnaratvādbhidyate 'vinaṣṭatvādghaṭavat /
yadi vā tannaratvamavinaṣṭānnaratvādbhidyate vinaṣṭatvādghaṭavaditi /


*8,12*

bhavedetadyadi vinaṣṭanarāśritamapi naratvaṃ vinaśyet /
nacaitadasti tasya nityatvādityata āha- kuta iti //

kuto bhasmatvamāptasya naratvaṃ punariṣyate // MAnuv_2,2.118ab //


NYĀYASUDHĀ:
naṣṭanarāśritasyāpi naratvasya punaḥ sattvaṃ na niṣpramāṇakaṃ pratyakṣasiddhatvāt /
naṣṭānaṣṭanarāśritaṃ naratvaṃ tāvadekam /
taccāvinaṣṭe nare punarupalabhyate /
ata evānumānamapi bādhitaviṣayamityata āha- ekatva iti //


*8,13*

ekatve nāsti mānaṃ ca ... // MAnuv_2,2.118c //

NYĀYASUDHĀ:
syātedadyadyetayorekatve mānaṃ syāt /
naca tadastītyarthaḥ /
naca pratyabhijñānaṃ pramāṇam /
tasya svarūpataḥ pramāṇatvena sandigdhatvāt /
caśabdenānyonyāśrayatvaṃ samuccinoti /
ekatve hi punaḥ (tasya) sattvasiddhistatsiddhau caikatvasiddhiriti /


*8,13f.*

evaṃ sāmānyādīnāṃ pratyāśrayaṃ bhede pratyakṣānumānānyuktavā śrutimapyāha- śrutirapīti //

... śrutirapyāha sādaram // MAnuv_2,2.118d //
bhinnāśca bhinnadharmāśca padārthā akhilā api /
svaiḥ svairdharmairabhinnāśca svarūpairapi sarvaśaḥ // MAnuv_2,2.119 //
anivṛttavināśāstu dharmā ubhayarūpakāḥ /
na kenacidabhinno 'to bhagavān svaguṇairvinā // MAnuv_2,2.120 //
iti ... // MAnuv_2,2.121a //


NYĀYASUDHĀ:
āha sāmānyādīnāṃ pratyāśrayaṃ bhedamiti śeṣaḥ /
bhinnāḥ parasparato bhedavantaḥ /
anyonyaṃ bhinnā dharmā yeṣāṃ te bhinnadharmāḥ /
bhinnadharmā ityanenāśrayato 'pi bhedo 'bhihita iti śaṅkānirāsārthamuktam- svairiti //
svarūpairapi yathā bhagavānmatsyādibhiḥ /
svaiḥ svairdharmairabhinnāścetyasyāpavādo 'nivṛtteti /
anivṛtte 'pyāśraye vināśo yeṣāṃ te tathoktāḥ /
yathā'maghaṭaśyāmatādayaḥ /
ubhayarūpakā bhinnābhinnāḥ /
na kenaciditi śrutiḥ svaprakṛtamupasaṃharati /
atra sarvaśa ityādivacanāduktavivaraṇāccādaraḥ pratīyate /


*8,15*

nanu ghaṭāderāmadravyasyāgninā sambaddhasya, agnyabhighātānnodanādvā tadārambhakeṣu paramāṇuṣu, karmāṇyutpadyante /
tebhyo vibhāgāḥ, vibhāgebhyassaṃyogavināśāḥ /
saṃyogavināśebhyaḥ kāryadravyaṃ vinaśyati /
tasminvicaṣṭe paramāṇuṣvagnisaṃyogādauṣṇyāpekṣācchyāmādīnāṃ vināśaḥ /
punaranyasmādagnisaṃyogādauṣṇyāpekṣātpākajā jāyante /

tadanantaraṃ bhogināmadṛṣṭāpekṣādātmāṇusaṃyogādutpannapākajeṣvaṇuṣu karmotpattau teṣāṃ parasparasaṃyogāddvayaṇukādikrameṇa kāryadravyamutpadyate /
tatra ca kāraṇaguṇaprakrameṇa rūpādyutpattirbhavati /
tatkathamāmaghaṭaśyāmatvādīnāmayāvaddravyabhāvitvamucyate /
maivam /
atra pramāṇābhāvāt /


*8,19*

nodanādyutpattau karmotpattiḥ pramāṇam, karmasu vibhāgāḥ, teṣu pūrvasaṃyoganivṛttiḥ, tatra kāryadravyavināśaḥ, tatra ca pūrvarūpādiparāvṛttiḥ, tathā rūpādyantarotpattiḥ sthūladravyotpattau pramāṇam, sā tadavayavaparamparāyām, sā dvayaṇuke, tadutpattiḥ paramāṇusaṃyoge, sa ca tatkriyāyam, sā tadavayavaparamparāyām, sā tadavayavaparamparāyām, sā dvayaṇuke, tadutpattiḥ paramāṇusaṃyoge, sa ca tatkriyāyām, sādṛṣṭavadātmasaṃyoga iti cenna /
paramāṇuṣviva kāryadravyeṣu pūrvarūpādinivṛtterapūrvarūpādyutpatterupapatteḥ /
pārthivāvayavirūpādayaḥ svāśrayavināśādeva vinaśyanti avayavirūpāditvāt dagdhapaṭarūpādivat /
kāraṇaguṇebhya evotpadyante tata eva tadvadeveti cenna /
kvacitsatyāśraye 'pi rūpā(dīnāṃ vi)divināśe 'gnisaṃyogajatve ca virodhābhāvāt /
anyathā kāryadravyaṃ saṃyogavināśādeva vinaśyati kāryadravyatvāt dvayaṇukavadityādikamapi syāt /


*8,21f.*

nanvagnisaṃyogaḥ sarvāvayaveṣvasti na vā /
nacettatra rūpādivināśotpādāsambhavaḥ /
tathā cāvayavāvayavinorvilakṣaṇarūpādimattvaṃ syāt /
ādye 'gnyavayavānāṃ sarvatra praveśena avayavināśasyāvarjanīyatvamiti cet /
avayavidravyāṇāṃ sacchidratvena praveśopapatteḥ /
saṃsthānāpagamābhāvenāvayavivināśāyogāt /
tathāvidhasyaivodāhṛtatvādityalam /


*8,25*

evaṃ sāmānyasyānekavṛttitvaṃ pramāṇairapākṛtam /
tadayuktam /
tasyānekavṛttitvābhāve bādhakasadbhāvāt /


*8,26*

tathāhi /
sarveṣu gopiṇḍeṣu yadyanugatamekaṃ gotvasāmānyaṃ na syāt tadā tatra gośabdasaṅgatigrahaṇalakṣaṇā vyutpattirna syāt /
vṛddhavyavahāropadeśādinā hi vyutpattirbhavati /
naca pratipiṇḍaṃ vyavahārādikamasti /
teṣāmānantyena vyutpattāveva puruṣāyuṣaparyavasānaprasaṅgāt /
ato yatropadeśādikaṃ tatraiva vyutpattirvyavahāraśceti syāt /
atha vinaivaikena nimittenopadeśādyabhāve 'pi gopiṇḍāntare gośabda(saṅgatiṃ)saṅketaṃ gṛhṇīyāt /
tadāśvapiṇḍe 'pi kinna gṛhṇīyāt /
aviśeṣāt /
anugatagotve tu gośabdavṛttinimittatayopadeśādināvagate nāyaṃ doṣaḥ prāduṣyāt /
tasmādanekeṣvekaśabdasaṅgatigrahaṇānyathānupapattyānugatamekamabhyupagantavyameva /


*8,28*

nanu kathaṃ tarhi sāmānyarahiteṣu pṛthivyādiṣu bhūtamūrtādiśabdasaṅgatigrahaṇam /
ucyate /
tatrāpi bāhyaikendriyagrāhyaguṇāśrayatveyattāvacchinnaparimāṇatvādyupādhinibandhanaiva vyutpattiḥ /
upādhīnāṃ vyāvṛttatve 'pyanugatasāmānyāśrayatvena doṣābhāvāt /


*8,34*

kiñcānugatatantutvapaṭatvādisāmānyābhāve kāryakāraṇabhāvāvadhāraṇaṃ na syāt /
tataśca kāryārthinaḥ kāraṇe pravṛttirna syāt /


*8,35*

kāyarkāraṇabhāve hyanvayavyatirekau vopadeśo vā pramāṇam /
naca vyāvṛtteṣu vastuṣvanvayavyatirekagrahaṇamupapadyate /
niyamavyabhicārayodurjñānatvāt /


*8,36*

upadeśaścānanteṣu na sambhavatyevetyuktam /


*8,37*

api ca vyāptijñānamapyanugatasāmānyābhāve 'nupapannaṃ syāt /
vyāvṛttavastūnāmanvayavyatirekāvagamānupapatteḥ /


*8,37f.*

sāmānyāpavādanyāyaścānugatasāmānyābhāve na bhavet /
dvayoḥ pramāṇayorekasvarūpaviṣayatve (hya)tvanyatarasyāprāmāṇyameva syāt /
bhinnaviṣayatve nāpavādaviṣayo 'sti /
asti ca tāvadgaurayamityanugatākārapratyayaḥ /
nacāsau vyāvṛtteṣu sambhavati /
bhrāntatvaprasaṅgāt /
nacaitatsavarmanyāpohanibandhanam /
tasyāpi pratipiṇḍaṃ vyāvṛttatvāt /
anugatatve vā kimaparāddhaṃ sāmānyena /
tathāca vidhirūpaḥ pratyayo 'pi samāhitaḥ syāt /

*8,40*

evaṃcāṅgīkārye gotvāderanugame nityatvamapyanivāryamityata āha- vyutpattirapīti //

... vyutpattirapi hi sādṛśyenaiva gamyate // MAnuv_2,2.121ab //

NYĀYASUDHĀ:
apipadaṃ kāryakāraṇabhāvāvadhāraṇādisamuccayārtham /
hiśabdo yasmādityarthe /
gamyate abhyupagamyate 'vagamyata iti /
asti tāvatsādṛśyaṃ nāma padārthāntaram /
gosadṛśo gavaya ityādyadhyakṣasiddhatvāt /
tenaiva copapadyate

vyutpattyādikam /
tasmānna tadarthaṃ gotvāderanugatatvaṃ kalpanīyam /


*8,41*

sādṛśyena tāvat śabdavyutpattiprakāraṃ darśayitumupakramate- sarveṣviti //

sarveṣu yugapacchabdaḥ sadṛśeṣu pravartate // MAnuv_2,2.121cd //


*8,41f.*

NYĀYASUDHĀ:
bahavo hi śabdasaṅgatigrahaṇopāyāḥ /
tatra yadopadeśato vyutpadyate tadāyaṃ gaurityupadeśavākyaṃ vyāptigrāhakatayopayujyate /
katham /
sādṛśyopadhānena sarveṣu gopiṇḍeṣu yugapadekakālamayamityādiśabdaḥ pravartate /
ayaṃ gaurityasyāyametatsadṛśāḥ sarve 'pi gośabdavācya ityartho vaktrā abhipreyate /
śrotrā cāvadhāryata iti yāvat /
dvayorapi sārvatrikavyutpattikāmatvena vākyasyaikapiṇḍaviṣaya(ka)tvakalpanānupapatteriti bhāvaḥ /


*8,43*

yadyayaṃ gaurityādivākyaṃ naikapiṇḍamātraviṣayam /
kintvayaṃ caitatsadṛśāśca sarve gośabdavācyā iti vyāptiparaṃ tadā saṅgatigrahaṇottarakālaṃ gāmānayetyukte gośabdātsarvagopratipattiḥ syāt /
abhīṣyagopratipattistu jāyate sā kathamiti taṭasthasya codyaṃ pariharati- tathāpīti //

tathāpi prāptitastvekavacanācca viśeṣataḥ /
abhīṣyāvagatiśca syāc ... // MAnuv_2,2.122a-c //


NYĀYASUDHĀ:
yadyapyupadeśo naikapiṇḍaviśeṣagocarastathāpi gāmānayetyukte 'bhīṣyagopiṇḍāvagatiḥ syādeva /
katham /
prāptito yogyatvāt /
atītānāgatānāmatyantaviprakṛṣṭadeśasthānāṃ gavāmānayanayogyatābhāvamālocya tatparityāga ityarthaḥ /
tarhi sannihitasarvagopratipattiḥ kuto na bhavati iti cenna /
gāmityekavacanāt /
tathāpi yasya kasyacidekasya gopiṇḍasya pratipattiḥ syāt /
nābhīṣyasyaiveti cenna /
śabalaṃ bahulāṃ kālākṣīmityādiviśeṣaṇāt /
etaduktaṃ bhavati /
gośabdādbhavatyeva sarvagopratipattiḥ /
kintu liṅgaprakaraṇādibalātpiṇḍaviśeṣe kāryapratipattiriti /


*8,45*

astvayaṃ gaurityādivākyaṃ vyāptiparam /
tataḥ kimityata āha- śaktiriti //

... chaktiḥ sādṛśyagā yataḥ // MAnuv_2,2.122d //
tādṛśo 'yaṃ ca tacchabda iti jñāpayati sphuṭam // MAnuv_2,2.123ab //


NYĀYASUDHĀ:
yato vācakatvaśaktiḥ śabdasya sādṛśyagā sādṛśyasambandhinī sādṛśya(sya) vyāpiketi yāvat /
asmādvākyādavadhāriteti śeṣaḥ /
atastāṃ śaktiṃ tattadviṣayatayā sādṛśyaṃ sphuṭaṃ jñāpayati /
kathamityataḥ prayogaprakāraṃ darśayati- tādṛśa iti //

co yasmādityarthe /
ayaṃ paridṛśyamāno yasmāttādṛśa upadeśakāle sannihitena piṇḍena sadṛśastasmāt /
tacchabdaḥ sa śabdo yasya vācako 'sau tathoktaḥ /
itiśabdaḥ prakāravācī /


ayamatra samudāyārthaḥ /
vyutpattyarthaṃ tāvannānugataṃ kimapyaṅgīkaraṇīyam /
sādṛśyenaiva tadupapatteḥ /
naca vācyaṃ sādṛśyamapyanugataṃ cetkiṃ sāmānyenāparāddham /
vyāvṛttatve kathaṃ sārvatrikavyutpattyaṅgamiti /
nahi sādṛśyaṃ śabdaśaktiviṣayatayā pravṛttinimittatayā vā abhyupagamyate /
kinnāma liṅgatayā /
yathā hi gandhavattvaṃ na pṛthivīśabdavācyam, nāpi tatpravṛttinimittam, kintu pṛthivītvavatyā vyakteḥ pṛthivīśabdavācyatve liṅgameva /
tathā tete vyāvṛttāmapi tadavabodhe liṅgatayopayujyate /
tathā hi /
yadāyaṃ gaurityupadeśapūrvikā vyutpattistadā tadvākyaṃ vyāptigrāhakam /
ayaṃ caitanyasadṛśāśca sarve gośabdavācyā ityevamparatvāt /
vyavahārādipūrvikāyāṃ tu vyutpattau bhūyovyavahārādidaśarne sādṛśyavyāpyatāvagamo bhavati /
tataścaitadvākyādināvagatavyāptirityanumīyate"ayaṃ gośabdavācyo bhavitumarhati tatsadṛśatvāt yastatsadṛśassa gośabdavācyastathā cāyaṃ tatsadṛśastasmādgośabdavācyaḥ'; iti /


*8,49*

nanvatra ko dṛṣṭāntaḥ /
upadeśakāle sannihito gopiṇḍa iti cenna /
tasya tatsadṛśatvābhāvāt /
maivam /
dṛṣṭāntaniyamasya nirastatvāt /
naca sāsnādimattvameva liṅgamastu kiṃ sādṛśyeneti vācyam /
tasya gotvavatprativyaktivyāvṛttatvāt /
sādṛśyasya tu vyāvṛttatve 'pi pratiyoginirūpyatvenānugataphalasādhakatvānubhavāt /
sāsnādimattvasyāpi sādṛśyopahitasya liṅgatvamabhyupagacchāmaḥ /
naca vācyaṃ gosādṛśyamaśve 'pyastīti tatrāpi gośabdavācyatānumānaprasaṅga iti /
jātinimittatve 'pyevaṃ prasaṅgasya samānatvāt /
jātiviśeṣo nimittatayāṅgīkriyate yo 'vyabhicārīti cet /
tarhi sādṛśyaviśeṣa eva liṅgaṃ yo lakṣaṇabhūta iti vadāmaḥ /


*8,52*

etena kāryakāraṇabhāvāvadhāraṇādikamapi samāhitaṃ veditavyam /
sādṛśyenaiva tadupapatteḥ /
antyaviśeṣe hi na kiñcidanugatamasti, nāpyanugatāśraya upādhiḥ /
tadbhāve dravyaguṇakarmavadatyantavyāvartakatvasvarūpahāniprasaṅgāt /
tathāpyasti tatra viśeṣaśabdavyutpattiḥ atyantavyāvṛ(tti)ttabuddhiṃ prati kāraṇatvāvadhāraṇamityādi /
tatra pareṇāpi lakṣaṇarūpaṃ sādṛśyamevādaraṇīyamiti /


*8,54*

evamanugatasāmānyānabhyupagamenaiva vyutpattyādikaṃ samarthitam /
yastu manyate anugatasāmanyenaiva vyutpattyādikaṃ nānyatheti tasya bādhakamāha- jātitaścediti //

jātitaścet kathaṃ tāsu ... // MAnuv_2,2.123c //

NYĀYASUDHĀ:
yadyanugatajātinimittaiva sarvatra vyutpattiḥ kāryakāraṇabhāvāvadhāraṇādikaṃ ca syāt /
tadā tāsu jātiṣu kathaṃ jātyādiśabdavyutpattiranugatabuddhikāraṇatvāvadhāraṇaṃ, gotvaṃ nityaṃ jātitvādityādivyāptijñānamityādikaṃ syāt /
jātiṣu jātyabhāvena tatra vyutpattyādikaṃ na syādityarthaḥ /


*8,54*

yadi vaiyātyātkaścidbrūyāt"asti jātiṣvapi jātitvaṃ nāma jātistadvaśāttatra savarmupapadyate'; iti, taṃ pratyāha- tatra cediti //


*8,55*

... tatra cedanavasthitiḥ // MAnuv_2,2.123d //

NYĀYASUDHĀ:
yadi tatra jātiṣvapi jātitvaṃ nāma jātiraṅgīkriyate tadānavasthitiḥ syāt /
tathāhi gotvādijātiṣu jātiśabdapravṛttinimittaṃ yā jātitvaṃ nāma jātiḥ sā na tāvatsvarūpe vartate /
svavṛtteraprāmāṇikatvāt /
ataḥ svavyatiriktāsveva jātiṣu vartata iti vācyam /
tathāca svavyatiriktajātiṣu jātiśabdapravṛttāviyaṃ nimittaṃ syānna tu svarūpe 'pi /
atastasyāṃ tadvayatiriktāsu jātiṣvekasya jātiśabdasya pravṛttau nimittaṃ jātyantaramaṅgīkaraṇīyam /
tatrāpyevamevetyanavastheti /


nanu gotvādijātiṣu jātitvaprayukto jātiśabdaḥ /
jātitve tūpadeśādhīno bhavatu /
tasyā ekatvāditi /
maivam /
na hyasmābhiḥ sādṛśyamiva bhavatā jātiḥ (jāti)śabdapravṛttau jñāpakatayopeyate /
yena kvacidupadeśo niveśyate /
kintu nimittatayā /
tatropadeśopanyāsasya kvopayogaḥ /


*8,56*

sthānāntare 'pi bādhakamāha- tathaiveti //

tathaiva vyaktivijñānaṃ vyaktitvābhāvadūṣitam // MAnuv_2,2.124ab //

NYĀYASUDHĀ:
yathā jātivijñānaṃ jātitvābhāvena dūṣitaṃ tathaiva vyaktivijñānaṃ vyaktīnāṃ vyaktiśabdavācyatvavijñānaṃ tannimittavyaktitvajātyabhāvena dūṣitam /
dravyaguṇakarmāṇi khalu vyaktaya ucyante /
naca tatra vyaktitvaṃ nāma sāmānyamasti /
sattayā parāparabhāvābhāvāt /
tasmāttatra vyaktiśabdavācyatvajñānaṃ na syāt /
mā bhūdvayatiriktaṃ vyaktitvaṃ sattaiva vyaktiśabdapravṛttau nimittaṃ bhaviṣyatīti cenna /
sāmānyasya paryāyapravṛttau nimittatvāt /
sadvayaktiśabdayoraparyāyatvāt /
anyathā saṃyogyādiśabdānāmapi dravyādiśabdaparyāyatvaṃ syāt /


*8,58*

nanu śabdamātrasya jātinimittatvātsattayā parāparabhāvaśūnyamapi dravyaguṇakarmasu vyaktitvamastyevetyato noktadoṣa ityata āha- yadīti //

yadi taccāsti tasyāpi viśeṣeṣvanavasthitiḥ // MAnuv_2,2.124cd //


*8,58f.*

NYĀYASUDHĀ:
tarhi tasya vyaktitvasyāpi viśeṣeṣu vyaktiṣu praveśaḥ syāt /
tathā cānavasthitiriti yojanā /
tathā hi /
yaḥ śabdo 'nekavācakaḥ sa sarvo jātinimittaka iti svīkṛtya dravyaguṇakarmasu vyaktitvaṃ nāma jātiryadyaṅgīkriyate /
tarhi tasyāmanyāsu ca jātiṣu jātiśabdapravṛttaye jātitvaṃ jātiraṅgīkartavyā syāt /
omiti cet /
tarhi sā vyaktitvajātirapi jātitvajātiṃ prati vyaktiḥ syāt /
naca sā svarūpe vartate tato dravyāditraye tasyāṃ ca vyaktiśabdapravṛttyarthamaparaṃ vyaktitvamaṅgīkaraṇīyam /
tatra punarjātiśabdapravṛttaye jātitvamabhyupagantavyamiti sāpi tadāśrayatayā vyaktiḥ syāt /
tasyāṃ punarvyaktitvāntaramityevamanavastheti /


*8,60*

sthalāntare bādhakamāha- kathamiti //

kathaṃ svarūpatvamapi jñāyate 'nugataṃ yadi /
ekavyutpattiparyantamanavasthādidūṣitam // MAnuv_2,2.125a-d //


NYĀYASUDHĀ:
atra svarūpamityadhyāhartavyam /
tataścāyamarthaḥ /
yadyanugatasāmānyanibandhanaiva sarvatra vyutpattistadā sakalapadārthasvarūpaṃ svarūpaśabdavācyatayā kathaṃ jñāyate /
anugatasya svarūpatvasāmānyasyābhāvāt /
svarūpeṣu svarūpaśabdavyutpattirna syāditi /

nanu ca sarvasvarūpeṣvanugataṃ svarūpatvamaṅgīkriyate mayāto noktadoṣa ityata uktam"svarūpatvamapi yadyanugatamaṅgīkriyate tadā anavasthādidūṣitaṃ bhavati'; iti /
tathāhi /
sarveṣu svarūpeṣu yatsvarūpaśabdapravṛttinimittaṃ svarūpatvaṃ nāma sāmānyamabhyupagamyate, tadapi tāvatsvarūpeṇa /
naca tatra svayameva vartate /
ātmāśrayatvasyālaukikatvāt /
atastasminnanyeṣu ca svarūpeṣu svarūpaśabdapravṛttaye 'nyatsvarūpatvaṃ nāma sāmānyamaṅgīkāryam /
tadapi svarūpamevetyanavasthā /
ādipadenāntyaviśeṣasvarūpeṣu svarūpatvasāmānyamaṅgīkāryam /
tadapi svarūpamevetyanavasthā /
ādipadenāntyaviśeṣasvarūpeṣu svarūpatvasāmānyāṅgīkāre 'tyantavyāvṛttidhīhetutvaṃ na syāt /
samavāyābhāvasvarūpe ca sambandhābhāva iti jñātavyam /

anavasthādyaniṣyaprasaṅgasya viparyaye paryavasānaṃ sūcayati- ekavyutpattiparyantamiti //
ekaṃ kevalanugatasāmānyahīnamiti yāvat /
tasminvyutpattirekavyutpattistatparyantaṃ tāvadidaṃ dūṣaṇamupaplavata eva /
yāvadanugatasāmānyanibandhanaiva sarvatra vyutpattiriti pakṣaṃ parityajya sāmānyahīne 'pi vyutpattimaṅgīkuryādityarthaḥ /
anavasthādiparihārāyānugatasāmānyena vināpi vyutpattiraṅgīkaraṇīyeti bhāvaḥ /


*8,61f.*

nanvidaṃ sakalamapyasaṅgatam /
tathāhi /
yaduktaṃ"jātitaścetyuktaṃ tāsu'; iti, tattāvadasat /
jātiṣu jātyantarābhāve 'pi nityatve satyanekānugatatvenopādhinā jātiśabdavyutpattyupapatteḥ /
astu vā jātiṣu jātitvaṃ nāma jātiḥ /
na cānavasthā /
jātitve jātiśabdasya svarūpanibandhanatvopapatteḥ /
"tathaiva vyaktivijñānam'; ityetadapyasat /
vyaktitvābhāve 'pi jātivyañjakatvopādhinā dravyādiṣu vyaktiśabdapravṛttyupapatteḥ /
vyaktitvajātyaṅgīkāre 'pi nānavasthā /
vyaktitve vyaktiśabdasya svarūpanimittatvasambhavāt /
yadapi"katham'; ityādi tadayuktam /
pramāṇagamyatvopādhinaiva svarūpaśabdavyutpattyupapatteḥ /
svarūpatvābhyupagame 'pi nānavasthā /
tatra svarūpaśabdasya svarūpamātranibandhanatvāt /
antyaviśeṣeṣūpādhinibandhana eveti na rūpahāniḥ /
samavāyādau svarūpameva sambandha ityato na kaściddoṣa ityāśaṅkāṃ pariharannanugatasamānyadūṣaṇamupasaṃharati- kalpaneti //

kalpanāgauravāt tena yuktā nānugakalpanā // MAnuv_2,2.125ef //

NYĀYASUDHĀ:
sarvatra vyāvṛttameva vācyaṃ śabdapravṛttau nimittaṃ ca /
vyutpattistu sādṛśyanibandhanetyekarūpakalpanena sarvasāmañjasye kvacidanugataṃ sāmānyaṃ nimittaṃ kvacidupādhiḥ kvacitsvarūpamevetyanekakalpane kalpanāgauravaṃ syādityarthaḥ /
tena bādhakasadbhāvena sādhakābhāvena ca /

nanvanugatatvābhāve kathaṃ gotvādikaṃ sāmānyam /
ananugatatve 'pi guṇakarmavadavāntarabhedasya kalpanīyatvāditi /


*8,64*

evaṃ samavāyaṃ svarūpato nirākṛtyedānīṃ yatsamavāyasya sarvatraikatvaṃ nityatvaṃ ca"tattvaṃ bhāvena'; iti sūtreṇoktam, tattvaṃ, samavāyasya sarvatraikatvaṃ nityatvaṃ ca, bhāvena, sattayā vyākhyātamiti /
tadapi nirāgikīṣurādau tāvadekatvaṃ nirākartuṃ pīṭhamāracayati- aupādhiketi //

aupādhikaviśiṣṭādyamapi tadvastu kiṃ tataḥ /
anyat ... // MAnuv_2,2.126a-c //



*8,65*

NYĀYASUDHĀ:
aupādhikaḥ pācakayājakādiḥ viśiṣṭo nīlāgnimadādiḥ /
ādyagrahaṇādupalakṣitagrahaṇam /
apiśabdo dūṣaṇāntarasamuccayārthaḥ /
tadvastūpādhyāditrayam /
kiṃśabdasyobhayataḥ sambandhaḥ /
tata upādhyāditrayāt /
vastvityetadaupādhikaviśiṣṭādyamityanenāpi sambaddhayate /


*8,65f.*

ayamarthaḥ /
samavāyasya sarvatraikatvaṃ vadatedaṃ tāvadvivicyatām /
eka eva puruṣaḥ pacanayajanādibhirupādhibhiravacchedakairdharmaiḥ pācako yājakaścetyādyabhidhīyate, sa pācakayājakādiraupādhiko 'rthaḥ kiṃ pacanādyupādhipuruṣatatsambandhebhyo 'nanya utānya iti /
tathā samānādhikaraṇaṃ vyāvartakaṃ viśeṣaṇam /
yathotpalasya nīlaṃ rūpaṃ parvatasya cāgniḥ /
vyadhikaraṇaṃ tu vyāvartakamupalakṣaṇam /
yathā nīlarūpagataṃ nīlatvamutpalasya /


*8,66*

anye tu kāyarpraveśāpraveśābhyāṃ viśeṣaṇopalakṣaṇayorbhedamācakṣate /
yathā lambakarṇa ānīyatāṃ citragurānīyatāmiti /
apare tu śābdasāmānādhikaraṇyābhyām /
yathā daṇḍī devadatto jaṭābhistāpasa iti /
kecitpunarvyavacchittisamaye sattvāsattvābhyām /
tatra viśiṣṭaṃ nīlamagnimānvā viśeṣaṇaviśeṣyatatsambandhebhyo 'nanyat anyadvā /
upalakṣitaṃ copalakṣaṇopalakṣyatatsambandhebhyo 'nanyat anyadveti /

tatrānyatvapakṣastāvadanubhavābhyupagamopapattiviruddhatvādasambhāvita eva /
nahi pācakādiḥ pacanāditrayātirikto 'nubhūyate /
naca yogyasyānanubhave sattvaṃ siddhayati /
nāpyagnimadādiḥ parvatādyatirikto 'nubhūyate /
atiriktatve caupādhikaviśiṣṭāderdravyādyantarbhāvāsambhavāt /
ṣaṭpadārthātirekaprasaṅgenābhyupagamavirodhaḥ syāt /
yadi caupādhikaviśiṣṭādyamatiriktaṃ syāt tadā pācakamānayetyukte puruṣādyānayanaṃ na kriyetetyādyupapattivirodhaḥ /


*8,70*

nanvavacchittiraupādhikatvaṃ, vyavacchittiśca vaiśiṣyayaṃ tritayādbhinnameveti cenna /
avacchitteranirūpaṇāt /
sā kimupādhisambandho vā puruṣasyaikatvaṃ vā svagato bhedo vā /
ādye na trayātirekaḥ /
dvitīye tvanaupādhikādaviśeṣaḥ /
tṛtīye tvasattvaprasaṅgaḥ /
vyavacchittirvaiśiṣyamiti cāyuktam /
tasyā nīlādipadārthatvābhāvāt /
sā hi vaiśiṣyayapratītiphalaviṣayatayā anubhūyate /


*8,71f.*

viśeṣaṇaviśeṣyasambandhāvagāhyekaṃ vā vijñānamaviralamanekaṃ vā viśiṣṭamiti kaścit /
yathā'ha"viśeṣaṇaṃ

viśeṣyaṃ ca tatsambandhaphalārpakam /
jñānarūpaṃ svasāmarthyādviśiṣṭamiti kīrtitam'; iti /
tanna /
viśiṣṭasya bāhyārthatayānubhavāt /
anyathā sādhyadharmaviśiṣṭaḥ pakṣaḥ /
so 'numānena prajñāpanīya ityādyayuktaṃ syāt /
tasmādatirekapakṣo 'nupapanna eva /


*8,74*

astu tarhyaipādhikaviśiṣṭādyaṃ tritayānanyadityata āha- tadeveti //

... tadeva cedagnimattvaṃ kiṃ tatra bhaṇyate // MAnuv_2,2.126cd //


*8,74f.*

NYĀYASUDHĀ:
pratidattisaukaryāyodāharaṇaniṣṭhatayā matupā praśnaḥ kṛto 'gnimattvamiti /
dhūmādyanumānasādhyaṃ viśiṣṭamityarthaḥ /
aupādhikāderapyupalakṣaṇametat /
ayamarthaḥ /
agnimadādiviśiṣṭaṃ ca yadi viśeṣaṇaviśeṣyatatsambandhebhyo 'nanyadaṅgīkriyate /
tadāpi vaktavyam /
kiṃ tattritayamapi pratyekaṃ viśiṣṭamutā(tatra)nyatamam /
dvitīye 'pi kiṃ viśeṣaṇabhūto 'gnirevāgnimacchabdārthaḥ, uta viśeṣyarūpaḥ parvataḥ, atha sambandhaḥ saṃyogalakṣaṇaḥ /
saṃyogapakṣe 'pi kiṃ nirviśeṣaṇasaṃyogaḥ kiṃvāgninā saṃyogaḥ /
uttaratrāpi kimagnisaṃyogamātram /
uta parvatasyāgnisaṃyoga iti /
evaṃ pācakāderapi pacanāditrayānanyatve vikalpo draṣṭavyaḥ /


*8,76*

antyapakṣātiriktānsarvapakṣānapākaroti- agnīti //

agnisaṃyogamātraṃ ced bhavet tat siddhasādhanam // MAnuv_2,2.127ab //

NYĀYASUDHĀ:
agnisaṃyogamātramiti sarvapakṣopalakṣaṇam /
cet agnimacchabdārtha iti śeṣaḥ /
tat dhūmavattvādyanumānamagniparvatasaṃyogānāṃ samastānāṃ vyastānāmagninā saṃyogasya cāgnimacchabdavācyaviśiṣṭatve dhūmānumānaṃ siddhasādhanaṃ syāt /
viśiṣṭasyānumānasādhyatvāt /
agnyāderviśiṣṭasya mānāntarata eva siddhatvāditi /


*8,77*

astu tarhi parvatasyāgninā saṃyogo viśiṣṭarūpo 'gnimacchabdārtho 'numānasādhya ityantimaḥ pakṣaḥ /
tatroktadoṣābhāvāt /
parvatamagnisaṃyogānāṃ samastānāṃ vyastānāmagnisaṃyogasya ca siddhatve 'pi parvatasyāgninā yaḥ saṃyogastasyānumānataḥ prāgasiddheriti śaṅkate- bhūdharasyeti //

bhūdharasyāgnisaṃyogo yadi ṣaṣṭhayartha eva kaḥ // MAnuv_2,2.127cd //

NYĀYASUDHĀ:
agnimacchabdārtho viśiṣṭo 'numānasādhya iti śeṣaḥ /
dūṣayituṃ pṛcchati- ṣaṣṭhayartha iti //
parvatasyāgnisaṃyogasya ca siddhatve 'pi pavartasya yo 'gnisaṃyogaḥ sa na siddha ityataḥ sa eva viśiṣṭo 'gnimacchabdārtho 'numānavedya iti vadatā parvatasyeti ṣaṣṭhayā nirdiṣyaḥ sambandha eva viśiṣṭo 'gnimacchabdārtho 'numānavedya ityuktaṃ bhavati /
anyasya sarvasya siddhatvāt /
ṣaṣṭhayarthāśca sambandhā vaiyākaraṇairaneke gaṇitāḥ /
ataḥ ko 'tra sambandho vivakṣita iti praśnārthaḥ /
evaśabdaḥ tasyaiva prādhānyadyotanārthaḥ /


*8,78*

uttaraṃ śaṅkate samavāya iti /

samavāyo yadi hy ... // MAnuv_2,2.128a //

NYĀYASUDHĀ:
saṃyogo hi guṇaḥ parvataśca guṇī guṇaguṇinośca samavāyaḥ sambandha iti prasiddhamiti hiśabdārthaḥ /
ṣaṣṭhayartha iti vartate /

nirākaroti- asya ceti //

... asya caikatvāt siddhasādhanam // MAnuv_2,2.128ab //

NYĀYASUDHĀ:
parvatāderivāsya samavāyasya ca siddhatvāditi śeṣaḥ /
siddhasādhanaṃ dhūmādyanumānamiti śeṣaḥ /
kathaṃ samavāyasya siddhatvamityata uktam- ekatvāditi //
yastantupaṭayoḥ samavāyaḥ sa eva hi parvatāgnisaṃyogayoḥ samavāyaḥ pareṇāṅgīkṛtaḥ /
tantupaṭayoḥ samavāyaśca pratyakṣeṇa vānumānena vā siddha eveti /

ayamatra samudāyārthaḥ /
yadyeka eva sarvatra samavāyaḥ syāttadā sarvānumānānāṃ siddhasādhanatā syāt /
yadyapi yāthārthyameva prāmāṇyaṃ tathāpi śabdavatparārthānumānasya parāpekṣayā pravṛttatvātsiddhasādhanatā doṣa eva /


*8,78f.*

tathā hi /
sarvamapyanumānaṃ na vastusvarūpamātraparam /
tasyāsiddhāvāśrayāsiddheḥ /
siddhau ca siddhasādhanatvāt /
kintu kenacidupahitaṃ vā viśiṣṭaṃ vopalakṣitaṃ veti vaktavyam /
tacca viśiṣṭādikaṃ na viśeṣaṇāditrayādanyadeveti yuktam /
anupalambhādibādhāt /
trayānanyatve 'pi na viśeṣaṇamātram /
tasya anumānātprāk siddhatvāt /
asiddhau cāprasiddhaviśeṣaṇatvāpatteḥ /
agnerevāgnimacchabdārthatve matupo vaiyarthyāpatteśca /
nāpi dharmisvarūpamātram /
uktadoṣāt /
parvato 'gnimānityetayerekārthatvāpatteśca /
naca sambandhamātram /
saṃyogo hi kvacitsambandhaḥ syāt yathāgniparvatayoḥ /
kvacitsamavāyaḥ yathā rāsadrūpānumāne /
dvāvapi svarūpataḥ siddhāviti siddhasādhanameva /
saṃyogamātrasya siddhatve 'pyagnyādisaṃyogaḥ sādhya ityapi na vācyam /
tasyāpi mahānasādau siddhatvāt /
atha parvatāderagnyādisaṃyogaḥ sādhyaḥ /
atrāpi vivektavyam /
kasyātrāsiddhayā sādhyatvamiti /
anyasyāsambhavāt /
ṣaṣṭhayarthasya samavāyasyeti vaktavyam /
sa ca sarvatraika eva cetpunaḥ siddhasādhanataiva syāt /
ataḥ sarvānumānocchedaprasaṅgātsarvatra samavāyaikyamayuktamiti /


*8,80*

nanu tantuṣu paṭādisamavāyaḥ parvatāgnisaṃyogādisamavāyaśca yadyapi svarūpeṇaika eva, tathāpi tantupaṭādiparvatāgnisaṃyogādyupādhinimittaḥ samavāyasya bhedo 'pyasti /
tataḥ siddhatve 'pi sādhyatvamupapadyata ityata āha- yadīti //

yadyasyaupādhiko bhedaḥ kuta ekatvamiṣyate // MAnuv_2,2.128cd //

NYĀYASUDHĀ:
yadi asya samavāyasya sādhyatvasiddhayarthamaupādhiko bheda iṣyate tadaikatvaṃ kuta iṣyate /
samavāyasyaikatvaṃ hi na saṅkhayāviśeṣaḥ /
nirguṇatvāt /
kintvabhedaḥ /
naca bhedābhedau kvāpi pareṇāṅgīkṛtau /
tasmātsamavāye bhedasyāṅgīkṛtau tadviruddho 'bhedo nāṅgīkartumucita iti /

nanu svābhāvikamekatvaṃ svābhāvikenaiva bhedena viruddhayate na punaraupādhikena /
svabhāvataḥ abhinne 'pi gaganādāvaupādhikabhedadarśanāt /
samavāye caupādhika eva bhedo 'bhyupagataḥ /
tatkathaṃ svābhāvikaikatvāṅgīkāro 'nucita ityata āha- neti //


*8,80f.*

nānirvācyaṃ hi teneṣyamata aupādhikānyayoḥ /
satyatvāt ko viśeṣaḥ syān ... // MAnuv_2,2.129a-c //



*8,81*

NYĀYASUDHĀ:
viruddhābhimatayoravirodho hi kālabhedena bhavati /
yathā tatraiva bhūtale tasyaiva ghaṭasya bhāvābhāvayoḥ /
deśabhedena vā /
yathā tadaiva tasyaiva ghaṭasyāstitvanāstitvayoḥ /
vyaktibhedena vā /
yathā tatraiva bhūtale yadaikasya ghaṭasya bhāvastadaiva ghaṭāntarasyābhāvaḥ /
pāramārthikatvāpāramārthikatvābhyāṃ vā /
yathā gagane rūpatadabhāvayoḥ /
tatra tāvatsamavāye 'bhedabhedayornādyaṃ vidhātrayaṃ sambhavatīti parasyāpi sampratipannam /
nāpi caturthī vidhā sambhavati /
samavāyabhedasyāpāramārthikatvamasattvamanirvācyatvaṃ vā /
ādye siddhasādhanatvaṃ tadavasthameva /
dvitīye tvidamupatiṣṭhate /
hi yasmāttena vaiśeṣikādinānirvācyaṃ vastu neṣyamato 'sattvānirvācyatvābhāvādaupādhikasya svābhāvikasya ca satyatvātko viśeṣaḥ syāt /
aupādhikasyāpi svābhāvikavatsatyatvātpāramārthikatvāpāramārthikatvalakṣaṇasya virodhaśāntihetoḥ abhāvavādaupādhikatvādyuktayā na kiñcitkṛtaṃ syāditi bhāvaḥ /


*8,82*

iṣyate samavāyabhedasyānirvācyatvaṃ mayā cettadā ko doṣa iti cedapasiddhānta ityāha- māyeti //

... māyāvādyanyathā bhavet // MAnuv_2,2.129d //

NYĀYASUDHĀ:
anirvācyavastvaṅgīkāre vaiśeṣikādirapi māyāvādī bhavedityarthaḥ /

nanu prakārabhedenāpi virodhaśaśantirbhava(viṣya)ti /
yathā tatraiva tadaiva nīlapaṭasadbhāve 'pi pītapaṭābhāvaḥ /
tathā samavāye 'pyaupādhiko bhedo na svābhāvikamabhedaṃ viruṇaddhītyata āha- upādhīti //

upādhijanyaṃ tadgamyamiti vaupādhikaṃ bhavet // MAnuv_2,2.130ab //

NYĀYASUDHĀ:
upādhiśabdāttṛtīyāsamarthājjanyagamyayoḥ śeṣike ṭhaki kṛte sati aupādhikamiti bhavati /
tataḥ kimityata āha-ubhayatreti //


ubhayatrāpyanantāḥ syuḥ samavāyā itastataḥ // MAnuv_2,2.130cd //

NYĀYASUDHĀ:
evaṃ sati samavāyabhedasyaupādhikatvaṃ nāmopādhijanyatvaṃ vopādhigamyatvaṃ vā vaktavyam /
tathāca pakṣadvaye 'pyanantāḥ samavāyāḥ syuḥ /
tatkathamityata āha- itastata iti //
sarvadeśakālagatānāmavayavāvayavyādyupādhīnāmanantatvāditi śeṣaḥ /
upādhīnāmanantatve 'pi samavāyānantyaṃ kuta ityata āha- bhinnatvamiti //

bhinnatvaṃ caiva teṣvasti ... // MAnuv_2,2.130e //


*8,82f.*

NYĀYASUDHĀ:
co yasmādityarthe /
nahyaupādhiko bhedo nāmopādhīnāmeva bhedaḥ /
tathā sati samavāyasyeti na syāt /
uktadoṣaparihāraśca na bhavet /
kintu teṣu samavāyeṣvevopādhijanyaṃ tadavagamyaṃ vā bhinnatvamasti /
bhedahetavaścopādhayo 'nantā iti kathaṃ na samavāyānantyam /
tathāpyaupādhikameva tadānantyamityuktasya kimāyātamityata āha- ka iti //


*8,83*

... ko viśeṣa upādhige // MAnuv_2,2.130f //

NYĀYASUDHĀ:
upādhigastatsambandhī aupādhika iti yāvat /
aupādhikabhede ko viśeṣo yenāsāvabhedaṃ na viruṇaddhītyarthaḥ /


*8,84*

etaduktaṃ bhavati /
nīlapaṭasadbhāve 'pi pītapaṭābhāva ityatra hi yadi viśiṣṭaviṣayau vidhiniṣedhau, tadā bhinnaviṣayatvena virodhābhāvaḥ /
nīlapītapaṭayorbhinnatvāt /
nacaivaṃ prakṛte /
bhedaviśeṣābhāve 'pi bhedāntarābhyupagamāpatteḥ /
tathā caikatvoktirayuktaiva /
nahi pārthivaparamāṇau rūpādayo 'gnisaṃyogajā na tvāpyaparāmāṇurūpādaya iva svābhāvikā ityetāvatā rūpādirahito 'sau bhavati /
yadi ca viśeṣaṇaviṣayau tadā samavāye bhedo 'styeva /
sa tu sambandhibhirupādhibhiḥ kṛto na tvakṛtrima ityuktaṃ syāt /
tathāca ghaṭādibhedena tulya iti riktaivābhedoktiḥ /
upādhīnāṃ ca sarvadānapāyānna bhedasyāgantukatvaṃ yuktamiti /


*8,86*

upādhigamyamaupādhikamiti pakṣamaṅgīkṛtyoktadoṣābhāvaṃ śaṅkate- avidyamāna eveti //

avidyamāna evānyaḥ samavāyo 'dhigamyate /
upādhinā ... // MAnuv_2,2.131a-c //


*8,86f.*

NYĀYASUDHĀ:
satyamupādhigamyatvādaupādhikaḥ samavāyabhedo 'dhigamaśca na pramā /
yenāsau bhedaḥ pāramāthirkaḥ syāt /
kintu vibhrama eva /
nacaivaṃ bhedasyāsttvaprāptyā siddhasādhanatātādavasthyamiti vācyam yato 'vidyamāna evānyaḥ samavāyo 'dhigamyate tattadupādhineti brūmaḥ /
yathā aṅgulyavaṣṭabdhanayanādyupādhivaśādavidyamāna eva dvitīyaścandro 'dhigamyate /
tathā taistaiḥ sambandhilakṣaṇopādhibhiravidyamānā evāneke samavāyāḥ pratīyante /
ta ete samavāyā aupādhikabhedābhinnā ityucyante /
ta eva cāgnimadādiśabdavācyā anumānasādhyā viśiṣṭākārāḥ /
tathā ca na samavāyaikatvahāniḥ /
candravadāropitānāmanekatve 'pyanāropitasyaikatvāvirodhāt /
nāpyanumānānāṃ siddhasādhanatā /
tathāvidhasamavāyānāṃ prāgasiddhatvāditi /
pariharati tadgamakamiti /


*8,87*

... tadgamakamanumānaṃ na mā bhavet // MAnuv_2,2.131cd //

NYĀYASUDHĀ:
yadyapyasminpakṣe na siddhasādhanaṃ dhūmādyanumānam /
tathāpi tadgamakamavidyamānasamavāyasattāṃ pratipādayadanumānajātaṃ dahanaśaityānumānamiva bādhitaviṣayatayā na pramāṇaṃ bhavet /
upalakṣaṇaṃ caitat /
upādhīnvinā samavāyāvabhāsasya kvāpyabhāvātsarvatrāpi tasyāvidyamānataiva syādityapi draṣṭavyam /
tadevaṃ sarvānu(dhūmādyanu)mānānāṃ siddhasādhanatvādiprasaṅgānna samavāyaikyamupapannamiti /
etaccopalakṣaṇam /
āgamāpanhavaśca samavāyaikye syāt /
padārthānāṃ tatsaṃsargāṇāṃ ca sikatāvadviśakalitānāṃ siddhatvāt /

*8,88*

idānīṃ samavāyasya nityatvaṃ nirākaroti- evameveti //

evamevāsataḥ sattasamavāyo janirmatā // MAnuv_2,2.132ab //

NYĀYASUDHĀ:
yathā samavāyasya sarvatraikatvāṅgīkāre sarvānumānānāṃ siddhasādhanatvādiduṣṭatvamuktam /
evameva tannityatvābhyupagame prāgasataḥ sattāsamavāyo janirduṣyā matā /
samavāyanityatve na kasyāpi janiḥ syādityarthaḥ /
tatkathamityata āha- tatrāpīti //

tatrāpi hyuktadoṣāṇāṃ naiva kiñcinnivārakam // MAnuv_2,2.132cd //


*8,88f.*

NYĀYASUDHĀ:
uktadoṣāṇāṃ siddhasādhanatvādīnām /
tathāhi /
prāgasataḥ sattāsamavāyo janiriti pareṇa janilakṣaṇamabhihitam /
tatra yadi samavāyo nityaḥ syāttadā tallakṣaṇā ghaṭajaniḥ prākkulālādivyāpārādastīti tadarthasya tasya siddhasādhanatā syāt /
jñaptau hi siddhasyāpi sādhanaṃ ghaṭate /
kintu kvacidanapekṣatvamityeva /
kṛtau tu prāksiddhasya sādhanamevāśakyamiti kulālādivyāpārasya niṣphalatvaṃ syāt /
atha samavāyasya nityatve 'pi prāgasataḥ sattāsamavāyaḥ sādhyaḥ asto ko doṣa iti cenna /
samavāyaikyavyāghātāt /
aupādhikaḥ samavāyasya bheda iti cet /
yathāsambhavaṃ sarvamuktamanusandheyam /
nahi prāgasadviṣayo vyāpāraḥ sambhavati /
tasya satkāraṇātiriktakartavyābhāvāt /
satkāraṇasya sattāsamavāyānatirekāt /
svarūpalābhaḥ kulālādivyāpārasādhya iti cet /
evaṃ tarhi kimapareṇa sattāsamavāyena /
tadevaṃ samavāyasyaikatvanityatve sarvathāpyayukte iti /
yadvā samavāyanirākaraṇaprasaṅgātparoktaṃ viśiṣṭāderjaneśca svarūpaṃ tanmatāsāmāñjasyapradarśanāyaupādhiketyādinā nirākṛtaṃ(ca) veditavyam /


*8,91*

nanvetatsarvaṃ vyāhatam /
yuṣmābhirapi lokavedavyavahāraṃ paripālayadbhirviśiṣṭādeḥ aṅgīkaraṇīyatvāt /
tatrāpyuktadoṣānuṣaṅgādityato viśiṣṭādinirūpaṇe tāvaddoṣābhāvaṃ svamate darśayati- asmaditi //

asmatpakṣe viśeṣasya sarvatrāṅgīkṛtatvataḥ /
nāsti doṣaḥ kvacid ... // MAnuv_2,2.133a-c //


NYĀYASUDHĀ:
viśiṣṭākāro na viśeṣaṇaṃ nāpi sambandhaḥ /
kinnāma viśeṣyam /
naca tanmātram /
dvividho hi viśiṣṭākāraḥ /
yāvadviśeṣyabhāvyayāvadviśeṣyabhāvī ca /

tatrādyo viśeṣyeṇātyantābhinnaḥ /
yatheśvaraḥ svarūpeṇa sarvajñaḥ /
evaṃ yatra yatra viśeṣaṇasambandho yāvadviśeṣyabhāvī tatra tatra viśiṣṭaprakāro 'pi tathābhūto viśeṣyeṇātyantābhinno draṣṭavyaḥ /
tathāpi viśeṣasya bhedapratinidheḥ sarvapadārtheṣvaṅgīkṛtatveneśvaraḥ sarvajña ityaparyāyaśabdapravṛttyādyanupapattidoṣo nāsti /
īśvara eva sarvajña ityabhedastāvatpramitaḥ /
bhede tu na niravakāśaṃ pramāṇamastīti /


*8,91f.*

dvitīyastu viśeṣyeṇa bhinnābhinnaḥ /
yathā pavartenāgnimān /
yathā hi saṃyogaviśeṣasacivāstantavaḥ paṭākāreṇa pariṇamante /
tathā'gantukaviśeṣaṇasambandhādviśeṣyasvarūpaṃ viśiṣṭākāreṇa pariṇamate /
tatra yadyapi bhedābhedau vastunaḥ svarūpabhūtau tathāpyasmatpakṣe viśeṣasya sarvatrāṅgīkṛtatvato na saṅkaradoṣaḥ /
tadidamuktam- kvaciditi //
atyantābhedasthale bhedābhedasthale cetyarthaḥ /


*8,94*

yadvā kvacidityaupādhikāditraya ityarthaḥ /
tasyāpyuktaprakāratvāt /
etena bhedahīne 'pyākāśādāvaupādhiko bhedo dṛṣṭa itya(pya)pāstam /
viśeṣanibandhanānāmevākāśādyaṃśānāṃ ghaṭādyupādhibhiḥ sphuṭīkaraṇāditi /
janinirūpaṇe doṣābhāvaṃ svamate darśayati- asmaditi //

viśeṣasya pariṇāmasya janitvenāṅgīkṛtatvato na kaściddoṣo 'stīti yojanā /
mṛdādīnāṃ ghaṭādyākārāpattireva ghaṭādijanirna tu samavāya ityarthaḥ /


*8,95*

syādetat /
kvacidbhāvo viśeṣyo viśiṣṭākāraścābhāvo dṛśyate /
yathā ghaṭo na jānāti prakṛtirna kartrīti /
kvaciccābhāvo viśeṣyo viśiṣṭākārāśca bhāvaḥ pratīyate /
abhāvo 'sti /
abhāvaḥ prameya iti /
naca vidhiniṣedhātmanorbhāvābhāvayorabhedo yujyate /
tatkathaṃ viśeṣyābhinnaṃ viśiṣṭamucyata ityata āha- bhāvo hīti //

... bhāvo hyabhāvaśca sa eva hi // MAnuv_2,2.133cd //

NYĀYASUDHĀ:
kvacidityanuvartate /
yo bhāvaḥ sa eva kvacidabhāvo bhavati /
yaścābhāvaḥ sa eva kvacidbhāvo bhavatītyetadubhayaṃ prasiddhamevetyarthaḥ /
vākyārthadvayaprasiddhidyotanārthaṃ hiśabdadvayam /
tatkathamityata āha- abhāvasya ceti //

abhāvasya ca dharmāḥ syurbhāvāsteṣāṃ ca te 'khilāḥ // MAnuv_2,2.134ab //

NYĀYASUDHĀ:
asti tāvadidaṃ yadabhāvasyāpi bhāvā dharmāḥ syustathā teṣāṃ ca bhāvānāṃ ca te 'bhāvā dharmāḥ syuriti /
akhilā iti bahutvopalakṣaṇam /
etadapi nāṅgīkaromītyata āha- pratyakṣeti //

pratyakṣamānataḥ sarvametanno vāraṇakṣamam // MAnuv_2,2.134cd //

NYĀYASUDHĀ:
pratyakṣagrahaṇamupalakṣaṇārtham /
yasmādabhāvasyāpi bhāvā dharmāḥ santi bhāvasya cābhāvā ityetatsarvaṃ pratyakṣādipramāṇataḥ siddham /
ato na vārayituṃ śakyam /


*8,97*

astvabhāvabhāvayorbhāvābhāvadharmavattvam /
tathāpi bhāvasyābhāvatvamabhāvasya ca bhāvatvaṃ kvacidastītyatra kimāyātamityata āha- sarva iti //


*8,98*

sarve bhāvā abhāvāśca padārthāstena sarvadā // MAnuv_2,2.134ef //

NYĀYASUDHĀ:
yato 'bhāvābhāvayorbhāvābhāvadharmavattvaṃ siddham /
siddhaśca dharmadharmiṇorabhedatvena kāraṇatvena sarve bhāvāḥ padārthā abhāvāśca bhavanti /
abhāvaśca sarve padārthā bhāvā bhavantītyuktamupapannamityarthaḥ /

yadyevaṃ bhāvasyāpyabhāvatvamabhāvasya ca bhāvatvaṃ tarhi dravyādayo bhāvā eva prāgabhāvādayastvabhāvā eveti sarvatra prasiddho bhāvābhāvavibhāgaḥ kathamityata āha- tathāpīti //

tathāpi prathamaṃ buddheryo niṣedhasya gocara ḥ /
so 'bhāvo vidhibuddhestu gocaraḥ prathamaṃ paraḥ // MAnuv_2,2.135 //


NYĀYASUDHĀ:
niṣedhasya buddheriti sāmānādhikaraṇyam /
paro bhāvaḥ /
yadyapyeṣo 'rthaḥ prāgevoktastathāpi prasaṅgātpunaḥ smārita ityadoṣaḥ /


*8,99*

abhāvabhāvayorbhāvābhāvadharmavattvaṃ pratyakṣādisiddhamityuktam /
tatkathamityata āha- tasmāditi //

tasmāt pradhvastabhedādi sadityevāvagamyate // MAnuv_2,2.136ab //

NYĀYASUDHĀ:
pradhvastaṃ pradhvaṃso bhedaḥ pṛthaktvam /
ādipadena prameyatvādigrahaṇam /
yasmādabhāvasya bhāvadharmatvamasti /
tasmādeva hi pradhvaṃsābhāvādeḥ pṛthaktvaprameyatvādibhāvadharmajātamastyevetyavagamyate /
pratyakṣādineti yojanā /
pradhvaṃsaḥ prāgabhāvādvā ghaṭādvā pṛthak prameyo 'bhidheyaścetyavagamyate /
abhāvasya (ca)dharmānabhyupagame tadvirodhaḥ syāditi brūmaḥ /
ghaṭaḥ paṭo na bhavatīti bhāvasyānyonyābhāvadharmatvaṃ sphuṭatvānna pradarśitam /


evamabhāvayorbhāvābhāvātmakatvaṃ sāmānyataḥ prasādhya prakṛte yojayati- astīti //

astyabhāvo 'sti ca dhvaṃso dehābhāvaśca bhasmatā // MAnuv_2,2.136cd //
ityādi yujyate sarvaṃ ... // MAnuv_2,2.137a //



*8,99f.*

NYĀYASUDHĀ:
tasmādityanuvartate /
yata evamabhāvasya bhāvatvaṃ bhāvasya cābhāvatvamupapāditam /
tasmādabhāvo 'sti pradhvaṃso 'sti /
dehābhāvo bhasmatetyabhāvasya viśeṣyatvaṃ bhāvasya ca viśiṣṭatvaṃ tayoścābhedastathā ghaṭo na jānātīti bhāvo viśeṣyo 'bhāvaśca viśiṣṭākārastayoścābheda ityuktaṃ yujyata ityarthaḥ /


*8,100*

yadi bhāvābhāvayorekatvaṃ na viruddhaṃ tadā ghaṭo 'pi svābhāvātmā kinna syādityata āha pratyakṣāditi /

... pratyakṣādipramāṇataḥ // MAnuv_2,2.137b //

NYĀYASUDHĀ:
siddhamiti śeṣaḥ /
bhāvābhāvayorviśeṣyaviśiṣṭayoraikyaṃ pratyakṣādipramāṇasiddhaṃ natu ghaṭatadabhāvayoḥ /
ato nātiprasaṅga ityarthaḥ /
yadvā bhāvābhāvayordharmadharmibhāvo dharmadharmiṇośca abhedaḥ prāmāṇika ityetatkiṃ bhāvābhāvayorviśeṣyaviśiṣṭayoraikyasyopapādakaṃ kiṃvā sambhāvanāhetuḥ /
ādye tūkto 'tiprasaṅgaḥ /
dvitīye sādhakaṃ vācyamityatredamuktam /
anena kvacidityuktaṃ vivṛtaṃ bhavati /


*8,101*

athavā bhāvo hītyādinā pariṇāmavādaḥ prapañcyate /
tathāhi /
kecitpariṇāmavādinaḥ sata evābhivyaktiṃ janimāhuḥ /
tadvyudāsārthamāha- bhāvo hīti //
atra bhāvābhāvaśabdau sadasatparau /
yaḥ kāraṇatvābhimato mṛtpiṇḍaḥ sa kāryaghaṭātmanābhāvaḥ sa eva tadātmanā bhāvaśca /
yadvā sa ghaṭaḥ prāgutpatterbhāvaḥ san, sa eva tadabhāvo 'saṃśca /
athavā yaḥ kulālādivyāpārātprāgabhāvo ghaṭātmanāsanmṛtpiṇḍaḥ sa eva tadanantaraṃ bhāvo ghaṭātmanā san bhavatīti /
etaduktaṃ bhavati /
kāryaṃ kāraṇena bhinnābhinnam /
tata eva prāgutpatteḥ sadasat /
ataḥ kāraṇaṃ prākkārakavyāpārādakāryātmakaṃ satkāryarūpatāmāpadyate yatsā janiriti /

nanvekasyaiva bhinnatvamabhinnatvaṃ ca sattvamasattvaṃ ca viruddhamityato yathaikasyaiva bhāvatvamabhāvatvaṃ ca na viruddham /
tathaitadapītyādau sambhāvanāṃ tāvadupadarśayannekaikasya bhāvatvamabhāvatvaṃ ca upapādayati- abhāvasyeti sārdhaślokadvayena /
pūrvavadeva vyākhyānam /


*8,101f.*

astviyaṃ sambhāvanā /
niścāyakaṃ kimityato bhedāsattvayoḥ pareṇāpyaṅgīkṛtatvādabhedasattve pramāṇena sādhayati- tasmāditi //
pradhvastasya ghaṭāderbhedaḥ pradhvastabhedaḥ /
ādipadenānutpannasya kārakatvaṃ gṛhyate /
"naṣṭānāmapi vastūnāṃ bhedo naiva vinaśyati'; iti yatpradhvastabhedasya sattvamavagamyate yacca ghaṭo jāyate ghaṭaṃ janayatītyanutpannasyāpi kartṛtvaṃ karmatvaṃ(ca) vā /
tattasmātkāryasya kāraṇābhedātprāgutpattervināśottaraṃ ca sattvādeva hi yujyate /
nahyatyantāsattvamāpannasya svarūpabhedaḥ sanniti yujyate /

nāpyatyantāsataḥ kārakatvam /
naca kāryasya pṛthageva sattvamasti /
anupalambhāt /
ataḥ sattvaṃ kāraṇābhedaścāṅgīkaraṇīyaḥ /
naca vinaiva bādhakenopacāratvakalpanā yuktā /
atiprasaṅgāt /
tadidamuktamavagamyata eveti /
na kevalaṃ vyavahriyata ityarthaḥ /

abhāvasya ca bhāvāḥ syurdharmāste ca pratyakṣādipramāṇasiddhatvādyujyanta eva na tu nirākaraṇārhā ityuktam /
tadviśadayati- astīti //
ādipadena ghaṭāderbhāvasya paṭānyonyābhāvadharmatvaṃ gṛhyate /


*8,105*

syādetat /
anyonyābhāvasya bhāvadharmatve 'pi tasya bhāvātpṛthaktvena kathaṃ bhāvasyāpyabhāvatvamucyate /
anyonyābhāvasya bhedatvādbhedasya ca svarūpatvāṅgīkārāditi cenna /
svarūpabhedasyānyonyābhāvātiriktatvāt /
yaccoktamabhāve 'pi pṛthaktvamastīti tadasat /
pramāṇābhāvāt /
svarūpabhedenaivāsaṅkaropapatteḥ /
pṛthaktvasya ca svarūpabhedātiriktatvādityata āha- anyonyeti //

anyonyābhāvabhedau ca pṛthaktavaṃ ca pṛthak pṛthak // MAnuv_2,2.137cd //
yat kalpayanti taccaiva kalpanāgauravād gatam // MAnuv_2,2.138ab //



*8,106*

NYĀYASUDHĀ:
pṛthak pṛthagvibhinnānītyarthaḥ /
caśabdo dūṣaṇāntarasuccayārthaḥ /
gataṃ prāgeva nirākṛtam /
anena punaruktidoṣaḥ parihṛto bhavati /

kathaṃ kalpanāgauravādikamityata āha- paryāyatveneti //

paryāyatvena te śabdā jñāyante sarva eva hi // MAnuv_2,2.138cd //

NYĀYASUDHĀ:
kramaprayojyatvenetyarthaḥ /
sarva eva laukikā vaidikāśca /


*8,107*

atra māyāvādinaścodayanti /
svarūpabhedānatiriktayoranyonyābhāvapṛthaktvayorbhāvābhāvadharmatvopalambhātsarvapadārthānāmapi bhāvābhāvātmatāsiddhiriti yaduktaṃ tadayuktam /
bhedasya vastusvarūpatvānupapatteḥ /
tathāhi /
bhedastāvadvidāraṇātmā /
bhidirvidāraṇa iti vidāraṇārthabhididhāturūpatvādbhedaśabdasya /
tasya ca vidāraṇātmano bhāvasvabhāvatve tasyāpi vidāraṇaṃ syāt /
tathā tadekadeśānāmapi bhedaḥ svabhāva iti tatrāpa vidāraṇaṃ bhavedityanena krameṇa sarvaśūnyatā syāt /

kiñca bhedasya vastusvarūpatve na tatraikatā samaveyāt /
abhedaikārthasamavāyinyā ekatāyā bhedena virodhāt /
ekatvābhāve 'nekatvamapi na syāt /
tatsamāhararūpatvāt tatkāryatvādvā tasya /
ekatvānekatvavikalaṃ ca śūnyamevāpadyate /


*8,107f.*

api ca yadi bhedo vastusvarūpaṃ syāttadā pratiyogyanapekṣaḥ prasajyeta /
svarūpasyānapekṣatvāt /
nahi ghaṭātpaṭasya bheda itivat ghaṭātpaṭa iti pratītirasti /
ghaṭo bhinno ghaṭasya bheda iti viśeṣaṇaviśeṣyabhāvasambandhapratibhāso 'pi bhedasya vastusvarūpatve dugharṭaḥ syāt /
nahi svayameva svasya viśeṣaṇaṃ sambandhi vā bhavati /
saṃśayaviparyayau caivamucchidyeyātam /
bhedāgrahanimittarau hi tau bhavataḥ /
tatra yadi dharmiṇamavagāhya tau bhavatastadā tatsvabhāvabhūto bhedo 'pi gṛhīta iti kva tayoravakāśaḥ /
na cennirviṣayatvātsutarām /
yadi cāsmadayaṃ bhinna iti pratiyogighaṭitatayā pratīyamāno bhedo vastunaḥ svarūpaṃ syāt /
tadā tasya saparikarasya bhedasya svarūpe 'ntarbhāvātpratiyogino 'pi svarūpatayā nimajjanādadvaitamatameva paryavasyediti /


*8,108*

tānapākaroti- bhedasyeti //

bhedasya tu svarūpatve ye vadanti ca śūnyatām /
adbhutatāste yato 'nyasya pratiyogitvamiṣyate // MAnuv_2,2.139 //


NYĀYASUDHĀ:
tuśabdaḥ prakṛtādvaiśeṣikādervyavacchindanye tviti sambaddhayate /
svarūpatve bhedyavastusvarūpatve /
śūnyatāṃ sarvasyāpīti śeṣaḥ /
caśabdaḥ pūrvoktadūṣaṇasamuccayārthaḥ /
adbhutā āścaryāḥ /
na laukikeṣvevaṃvidhā dṛśyante nāpi parīkṣakeṣviti yāvat /
tatkathamityataḥ śūnyatāpattiṃ tāvannirākaroti- yata iti //
yo bhedo yasya svarūpamiṣyate taṃ bhedaṃ prati tato 'nyasyaiva vastunaḥ pratiyogitvamiṣyate yatastasmādadbhutāsta iti sambandhaḥ /


*8,111*

anyasya pratiyogitve 'pi kathamuktadoṣaparihāra ityata āha- pratiyogino hīti //

pratiyogino hi bhedo 'yaṃ natu svasmāt kathañcana // MAnuv_2,2.140ab //

NYĀYASUDHĀ:
hiśabdaḥ pūrvavaddhetau /
ayamityevambhāvasya pratyakṣādisiddhatāṃ sūcayati /
svasmāt dharmisvarūpāt /
idamuktaṃ bhavati /
vidāraṇātmā hi bhedo yasya yatastaṃ tato vidārayet /
natu yaṃ kamapi yataḥ kutaścit /
na(hi)ca ghaṭasvarūpasya bhedasya ghaṭa eva pratiyogī yena svasminvidāraṇaṃ syāt /
kintu ghaṭādaya eva /
tato vidāraṇaṃ tu nāniṣyam /
tasya śūnyatānāpādakatvāditi /

kiñca bhidyate 'neneti yadi bhedaśabdaḥ karaṇasādhano bhavet tadā bhedaḥ kamapi vidārayet /
bhāvasādhanatvāṅgīkārāt /
ato 'bhyupagamyaiva karaṇasādhanatāmayaṃ parihāraḥ abhihita ityāśayavānāha- kathañcaneti //
idamuditamiti śeṣaḥ /


*8,112*

kiñca vidāraṇamapi lavitrādi yatsambandhi tadvidārayati /
natu svātmānam /
ato dharmabhedavāde kathañcididaṃ vaktavyam /
svarūpabhedavāde tu kvāsyāvakāśaḥ /
bhedasya vastusvarūpatve na tatraikatā samaveyādityapyanenaiva nirastam /

nahyekatānekate svarūpeṇa viruddhe /
ekasyaiva ghaṭasyānyāpekṣayānekatvadarśanāt /
kintu yadapekṣayānekastadapekṣayaivaika iti viruddham /
tatra ghaṭasya parasmātpratiyogina eva bheda iti /
tadapekṣayaivānekatvaṃ svāpekṣayā tvekatvamiti ko virodhaḥ /
api caikatvānekatvayoḥ sāmānādhikaraṇyaṃ vā viruddhaṃ dharmadharmibhāvo vā /
ādye naikatāyā bhedena virodhaḥ /
bhedasya svarūpatvenaikatāsāmānādhikaraṇyābhāvāt /
na dvitīyaḥ /
ekaṃ dvitvamiti darśanāt /
ekatvānekatvābhāve 'pi śūnyatvaṃ kutaḥ /
vaiśeṣikādīnāṃ guṇādivanmāyāvādināṃ brahmavadaguṇasyāpi sattvopapatteriti /


*8,114*

nanu bhedo vastusvarūpaṃ cetpratiyoginirūpya eva na syāt /
svarūpasya tadabhāvāt /
ato nāyaṃ parihāro yujyate /
tathāca svasminneva vidāraṇe punaḥ śūnyataiveti cenna /
svataḥ parato 'pi vyāptyasiddheḥ /
yathā(hi) paranirūpyamapi brahmaṇo jīvaikyaṃ brahmasvarūpatvaṃ māyāvādināṅgīkṛtam asmābhiśca paratvādikaṃ dravyasvarūpam /
tathā pratiyoginirūpyasyāpi bhedasya vastusvarūpatve ko virodhaḥ /


*8,115*

kiñca bhedo vastusvarūpamiti bruvāṇo vastusvarūpasyāparanirūpyatvaṃ kathamabhyupeyāt /
etāvattu syāt /
ekasyaiva vastunaḥ pratiyogipratītimapekṣyānapekṣya ca pratītiḥ katham /
tatrāpi na saiva pratītirubhayīṃ gatimaśnute /
kintu pratītidvayametat /
taccaikasminnapi vastuni viśeṣabalamavalambya samañjasaṃ bhaviṣyatīti bhedasya parapratiyogitopapatteḥ kutaḥ svasminvidāraṇāpattiḥ /


*8,117*

astu vā svarūpavidāraṇam /
tathāpi śūnyatāpādanamayuktamevetyāśayavānāha- vibhāgeneti //

vibhāgenālpataiva syāt kuta eva ca śūnyatā // MAnuv_2,2.140cd //

NYĀYASUDHĀ:
loṣṭhādeḥ khalvavayavibhāgena loṣṭhādivināśe satyalparimāṇāvayavāvaśeṣo 'vagato, natu sarvaśūnyatā /
tathā sarvatrāpi vibhāgenālpatālpāvayavāvaśeṣataiva syācchūnyatā tu kuta eva syāt /

nanu ca pañcaṣeṣu sthaleṣu vidāraṇenālpālpatarālpatamavastvavaśeṣe 'pyantataḥ kasyacidavayavajātasya śūnyatāyāṃ sarvaśūnyatā syādityata āha- neti //

na śūnyānāṃ hi saṃyogād bhāvo vastuna iṣyate // MAnuv_2,2.141ab //


*8,117f.*

NYĀYASUDHĀ:
yatsaṃyogena hi yadvastūtpannaṃ tasminvidāraṇe sati saṃyoganāśādvastunāśānantaraṃ tadavaśeṣo bhavati /
yathā tantusaṃyogenotpanne ghaṭe tantuvidāraṇasaṃyoganāśakrameṇa vinaṣṭe tantvavaśeṣaḥ /
evaṃca yadi keṣāñcitparamālpānāṃ vastūnāṃ śūnyasaṃyogādutpattiḥ syāttadā vidāraṇe sati saṃyoganāśena kāryanāśe śūnyāvaśeṣaḥ syāt /
nacaivaṃ prāmāṇikairiṣyate /
ato 'saṅgataṃ sarvaśūnyatāpādanamiti /
bhāvo janma /


*8,118*

nanu śūnyatvaṃ nāma nātyantāsattvamāpādyatvena vivakṣitam /
kintu sūkṣmatamatvameva /
taccāniṣyamityata āha- vidāraṇeti //

vidāraṇārtho dhātuśca vibhāgaguṇavācakaḥ // MAnuv_2,2.141cd //

NYĀYASUDHĀ:
syādetadyadi bhedo vidāraṇātmā bhavet /
nacaivam /
pramāṇābhāvāt /
aṅgīkṛtyaiva tu pūrvaḥ parihāro 'bhihitaḥ /

nanūktamatra bhedaśabdādeva bhedasya vidāraṇātmakatvamavagamyate /
sa hi bhiderdhāto rūpam /
sa ca vidāraṇārthatayā vyākhyāta iti /
atrotraram /
yadā bhididhāturvidāraṇārtho vivakṣitastadā bhedaśabdo vibhāgākhyaguṇavācako na tvanyonyābhāvalakṣaṇabhedavācaka iti /
etaduktaṃ bhavati /
"kriyāvācitvamākhyātumekaiko 'rthaḥ pradarśitaḥ /
prayogato 'nugantavyā anekārthā hi dhātavaḥ'; iti vacanādbhidirvibhāgavacano 'nyatvavacanaśca /
bhinno ghaṭa ityukte sphuṭita iti gamyate /
bhinnaṃ gaganaṃ ghaṭādityanyaditi vijñāyate /
tatra vibhāgo vidāraṇātmā nānyatvam /
tadeva cātra prakṛtaṃ na vibhāga ityanyatālakṣaṇasya bhedasya vastusvarūpatve vidāraṇaprasaṅgenātyalpatāpādanamapyasaṅgatameva, chalatvāditi /

nanu vibhāgasyānyatvasya ca ko viśeṣo yenaivamucyata iti cenna /
guṇagrahaṇenaiva parihṛtatvāt /
vibhāgo hi guṇatayā vaiśeṣikādibhirupāttaḥ /
anyatā cānyonyābhāva iti sphuṭo bhedaḥ /


*8,120*

yastu guṇādiprakriyāṃ na māyāvādī manyate /
taṃ bodhayitumāha- avidāraṇe 'pīti //

avidāraṇe 'pi hyāsyasya bhinnāvoṣṭhau tu tasya ca // MAnuv_2,2.142ab //

NYĀYASUDHĀ:
āsyasyetyāsyasambandhinoroṣṭhayorgrahaṇam /
tasya ca māyāvādina eva /
yadā hi māyāvādī niruttaratayā tūṣṇīmāste tadā tadīyayoroṣṭhayorvidāraṇalakṣaṇavibhāgābhāve 'pyoṣṭhau bhinnāvanyonyābhāvalakṣaṇabhedavantau bhavata eva /
yadabhāve ca yadasti tattato 'nyaditi ca prasiddhameva /
ato vibhāgādbhedo 'rthāntarameveti jñāyate /
tasya cetyanena nātaḥ paraṃ svarūpabhede kācidanupapattiḥ sambhāvitāstīti sūcitam /
nanu kathaṃ nāsti /
viśeṣaṇaviśeṣyabhāvānupapattyāderaparihṛtatvāditi cenna /
svarūpatve 'pi viśeṣabalena viśeṣaṇaviśeṣyabhāvasambandhāvabhāsopapatteḥ /
anyathā'nandaṃ brahma ānandaṃ brahmaṇa ityāderanupapattiprasaṅgāt /
saṃśayaviparyayānupapattirapi nāsti /
saviśeṣatvena jñātājñātatvopapatteḥ /
anyathā'tmasvarūpe svayaṃprakāśamāne tatsvarūpamātrāṇāmadvitīyatvānandatvādīnāmapi prakāśanīyamānna jātu kasyacitsaṃśayaviparyayau syātām /
avidyāvaśāttatra tatheti cet /
atrāpi sādṛ(śyādiva)śyavaśāttatheti santoṣyavyam /


*8,121*

yaccādvaitaparyavasānamuktam /
tatkuta iti vaktavyam /
yadi manyeta yathā hi lambakarṇa āgato, nīlamānīyatāmityādau parikaravato yadbhavati tatparikarasyāpi, tathā pratiyogighaṭitasya bhedasya dharmisvarūpatve pratiyogino 'pi ta(tra nima)nnimajjanaṃ syāditi tatra kiṃ sambhāvanayedamucyate uta vyāptyā /
nādyaḥ /
praśithilamūlatvāt /
na dvitīyaḥ /
citragurānīyatāṃ kāśīnivāsī samāgata ityādau tadabhāvāt /
pāramārthikīṃ dṛṣṭimavalambamānasya tadapi asiddhamiti cet /
aho pakṣapāto 'sya yatparasyāniṣyaṃ prasañjayanvyāptigrahaṇāya laukikaṃ dṛṣṭāntaṃ bahumanyate vyabhicāre tu tatrodāste /
parasiddhena parasyaivāniṣyāpādanamiti cet /
tarhi mūlaśaithilyamapi paraḥ svasiddhena pratipatsyate /
vaicitryaṃ kinnimittamiti cet /
vyāvartakatvamātreṇa pratiyogināmupayogāditi brūmaḥ /


*8,123*

tadevaṃ svaparamatāvalokānapekṣayaiva doṣodbhāvanādupekṣaṇamevonmattavākyavanmāyāvādasyocitam /
kinnirākaraṇenetyāśayavānupasaṃharati- ata iti //

ata unmattavākyatvānmāyāvādo 'bhyupekṣitaḥ // MAnuv_2,2.142cd //

NYĀYASUDHĀ:
nanvevaṃvidhaṃ mataṃ siddhāntaviruddhatvātsūtrakṛtā kuto 'tra na nirākṛtamityetadanena parihriyate /
upekṣitaḥ sūtrakāreṇeti śeṣaḥ /


evaṃ samavāyaṃ nirākṛtyedānīṃ sambandhaprasaṅgena sambandhināmapi guṇādīnāṃ prasaktatvādīśvaraguṇasaṅkhayāvipratipattiṃ nirākaroti- naceti //

na cāmandasadānandasyandyanantaguṇārṇavaḥ /
īśvaro 'ṣṭaguṇatvena prameyo 'pramitatvataḥ // MAnuv_2,2.143 //

NYĀYASUDHĀ:
īśvaro 'ṣṭaguṇatvena aṣṭāveva guṇā asya santītyevaṃrūpeṇa, na prameyo na pratipattavyaḥ /
kutaḥ apramitatvataḥ aṣṭaguṇatve pramāṇābhāvāt /
kintvamandasadānandasyandyanantaguṇārṇavaḥ prameyaḥ /
arṇava ivārṇavaḥ, kṣīrārṇavaḥ sudhāsyandī bhavati /
ayañcānalpavidoṣānandasudhāsyandī /
so 'nantā guṇāḥ śubhapadārthāścintāmaṇiprabhṛtayo 'sminnityanantaguṇaḥ /
ayamapyānandādayo 'nantā guṇā asminnityanantaguṇaḥ /
amandasadānandasyandī cāsāvanantaguṇaścāsāvarṇavaśceti vigrahaḥ /


*8,124*

aṣṭaguṇatvavadanantaguṇatve 'pīśvarasya pramāṇaṃ nāstītyata āha- mayīti //

mayyanantaguṇe 'nante guṇato 'nantavigrahe /
anantaguṇamāhātmyaśaktijñānamahārṇavaḥ // MAnuv_2,2.144 //
nārāyaṇaḥ paro 'śeṣacetanebhyaḥ paraṃ padam /
ityādivedatadvākyairanantaiścāvasīyate // MAnuv_2,2.145 //
anantaguṇatā viṣṇoḥ ... // MAnuv_2,2.146a //



*8,124f.*

NYĀYASUDHĀ:
anantā asaṅkhayātā guṇā yasyāsāvanantaguṇaḥ /
guṇato 'nanta iti guṇānāṃ pratyekamanavadhikatvamanantāvāntaraviśeṣavattvaṃ cābhipreyate /
anantavigraha ityantaṃ bhagavadvākyam /
uttaraṃ vedavākyam /
guṇamāhātmyeti sāmānyaviśeṣābhyāmuktam /
māhātmyaṃ parimāṇātiśayaḥ /
paraṃ padamityuddiśyānyaducyata iti na liṅgavyatyayadoṣaḥ /

nanvetāni vacanānyupacaritārthāni kinna syurityata āha- kathameveti //

... kathameva hyapodyate // MAnuv_2,2.146b //

NYĀYASUDHĀ:
bādhakavaśāddhi mukhyārtho 'podyate /
nacātra tadastītyato 'nantaguṇatā viṣṇoḥ kathamevāpodyate /


*8,126*

yacca vaiśeṣikādibhirīśvarajñānecchāprayatnānāmakhaṇḍatvamuktaṃ tadapyasat /
"anantaṃ guṇataḥ'; iti pratyekaṃ guṇānāmanantaviśeṣavattvasyāgamasiddhatvāt /
tadanaṅgīkāre bādhakaṃ cāha- yadīti //

yadyanantaviśeṣāśca tajjñānādernivāritāḥ // MAnuv_2,2.146cd //
kathaṃ tattadviṣayatā sārvajñyārthaṃ vidhīyate /
aupādhikaviśeṣastu pūrvameva nirākṛtaḥ // MAnuv_2,2.147 //



*8,126f.*

NYĀYASUDHĀ:
tattadviṣayatā ghaṭādiviṣayatā, vidhīyate astitvenāṅgīkriyate /
mā bhūttattadviṣayatvamityata uktam- sārvajñārthamiti //
upalakṣaṇaṃ caitat /
sarvakartṛtvādyarthaṃ cetyapi draṣṭavyam /
atrānantaviśeṣā iti yathāgamasiddhoktiḥ /
vastutastu yadi īśvarajñānādi nirviśeṣaṃ syāttadā tattadviṣayatvaṃ na syāt /
tadā ca tasya sārvajñādikaṃ na syāt /
sarvaviṣayajñānavānhi sarvajño nāma /
tathā sarvakāryotpattiviṣayecchāprayatnavānsarvakartā /
sarvakāryavināśaviṣayecchādimāṃśca sarvasaṃhartā /
aṅgīkṛtaṃ ca sārvajñādi pareṇa parameśvarasya /
atastadarthaṃ jñānādestattadviṣayatayā bhāvyam /
kathaṃ ca tathā sati nirviśeṣatvamiti /


*8,127*

etanaidapi nirastam /
yadāhuḥ /
"anityaṃ hi jñānādi karmakārakatayā viṣayasahitatvamapekṣeta /
nityasya tu kiṃ viṣayeṇa'; iti /
viṣayāṇāṃ cānantyādanantaviśeṣatāsiddhiḥ /


*8,128*

syādetat /
nirviśeṣameveśvarajñānaṃ jñaptirūpam /
tattu taistairghaṭādyupādhibhistattadviṣayamiti vyapadiśyate /
evamakhaṇḍaiva tasyecchāstvityevamākārā /
tathāpi taistaiḥ sṛṣṭayādyupādhibhiḥ sisṛkṣā sajjihīrṣetyādyucyate /
tathā prayatno 'pi /
ataḥ svato viśeṣābhāve 'pyaupādhikaviśeṣavaśāttattadviṣayatā sārvajñādikaṃ ca yuktamityata āha- aupādhiketi //


aupādhiko 'pi viśeṣo 'sti na vā /
asti cetkathaṃ nirviśeṣatvam /
na cetpunaḥ sārvajñādyabhāva ityādipūrvoktanyāyenaiva nirastamityarthaḥ /
kiñcopādhirjñānādisambaddho viśeṣamāpādayedasambaddho vā /
ādye sambandho viṣayaviṣayibhāvātirikto nāstīti pūrvameva tadviṣayataiṣyavyā /
dvitīye 'tiprasaṅgaḥ /
api cāstvityevamākāreṇaivecchādinā sṛṣṭayādikaṃ bhavati uta sṛṣṭayādikaṃ bhavatvityevamākāreṇa /
nādyaḥ /
atiprasaṅgāt /
dvitīye svataḥ saviśeṣatvamityeṣā dik /


*8,129*

vaiśeṣikādayaḥ kecidīśvarajñānaṃ svaprakāśaṃ na bhavatītyāhuḥ /
tānapākaroti- svaprakāśatvamapīti //

svaprakāśatvamapi tu yairjñānasya nivāritam /
kathaṃ sarvajñatā tasya ... // MAnuv_2,2.148a-c //


NYĀYASUDHĀ:
yaistviti sambandhaḥ /
kecidvaiśeṣikādayaḥ svaprakāśatāmaṅgīkurvantītyetatsūcayituṃ tuśabdaḥ /
jñānasya īśvarajñānasya /
teṣāṃ pakṣa iti śeṣaḥ /
tasya īśvarasya /
kathaṃ svaprakāśatvābhāve sarvajñatābhāva ityata āha- sveti //


*8,130*

... svajñānādhigamaṃ vinā // MAnuv_2,2.148d //

NYĀYASUDHĀ:
svajñānādhigamābhāvādityarthaḥ /
ekameva hīśvarajñānaṃ tacca svavyatiriktameva viṣayīkaroti na tu svarūpamiti kathamīśvaraḥ sarvajñaḥ syāditi /

svaprakāśajñānābhāve 'pīśvarasya sārvajñasambhavaṃ śaṅkate- jñānamiti //

jñānaṃ viśvādhigaṃ tvekaṃ tajjñānaviṣayaṃ param /
iti jñānadvayenaiva sarvavit parameśvaraḥ // MAnuv_2,2.149 //
iti ced ... // MAnuv_2,2.150a //


NYĀYASUDHĀ:
viśvādhigaṃ svavyatiriktasamastaviṣayam /
tajjñānaṃ viṣayo yasya tattathoktam /
syādayaṃ doṣo yadīśvarasyaikameva jñānaṃ syānna caivam /
dve khalvīśvarajñāne /
tatraikaṃ svavyatiriktadvitīyajñānasahitasarvaviṣayam /
dvitīyaṃ tu tajjñānaviṣayīkāri /
evaṃca jñānasya svaviṣayatvābhāve 'pīśvarasyaivaṃvidhajñānadvayenaiva sarvavittvamupapadyata iti /

tathāpīśvarasyāsārvajñaṃ tajjñānasya vā svaprakāśatvaṃ duṣpariharamityāśayavānuttaramāha- eṣa eveti //

... eṣa evārthastajjñānāvasito yadi /
svaprakāśatvameva syāj ... // MAnuv_2,2.150a-c //


NYĀYASUDHĀ:
āstāṃ tāvatsajātīyātmaviśeṣaguṇayaugapadyānupapattiḥ /
jñānadvayavānahaṃ, jñānadvayena sarvajño 'smi, idaṃ me jñānametajjñānaviṣayaṃ etaccaitadviṣayamityādireṣa evārtha īśvareṇa jñāyate na vā /
neti pakṣe tasya sārvajñaṃ na syāt /
ādye kimetayoranyatareṇota jñānāntareṇa /

prathamasyedamuttaram /
eṣa evārthastayoranyatareṇa jñānenāvasito viṣayīkṛto yadi tadā tasya jñānasya svaprakāśatvaṃ syādeveti /
tatkathamityata āha- jñānaṃ hīti //

... jñānaṃ hyetad viśeṣaṇam // MAnuv_2,2.150d //

NYĀYASUDHĀ:
yadyapyetajjñānaṃ na niṣkṛṣṭaṃ svasya svaviṣayatāmāpadyate /
tathāpi jñānaviṣayasyaitasya jñānadvayānahamityāderarthasya viśeṣaṇaṃ bhavatyeva /
tathāca viśiṣṭārthaviṣayatve viśeṣaṇabhūtasvaviṣayatvamavarjanīyameva /
nahi daṇḍisākṣātkāre daṇḍo na sphuratīti yuktamiti /


*8,131*

dvitīye doṣamāha- jñānāntareṇeti //

jñānāntareṇa cedatra bhavedevānavasthitiḥ // MAnuv_2,2.151ab //

NYĀYASUDHĀ:
jñānāntareṇa tṛtīyena jñānena /
yadyeṣo 'rtho viṣayīkriyate /
atra asminpakṣe anavasthitiḥ jñānadvayavānīśvara iti niyamābhāvo bhavet /

yastu jñānatrayavāniti niyamaṃ manyate sa praṣṭavyaḥ /
kiṃ jñānatrayavānahamasmītyādikamarthamīśvaro vetti na veti /
dvitīye tu punarasārvajñam /
ādye kimetattrayānyatamena, uta caturthena /
nādyaḥ /
svaprakāśatāpatteḥ /
dvitīye punaranavasthaiva /
evaṃ jñānāntaraparamparābhyupagamavyasanaṃ durvāraṃ syāt /


*8,132*

nanvanantānīśvarajñānānyabhyupagacchāmi ko doṣa iti cenna /
kalpanāgauravādvaramekasyaiva jñānasya svaprakāśatvābhyupagama ityāśayavānupasaṃharati- svaprakāśatvamiti //

svaprakāśatvametasmād durnivāryaṃ samāpatet // MAnuv_2,2.151cd //

NYĀYASUDHĀ:
nanu jñānaṃ na svaprakāśaṃ vastutvādityādeḥ viruddhaṃ(di) svaprakāśatvaṃ kathamaṅgīkartumucitamiti cet (na) /
yat vastu, na tatsvaprakāśamiti vyāptijñānaṃ svātmānaṃ na viṣayīkaroti cenna sarvopasaṃhāravadvayāptisiddhiḥ /
viṣayīkaraṇe tu svaprakāśatvaṃ durnivāramityāśayavato vopasaṃhāraḥ /


*8,133*

yaduktamīśvaro 'nantaguṇa iti tadanupapannam /
caturviṃśateradhikānāṃ guṇānāmabhāvāt /
tatrāpi keṣāñcidīśvare 'nupapatteḥ /
tasmādupapannairaṣṭabhireva guṇairupapanno bhagavāniti /
maivam /
śauryaudāyarprāgalbhyaprabhṛtīnāṃ guṇānāṃ bhāvāt /
pareṇa svīkṛteṣvapi keṣāñcidanupapattyabhāvācca /
tathāhi /
sukhaṃ tāvadīśvarasya kuto nāṅgīkartavyam /
īśvaraḥ sukharahito duḥkharahitatvādghaṭavat /
sukhavāṃścedaduḥkhavānprasajyate devadattavaditi vipakṣe bādhakopapannādanumānāditi cet /
tatrānugrāhakasya tarkasya tāvaddūṣaṇamāha- sukhavāniti //


*8,134*

sukhavān duḥkhavāṃśca syāditi vyāptiśca no bhavet // MAnuv_2,2.152ab //


NYĀYASUDHĀ:
kathaṃ vyāptyabhāva ityata āha- nirduḥkhatvamiti //

nirduḥkhatvaṃ mahānandaḥ śrutyaiveśasya bhaṇyate // MAnuv_2,2.152cd //


*8,134f.*

NYĀYASUDHĀ:
yadyapi sukhitvaṃ duḥkhitvena sahacaritaṃ devadattādāvupalabdham /
tathāpīśvare nirduḥkhe 'pi vācyaṃ prāk prasañjānādvayāptigrahaṇavelāyāmevedaṃ vyāptibhaṅgodbhāvanamiti /
sarvatrāpyevaṃ vaktuṃ śakyatvenoktadoṣānistārāditi /
maivam /
svābhyupagamamātreṇāpādanasthale vyāptibhaṅgābhidhāne satyevametat /
nacaivaṃ prakṛte /
śrutibalenaiveśvare sukhitvasya duḥkhitva(sya)vyabhicāropapādanāt /
tadidamuktam- śrutyaiva bhaṇyata iti //
pratyekaṃ sambandhādekavacanam /


*8,135*

kāsau śrutirityato 'rthatastāmudāharati- ya iti //

yo 'śanāyāpipāse ca śokādīṃścātivartate /
ānandaṃ brahmaṇo vidvān vipāpmetyādikā ca sā // MAnuv_2,2.153 //


NYĀYASUDHĀ:
anena"yo 'śanāyāpipāse śokaṃ mohaṃ jarāṃ mṛtyumatyeti'; iti śrutimupādatte /
vipāpmetyanena"ya ātmāpahatapāpmā'; ityādiśrutim /
sā nirduḥkhatvādyabhidhātrī /

nanvānandaśruterduḥkhābhāvaviṣayatvopapatterna śrutyavaṣṭambhena prasaṅgamūlabhūtavyāptibhaṅgo vaktuṃ śakyata ityato 'ṅgīkṛtya tāvatsopādhikatvamāha- īśvarasyeti //


*8,136*
īśvarasya tatheṣṭatvaṃ duḥkhitvopādhirityapi /
ukte kimuttaraṃ brūyācchrutyanādaratatparaḥ // MAnuv_2,2.154 //


NYĀYASUDHĀ:
tatheṣṭatvaṃ duḥkhī bhavatvitīṣṭatvam /
duḥkhitvopādhiḥ duḥkhitvaprayojakam /
apipadenādharmādimattvaṃ samuccinoti /
anādaro vinā bādhakena pratītārthaparityāgaḥ /
mā bhūttāvat śrutyavaṣṭambhena vyāptibhaṅgaḥ, sopādhikatayā tu bhaviṣyati /
sopādhikasambandhasya vyabhicāraniyamāditi /


yaḥ sukhī sa duḥkhī bhavatvitīśvarecchāviṣaya eveti niyamānnāyamupādhirityata āha- na ceti //

na cātmaduḥkhitecchā syādata etannivāryate // MAnuv_2,2.155ab //

NYĀYASUDHĀ:
īśvarasya hi"ānandaṃ brahmaṇo vidvān'; ityādiśruteḥ sukhitve 'pi nopādhimattvam /
kasyāpyātmaduḥkhitecchābhāvādata etadupādhervyāpyābhimatavyāpakatvaṃ nivāyarte /
yadyapyayaṃ niyamo na darśanamātreṇa siddhayati /
atiprasaṅgāt /
niyāmakaṃ tu nāstīti vaktuṃ śakyate /
tathāpi śrutyarthaparityāgaṃ vārayituṃ prasaṅgāpādanāyedamuditamiti draṣṭavyam /
bhavedetadyadyānandaśrutiḥ sukhavādinī syānna caitadasti /
tasyā duḥkhābhāvaparatvāditi cet /
kiṃ bādhakādiyaṃ śrutiḥ svārthātpracyāvyate utaivameva /
na tāvaddvitīyaḥ /
duḥkhābhāvaśruterapyanyathayituṃ śakyatvena tarkasyeṣyāpattitāpatteḥ /
ādye na tāvatpratyakṣamāgamo vā bādhako 'sti /
tataḥ sukhitve duḥkhitvaprasaṅgo vā nirduḥkhatvānumānaṃ vā bādhakamiti vācyam /
tadubhayamapi vyaptibalapravṛttaṃ vā syātsahadarśanamātrabalapravṛttaṃ vā /
nādyaḥ /
itaretarāśrayatvaprasaṅgāt /
siddhe hi śruteḥ svārthapracyāvane tarkānumānayorvyāptisiddhistatsiddhau ca śruteḥ svārthātpracyāvanasiddhiriti /


*8,138*

nanvetadbhavatāmapi samānam /
śruteḥ svārthaparatve tarkānumānayorvyāptibhaṅgaḥ, sati ca tasmin śruteḥ svārthaparatvamiti /
maivam /
yataḥ pratītārthaparityāga eva bādhakamapekṣate /
na svārthaparatvaṃ, bādhakābhāvam /
tasya pratītyaiva siddhatvāt /
dvitīye tvatiprasaṅgaḥ syādityāha- saheti //

sahadarśanamātreṇa śrutīnāmapalāpakaḥ // MAnuv_2,2.155cd //
yajñāderapi pāpasya hetutvaṃ hiṃsayā yuteḥ /
nānumāti kathaṃ ... // MAnuv_2,2.156a-c //


NYĀYASUDHĀ:
āpādyena sādhyena vā sahadarśanaṃ yasyāpādakasya sādhanasya vā tatsahadarśanam /
śrutīnām īśvarasyānandavādinīnām apalāpakaḥ svārthapracyāvakaḥ /
yajñāderityādipadena gobhyo yavasadānaṃ gṛhyate /
yuteḥ yogāt /
yadi sahadarśanamātreṇānandaśrutyarthālāpaḥ kriyeta /
tadā yā hiṃsā sā pāpaheturiti sahadarśanena jyotiṣyomādiśrutyarthāpalāpo 'pi kriyatāmaviśeṣāditi bhāvaḥ /


*8,139*

nanvaviśeṣo 'siddhaḥ /
hiṃsātvapāpasādhanatvayoḥ /
sāhacarye niṣiddhatvasyopādheḥ vidyamānatvāt /
naca sukhitvaduḥkhitvasambandhe kaścidupādhirasti /
īśvarasya tatheṣṭatvamupādhistvidānīmapi gaha(naṃ pravi)naniviṣya ityāśaṅkate- tatreti //

... tatra yadyupādhirniṣiddhatā // MAnuv_2,2.156cd //

NYĀYASUDHĀ:
astītyucyata iti śeṣaḥ /


keyaṃ niṣiddhatā nāma /
akartavyatayā śrutyuktatvamiti cet /
keyamakartavyatāpi karaṇānarhatā vā karturaniṣyahetutā vā /
nādyaḥ /
brahmahiṃsāyā api kriyamāṇatvāt /
dvitīye 'pi kiṃ sākṣādaniṣyasādhanatvaṃ paramparayā vā /
nādyaḥ /
hiṃsānantarameva duḥkhotpādādarśanāt /
dvitīye tu pāpasādhanatayoktatvamupādhirityuktaṃ syāt /
evaṃcātrāpyupādhisadbhāvādaviśeṣa eveti pariharati- aduḥkhitveneti //

aduḥkhitvena cānuktiḥ kathaṃ nopādhitāṃ vrajet // MAnuv_2,2.157ab //

NYĀYASUDHĀ:
"aduḥkhitvenānuktiriti'; duḥkhitvenoktirityarthaḥ /
kāsau devadattādīnāṃ śrautī duḥkhitvoktirityata āha- aduḥkhamiti //

aduḥkhamitarat sarvaṃ jīvā eva tu duḥkhinaḥ /
teṣāṃ duḥkhaprahāṇāya śrutireṣā pravartate // MAnuv_2,2.157c-f //
iti śrutir hi paramā ... // MAnuv_2,2.158a //


NYĀYASUDHĀ:
pravartate duḥkhaprahāṇasādhanaṃ paramātmānaṃ pratipādayatītyarthaḥ /


*8,141*

evamanumānānugrāhakaṃ tarkaṃ nirākṛtyedānīmīśvaro na sukhī nirduḥkhatvādghaṭavadityanumānamapi dūṣayati- śrutyuktiriti //

... śrutyuktir yadi kāraṇam /
kiṃ kāryamanumānena gaḷastanasamena hi // MAnuv_2,2.158b-d //


NYĀYASUDHĀ:
kāraṇaṃ pramāyāḥ /
"ānandaṃ brahmaṇo vidvān'; ityādiśrutiḥ pramāṇaṃ na vā /
neti pakṣe apasiddhāntaḥ /
ādye tadbādhitatvenājāgalastana iva vivakṣitārthāsādhakamanumānamupekṣaṇīyamiti bhāvaḥ /

nanu śrutiḥ pramāṇameva kintvanumānaviruddhatvātpratītārthaṃ parityajya duḥkhābhāvaparatayā vyākhyātavyetyāśaṅkaya, naivam, anumānasya śrutibādhakatvādarśanāt /
kvacidupajīvyatvādinaiva bādhakatvāt /
evameva bādhakatvābhyupagame tvatiprasaṅgaḥ syādityāha- anumāneneti //

anumānena yadyarthaḥ śrutidṛṣṭo vyapodyate /
pūrvoktena prakāreṇa neśvaro dharma eva ca /
syāt tatphalaṃ ca ... // MAnuv_2,2.159a-e //


NYĀYASUDHĀ:
pūrvoktena śāstrayonisūtroktena /
neśvaraḥ syāt śrutidṛṣṭo 'pīśvaro 'numānavirodhāttyājyaḥ syāditi bhāvaḥ /
dharmaśca naiva syāttatphalaṃ ca naiva syādityatrāpyevameva tātparyam /
yajñakriyā nādṛṣṭaphalahetuḥ kriyātvānniṣṭhīvanādikriyāvat /
dharmo vā na sukhasādhanamadṛṣṭatvādadharmavadityādyanumānasambhavāt /
atiprasaṅgasya viparyaye paryavasānamāha- teneti //

... tenātra śrutireva pramā bhavet // MAnuv_2,2.159ef //

NYĀYASUDHĀ:
yasmādupajīvyatvādirahitenānumānenānandaśruterbādhābhyupagame 'niṣyaprasaṅgastena kāraṇenaiṣā śrutiratreśvarasyānandavattva eva pramā pramāṇaṃ bhavenna punaranyathā yojyeti /

JOSHI-1


*8,143*

mā bhūt śrutirapramāṇaṃ, mā ca bhūdanumānabādhayār'thāntaraparā, tathāpyanumānasya bādhikā kutaḥ, pratirodhikā tu bhavedityata āha- īśasyeti //

īśasyānumayā siddheḥ śrutirdhamirpramā bhavet /
tayā sarvaguṇaiḥ pūrṇa ukta īśo yatastataḥ // MAnuv_2,2.160 //
anānandānumā tasya dharmigrāhivirodhataḥ /
na pramāṇaṃ bhavet ... // MAnuv_2,2.161a-c //


NYĀYASUDHĀ:
anumayeti śrutivyatiriktapramāṇopalakṣaṇam /
dharmipramā dharmigrāhakaṃ pramāṇam /
anumānaṃ hi pramāṇāntareṇa siddhe dharmiṇi pravartate nānyathā /
atra ceśvaro dharmī na cāsāvanumānena siddhayatīti samarthitaṃ prāk /
pratyakṣādyaviṣayatvaṃ tu parasyāpi sammatam /
tataḥ pariśeṣāt śrutireva dharmiṇaḥ parameśvarasya grāhiketyeṣyavyam /
tathācānenānumānena śrutiprāmāṇyamanumatam /
anyathā svasyānutthānaprasaṅgāt /
sā copajīvyā śrutirīśvaramānandavantamācaṣṭe /
tatastadvirodhādanumānamapramāṇameva /
agnisvarūpagrāhakapratyakṣaviruddhatacchaityānumānavaditi /
naca vācyaṃ yaḥ sarvajña ityādivākyamanumānasyopajīvyaṃ nānandavādīti /
sarvasyāpi vedasyaikavākyatvenārdha(ja)caratīyāyogāt /
anyathāgnigrāhakamevopajīvyam /
natu tadauṣṇyagrāhakamityapi syāt /


*8,144*

anenaiva nyāyeneśvarasya vigraharāhityādyanumānamapi sarvaṃ śrutiviruddhatvādapramāṇamevetyāśayavānupasaṃharati- tasmāditi //

... tasmānnānumātropayoginī // MAnuv_2,2.161d //

NYĀYASUDHĀ:
atra īśvaravākye /
ata eva sarvaguṇaiḥ pūrṇa ityuktam anyathā'nandavānityavakṣyat /


*8,145*

anupapattyantaraṃ vaiśeṣikādidarśane darśayan"nityameva ca bhāvāt'; iti sūtraṃ vyākhyāti- nityecchatvāditi //

nityecchatvāt pareśasya paramāṇusadātvataḥ /
adṛṣṭakālayoścaiva bhāvāt kāryaṃ sadā bhavet // MAnuv_2,2.162 //



*8,145f.*

NYĀYASUDHĀ:
vaiśeṣikādayo hi kālaviśeṣe dvayaṇukādiprakrameṇa mahābhūtasṛṣṭimabhyupagacchanti /
tattadīyaprakriyāparyālocanāyāṃ nopapadyate /
kintu tatpakṣe kāryaṃ sadā bhavet /
yadābhilaṣṭate tataḥ prāgapi bhavet /
kutaḥ /
kāraṇasāmagrīsampattinibandhano hi kāryotpatteḥ kālaniyamaḥ /
tatrādisṛṣṭau paramāṇavaḥ samavāyikāraṇabhūtāstāvatsadā vidyante /
nimittakāraṇaṃ ceśvarecchā nityaiva /
tathā kālo di(kca)k /
yadyapyadṛṣṭaṃ dharmādharmasamākhyātaṃ na nityaṃ tathāpi pralaye 'stītyaṅgīkriyata eva /
vṛttilābhastadā nāstīti cenna /
tasyāpīśvarecchādikāraṇakasya tadbhāve 'bhāvānupapatteḥ /
ata eva paramāṇusaṃyogasyāsamavāyikāraṇasyābhāvānna sadā sṛ(sadādisṛ)(mahadādisṛ)ṣyiriti nirastam /
saṃyogānutpādasyāpyanupapatteḥ /
tadasamavāyikāraṇakarmābhāvāditi cenna /
tadanutpādasyāpyayogāt /
nacāto 'nyadvayaṇukādeḥ kāraṇamasti /
yadvaikalyādabhilaṣitasamayātprāk kāryābhāvo bhavet /
satyāṃ cābhimatasāmagṣāṃ kāryānudaye paścādapi notpadyeta /
niyāmakābhāvāditi /
sadātvaṃ sadātatvanam /
bhāvāt pralaye 'pīti śeṣaḥ /
evaśabdasya sadaiveti sambandhaḥ /
kāryaṃ bhavediti cābhyupagamyoktam /
vastutastu tatpakṣe kadāpi dvayaṇukādyutpattirna sambhavati /
vināśakāraṇasyeśvarecchādeḥ sadātanatvena satpratipakṣatvāt /
kāryotpattisahakṛtameveśvarecchādikaṃ vināśakāraṇamityaṅgīkāre 'pyutpattyanantarameva vināśaḥ prasajyeteti /
ata eva sṛṣṭayādīti vakṣyati /


*8,147*

syādevaṃ yadi kālamātraṃ sṛṣṭervā saṃhārasya vā kāraṇaṃ syāt /
nacaivam /
kintu kālaviśeṣa evātastadbhāvābhāvābhyāṃ sṛṣṭisaṃhāraniyamo ghaṭate /
tathā neśvarecchāmātraṃ sṛṣṭayādihetuḥ kintu tadviśeṣa eva tatastadbhāvābhāvaprayuktā sṛṣṭayādivyavasthā syāditi cenna /
kiṃ kāladeśāderaupādhiko bhedaḥ, kiṃvā svābhāvikaḥ /
nādyaḥ /
nirastatvāt /
dvitīye tvapasiddhānta ityāha- nahīti //

na hi kālavibhedo 'sti tatpakṣe ... // MAnuv_2,2.163ab //

NYĀYASUDHĀ:
hiśabdena"ākāśakāladiśāmekaikatvāt'; ityāditadvākyaṃ smārayati /
kāletīśvarecchāyā apyupalakṣaṇam /


*8,148*

nanvidaṃ dūṣaṇaṃ bhavatāmapi samānam /
tathāhi /
mahadādyupādānakāraṇaṃ prakṛtirnityaiva /
tathā nimittakāraṇamīśvarecchākālādikamapi /
tadeva ca pralayakāraṇam /
ataḥ sṛṣṭipralayasamayaniyamo bhavatāmapi durghaṭa ityata āha- asmanmata iti //

... 'smanmate hareḥ /
viśeṣakāla evaitatsṛṣṭayādīcchā sadātanā // MAnuv_2,2.163b-d //


NYĀYASUDHĀ:
yadyapyasmanmate harericchā sadātanā /
prakṛtyādyupalakṣaṇametat /
tathāpi viśeṣakāla evaitasya mahadādeḥ sṛṣṭayādi bhavatīti yojanā /
asmābhiḥ kāle svabhāvata eva bhedo 'bhyupagamyate /
tathā ca kālaviśeṣasyaiva sṛṣṭiṃ saṃhāraṃ ca kāraṇatvāttadbhāvābhāvābhyāṃ satsvapītarakāraṇeṣu sṛṣṭayādisamayaniyamo yujyata iti bhāvaḥ /

nanu kālaviśeṣa iti vācyam /
maivam /
viśiṣṭata iti viśeṣaḥ, sa cāsau kālaśceti vigrahagrahaṇāt /
nanu sadātanīti bhavitavyam /
maivam /
nāyaṃ ṭyuṭyuloranyarataḥ pratyayaḥ /
kintu bha(bhā)vārthe tanapratyayo 'yam /
athavā taneti tanote rūpametat /


*8,149*

nanu te kālabhedā yadi nityāstadā sa prasaṅgastadavasthaḥ /
vyarthaśca kālabhedābhyupagamaḥ /
anityatve tatkāraṇaṃ vācyamiti cet /
satyam /
upādānaṃ tu prakṛtireva /
nimittamāha- viśeṣāśceti //


*8,150*

viśeṣāścaiva kālasya harericchāvaśāḥ sadā // MAnuv_2,2.164ab //
NYĀYASUDHĀ:
na kevalaṃ mahadādi kintu kālasya viśeṣāśca kṣaṇalavādayaḥ /
evaśabdasya harereveti sambandhaḥ /
sadetyanena na yugapatsarvakṣaṇasṛṣṭiryena teṣāmapi kṣaṇikatvaṃ syāt /
kintu nirantarapravāhatayetyuktaṃ bhavati /


*8,152*

nanu kālaviśeṣāṇāṃ parameśvarājjanma kutaḥ pramāṇātsiddhamityata āha- sarva iti //

sarve nimeṣā iti hi śrutirevāha sādaram // MAnuv_2,2.164cd //

NYĀYASUDHĀ:
"sarve nimeṣā jajñire vidyutaḥ puruṣādadhi'; iti śrutireva kālaviśeṣāṇāmīśvarājjanimāha hi ityarthaḥ /
viśeṣaṇadyotata iti vidyuttasmātparamapuruṣātsarve nimeṣāḥ kālabhedā adhijajñire yatāsvaṃ jāyanta iti /
nanveṣā śrutiḥ kālopādhīnāmīśvarājjananamāha, natu kālasya /
tathā sati kāṣṭhākalāmuhartāścetyuttaravākyasya paunaruktyaprasaṅgāt /
nahi sarvanimeṣātiriktaṃ kāṣṭhākalādikamasti /
upādhayastu nimeṣādirūpāḥ pṛthageveti na tatra punaruktidoṣa ityata uktam- sādaramiti //
yatsarvanimeṣajanmābhidhāya punaḥ kāṣṭhādijanmābhidhatte tadādarārthamityato na punaruktidoṣaḥ /
upādhibhedastu nopapadyata ityuktameveti /


*8,155*

nanu nimeṣādiśabdā akṣipakṣmasaṃyogādivācino na sākṣātkālābhidhāyinaḥ /
ato neyaṃ śrutirvyaktaṃ kālasyaiveśvarājjanma pratipādayitumalamityato 'tra spaṣṭāṃ śrutiṃ cāha- udīrayatīti //

udīrayati kālākhyaśaktimityasya vāgapi // MAnuv_2,2.165ab //

NYĀYASUDHĀ:
"so 'ntaḥśarīre 'rpitabhūtasūkṣmaḥ kālātmikāṃ śaktimudīrayāṇaḥ'; iti asya īśvarasya vāgapi kālasyeśvarādutpattimāhetyarthaḥ /
kālātmikāṃ kālākhyāṃ sahakāriśaktimudīrayāṇo janayannityarthaḥ /
atra kālaśabdādīśvarasya jagatsṛṣṭau śaktitvābhidhānācca nārthāntarakalpanāvakāśaḥ /


*8,156*

syādetat /
kālastāvatsarvotpattimatāṃ nimittam /
naca kālasyotpattau kālāntaramasti /
tatkathaṃ tasyopapattiḥ /
pūrvakālaḥ parakālasya nimittamiti cenna /
idānīṃ jātastadānīṃ jāta ityadhikaraṇatayā kālasya kāraṇatāvadhāraṇāt /
adhikaraṇasya kāryotpattisamānakālīnatāyā gehe jāto goṣṭhe jāta ityādau niścitatvādityata āha- kālasyeti //

kālasya kālagatvena na virodho 'pi kaścana // MAnuv_2,2.165cd //

NYĀYASUDHĀ:
kālasyotpattyaṅgīkāre na kevalaṃ sādhakasadbhāvaḥ /
kintu kaścana virodho 'pi nāstīti yojanā /
etacca prapañcayiṣyate /


evaṃ svamate kālaviśeṣabhāvābhāvaprayuktaḥ sṛṣṭayādeḥ samayaniyama iti samarthitam /
prakārāntareṇa taṃ samarthayate- asaṅkhayāteti //

asaṅkhayātaviśeṣatvādicchāyā api sarvadā // MAnuv_2,2.166ab //


*8,156f.*

NYĀYASUDHĀ:
sarvadā vidyamānāyā iti śeṣaḥ /
sarvadā vidyamānāyā apīśvarecchayāḥ śaktivyaktirūpāvasthitasisṛkṣātvādyasaṅkhayātaviśeṣa(vattvā)tvāt tadvayaktyavyaktiprayuktaḥ sṛṣṭayādeḥ samaniyamo yujyata ityarthaḥ /
yadyapi kālabhedamātreṇa kṛtasamādhānametat /
kālaviśeṣe srakṣyāmītyevaṃrūpatvādbhagavadicchāyā na moghatvamāpadyate /
tathāpi vastusthitiriyaṃ darśitā veditavyā /


*8,157*

kālasya kālagatvenetyuktaṃ, tatra kiṃ kālaḥ svagataḥ kiṃ vā kālāntaragataḥ /
nādyaḥ /
svaskandhārohaṇavadviruddhatvāt /
na dvitīyaḥ /
tadabhāvāt /
bhāve vā kālāntarasṛṣṭivaiyarthyāt /
tasyāpyutpattau kālāntarāṅgīkāraprasaṅgādityataḥ sapramāṇakamuktaṃ vivṛṇoti- īśa iti //

īśo deśaś ca kālaś ca svagatā eva sarvadā // MAnuv_2,2.166cd //

NYĀYASUDHĀ:
deśa ityavyākṛtākāśābhidhānam /


svagatā ityuktyā prāptāṃ deśakālayoḥ svātantryaśaṅkāṃ vārayati- īśādhīnāviti //


*8,158*

īśādhīnau ca tau nityaṃ tadādhārau ca tadgatau /
iti śrutirapi prāha kāle svoddiṣṭa eva tu // MAnuv_2,2.167 //
tatkālasṛṣṭimevāto vāñchatīśaḥ sadaiva hi /
syāt kālaḥ sa tadaiveti kālasya svagatatvataḥ // MAnuv_2,2.168 //


NYĀYASUDHĀ:
viśeṣaṇamātreṇa sattāpratītipravṛttīnāṃ parameśvarāyattatvamucyate /
śrutirapīti sākṣiṇaṃ samuccinoti /
yataḥ kālasya svagatatvaṃ śrutiḥ prāha sākṣiṇā ca siddham /
ataḥ kālasya svagatatvataḥ /
sa kālastadaiva syāditīśaḥ sadaiva svoddiṣya eva kāle /
tattatkālasṛṣṭimeva vāñchatītyanvayaḥ /


*8,158f.*

etaduktaṃ bhavati /
kālātiriktakāryāṇāmeva kālo 'dhikaraṇatayā kāraṇaṃ na kālasya /
kevalaṃ śvo ghaṭaṃ sraṣṭāsmītivatkālasṛṣṭiṃ vāñchataḥ parameśvarasyādhikaraṇatayoddeśyaḥ kālaḥ ka iti praśno 'vaśiṣyate /
tatra yaḥ sṛjyaḥ sa evetyuttaram /
nahi sṛjyasya prāk sattvamasti /
yenoddeśyatvaṃ sattvamapekṣeta /
adhikaraṇādhikartavyatā caikasyaiva śrutyādisiddhā viśeṣabalāccopapadyate /
ato na kālasyotpattau kācidanupapattiriti /


*8,160*

yaduktaṃ yadeśvarecchā sisṛkṣākārā vyajyate tadā mahadādisṛṣṭibharvati /
yadā tu sañjihīrṣārūpā sampadyate tadā saṃhāro bhavatīti /
tatredaṃ vaicitryaṃ kinnimittamiti vācyam /
naca kālaviśeṣo nimittamiti yuktam /
tasyeśvarecchāyattatvāt /
nāpi puruṣārthāyattam /
pāratantryāpatterityata āha- svabhāvādeveti //

svabhāvādeva hīcchaiṣā ... // MAnuv_2,2.169a //

NYĀYASUDHĀ:
eṣā vicitrā /
tasmātkālaviśeṣāṇāmīśvarādhīnatve netaretarāśrayadoṣāpattiriti hiśabdārthaḥ /
kuta etadityata āha- devasyeti //

... devasyaiva iti śruteḥ // MAnuv_2,2.169b //

NYĀYASUDHĀ:
etadavagamyata iti śeṣaḥ /


*8,161*

apara āha /
kimanayā kālādivaicitryakalpanayā /
yāvatā kāraṇānāṃ kāryāṇāṃ ca svabhāvādeva samayaniyamopapatteḥ /
antato 'pi hi svabhāvavādo 'bhyupagantavyaḥ /
tato varamādāveva svabhāvavādābhyupagama iti /
ata āha- svabhāvo 'pīti //

svabhāvo 'pi pareśecchāvaśa ityuditaḥ purā // MAnuv_2,2.169cd //

NYĀYASUDHĀ:
purā"cetanānāṃ viśeṣo yaḥ'; ityādau /
svabhāvavādamabhyupagacchatāpi tanniyāmakatayeśvaro aṅgīkāryaḥ /
tatastatraikatraiva svabhāvānusaraṇe pramāṇāyatte 'ṅgīkārye kimanekatra tadabhyupagameneti bhāvaḥ /


na kevalaṃ pūrvoktameva pramāṇaṃ smartavyam /
kintu pramāṇāntaramapyastītyāha- nityā iti //

nityā anityāśca tatastadadhīnā iti śrutiḥ // MAnuv_2,2.170ab //

NYĀYASUDHĀ:
tata ityasya śrutāveva parāmarśaviṣayo draṣṭavyaḥ /
śrutiḥ sarvasyeśvarādhīnatāmāheti śeṣaḥ /


*8,162*

anupapattyantaraṃ vaiśeṣikādimate darśayan, //
oṃ rūpādimattvācca viparyayo darśanāt oṃ //
oṃ ubhayathā ca doṣāt oṃ //
iti sūtradvayaṃ vyācaṣṭe- rūpeti //

rūpādimattvāc ca viparyayo darśanāt | BBs_2,2.15 |
ubhayathā ca doṣāt | BBs_2,2.16 |


rūpasparśādihetubhyaḥ paramāṇoranityatā // MAnuv_2,2.170cd //
anumeyā ... // MAnuv_2,2.171a //


NYĀYASUDHĀ:
paramāṇoriti jātyapekṣamekavacanam /
pārthivādīnāṃ caturvidhānāṃ paramāṇūnāṃ nityatāmupayānti vaiśeṣikādayaḥ /
tadanupapannam /
pāthirvāḥ pāthasīyāstaijasāśca paramāṇavo 'nityā rūpavattvātpaṭavat /
yadvā caturvidhā apyanityāḥ sparśavattvātpaṭavat /
evaṃ pārthitavā āpyāścānityā rasavattvātpaṭavat /
pārthivā anityā gandhavattvāttadvadevetyādyanumānaviruddhatvāt /
naca sāvayavatvamupādhiḥ /
guṇādau sādhyāvyāpteḥ /
naca dravyatvāvacchinne sādhye 'syopādhitvam /
yadrūpādimattatsāvayavamiti sādhanavyāpakatvāt /
naca dharmigrāhakavirodhaḥ /
sākṣiṇaiva paramāṇusiddheruktatvāt /
anityatve ca paramāṇūnāṃ na mūlakāraṇatvasiddhiḥ /
yadi ca rūpādimanto 'pi paramāṇavo nānityāstadā ghaṭādayo 'pyanityā na syuraviśeṣāt /
tathā(ca)pi na paramāṇūnāṃ mūlakāraṇatvam /
naceśvare hetūnāṃ vyabhicāraḥ /
bhautikatvena viśeṣaṇāt /
tathāca vakṣyati /
"bhautikaṃ tveva rūpādi vyāptaṃ nāśena no mate'; /
iti /


*8,164*

nanvasmābhirbhūtasūkṣmāṇāṃ nityatāṅgīkriyate /
tatkathamevamanumīyate /
maivam /
nahi paramāṇavo bhūtasūkṣmāṇi, kinnāmāhaṃ(kāro)mātropacitāni /
vikṛtākārāśca anityā eveti /


*8,165*

aparigrahāc cātyantam anapekṣā | BBs_2,2.17 |

// oṃ aparigrahāccātyantamanapekṣā oṃ //

iti sūtraṃ vyācaṣṭe- śrītīnāṃ ceti //

... śrutīnāṃ ca viruddhatvānna tanmatam /
upādeyamataścāyamaviruddhaḥ samanvayaḥ // MAnuv_2,2.171 //


NYĀYASUDHĀ:
sambandhamātre ṣaṣṭhī /
anyathā tṛtīyā syāt /
śrutayaśca"ātmana ākāśaḥ'; ityādyāstatra tatrodāhṛtā jñātavyāḥ /
vaiśeṣikādimatasyānupādeyatve siddhe kiṃ labdhamityata āha- ataśceti //
ayaṃ sakalaguṇapūrṇaparabrahmaviṣayaḥ /
aviruddha iti na vaiśeṣikāsidamatavirodenāsamañjaso mantavya iti bhāvaḥ /
// iti śrīmannyāyasudhāyāṃ vaiśeṣikādhikaraṇam //


___________________________________________________________________________


*8,166*


[======= JNys_2,2.VII: samudāyādhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ samudāyādhikaraṇam //


samudāya ubhayahetuke 'pi tadaprāptiḥ | BBs_2,2.18 |

// oṃ samudāya ubhayahetuke 'pi tadaprāptiḥ oṃ //

athedānīṃ saugatamatamapākriyate /
te ca caturvidhāḥ /
vaibhāṣikāḥ sautrāntikā mādhyamikā yogācārāśceti /
tatra jagatsatyameva paramāṇumayamācakṣāṇānāṃ vaiśeṣikādīnāṃ nirasanaprasaṅgādanatibhedaṃ vaibhāṣikasautrāntikamatamādau tāvannirākriyate /
vipratipattiṃ darśayaṃstanmatamupanyasyati- vaibhāṣikāśceti //

vaibhāṣikāśca sautrāntāḥ svarasakṣaṇikaṃ jagat // MAnuv_2,2.172ab //

NYĀYASUDHĀ:
āhuriti vakṣyamāṇena sambandhaḥ /
kṣaṇikaṃ kṣaṇamātrāvasthāyi /
mudgarābhighātādīnāṃ vināśahetūnāṃ pratikṣaṇamanupalambhātkathaṃ kṣaṇabhaṅgitvamityata uktam- svaraseti //
svabhāvenaiva kṣaṇikaṃ svabhāva evāyaṃ vastuno yadvināśitvam /
tatra kā kāraṇāpekṣā /
mudgarādayo 'pi na vastuvināśahetavaḥ /
kinnāma ghaṭāditaḥ kapālādervisadṛśakāryasyotpattau nimittabhūtā eveti /


*8,169*

nanu ca kāraṇānāṃ kriyayā saṃyoge sati tatsamavetatayā tatpariṇāmatayā vā kāryeṇotpattavyam /

tatkāryeṇāpyevamiti kathaṃ kṣaṇikatvaṃ jagata ityata āha- aṇūnāmiti //

aṇūnāṃ samudāyaṃ ca ... // MAnuv_2,2.172c //

NYĀYASUDHĀ:
jagadāhuḥ /
aṇusamudāyā eva goghaṭādibodhabodhyāḥ /
natu tadatirikto 'vayavī nāmāsti /
yena kṣaṇikatā virudhyeta /
aṇumātramiti vaktavye samudāyagrahaṇameko mahāniti pratyakṣapratyayavirodhaparihārārtham /
pratyekamaṇūnāmapratyakṣatve 'nekatve 'mahattve 'pi tatsamudāyasya pratyakṣatvādi yujyata iti bhāvaḥ /

samudāyo hi melakena (kenacit) puṃsā bhavati /
nacāsmadādistathetīśvaro 'bhyupagantavyaḥ syāt /
tathāvayavyanabhyupagame goghaṭādivilakṣaṇākāratā na syādityata āha- kāleti //

... ca kālakarmanimittataḥ // MAnuv_2,2.172d //
utpattikāle yuktānām ... // MAnuv_2,2.173a //



*8,170*

NYĀYASUDHĀ:
kālakarmaṇī ca te nimitte ca tataḥ /
utpattikāle ādisṛṣṭau /
anyadā tu nimittāntaramastīti bhāvaḥ /
yuktānāṃ sannikṛṣṭatayotpannānāmaṇūnāṃ samudāyamiti sambandhaḥ /
karmādivaśādeva tathā tathā sannikṛṣṭāḥ paramāṇavo jāyante /
yatā yathā goghaṭādivicitrākārāvabhāsaḥ syāt /
tatra kimīśvareṇa /
kiṃ vāvayavinā /
siddhāntināpi hi karmādikaṃ nimittamaṅgīkartavyam /
saṃyogaścāvayavyutpādānuguṇaḥ /
tāvataiva sarvamupapadyata itrata /


*8,171*

kimanātmaprapañca eva kṣaṇiko netyāha- ātmānamiti //

... ātmānaṃ ca kṣaṇasthitim // MAnuv_2,2.173b //

NYĀYASUDHĀ:
kṣaṇikatvahetoḥ sattvasya sarvatra sāmyāditi bhāvaḥ /
kṣaṇikatve pratyabhijñāvirodha ityata āha- nityamiti //

nityaṃ santānameteṣāṃ ... // MAnuv_2,2.173c //

NYĀYASUDHĀ:
eteṣāṃ aṇūnām /
santāviṣayā pratyabhijñeti bhāvaḥ /
nacaivaṃ sattvasyānaikāntyāt /
santānasya sattvābhāvāt /


*8,172*

evaṃ sāmānyato nirūpya vibhāgamāha- pañceti //

.... pañcaskandhātmanā sthitam // MAnuv_2,2.173d //

NYĀYASUDHĀ:
jagadvṛkṣaṃ pañcaskandhātmanā sthitamāhuḥ /
pañcaskandhānāha- saṃskāreti //

saṃskārarūpavijñānasañjñāduḥkhātmanā sthitiḥ // MAnuv_2,2.174ab //

NYĀYASUDHĀ:
sthitiḥ skandhānāmiti śeṣaḥ /
samanantarapratyayaḥ saṃskāraskandhaḥ /
rūparasagandhasparśaśabdātmakāḥ paramāṇavo rūpaskandhaḥ /
nirvikalpakaṃ jñānaṃ vijñānaskandhaḥ /
savikalpakaṃ jñānaṃ saṃjñāskandhaḥ /
vedanāparaparyāyaṃ duḥkhaṃ caikaskandhaḥ /
atra rūpaskandho bāhyaḥ /
anye catvāra ābhyantarā ityāhuriti sambandhaḥ /


*8,173*

sukhādīnāṃ padārthāntareṇa vidyamānatvātkathaṃ pañcaiva skandhā ityata āha- duḥkhābhāvāditi //

duḥkhābhāvaṃ sukhaṃ cāhur ... // MAnuv_2,2.174c //


*8,174*

NYĀYASUDHĀ:
caśabdena kecitsukhaṃ vedanāskandhe 'ntarbhāvayantīti sūcitaṃ bhavati /
yadvānuktasamuccayārthaścaśabdaḥ /
yathā mūrtābhāva evākāśaṃ, rūpādaya eva pṛthivyādyāḥ, saṅkhayādayastu guṇāḥ pṛthaganupalambhānna santyeva /
deśāntarotpāda eva karmapratyayālambanam /
kṣaṇikasya vāstavakarmāyogāt /
sannikṛṣṭaviprakṛṣṭatayotpāda eva saṃyogādivyavahāragocaraḥ /
atadvayāvṛttireva gotvādisāmānyabuddhibodhyetyādi /

... arūpajñānasantatim // MAnuv_2,2.174d //
mokṣaṃ ... // MAnuv_2,2.175a //


NYĀYASUDHĀ:
arūpeti /
santanyamānaṃ jñānamevātmā tasya viṣayopaplavaḥ saṃsāraḥ /
arūpā nirviṣayā yā jñānasantatistāmeve mokṣamāhurnānyamityato na pañcaskandhaprakriyābhaṅga iti /


*8,175*

evaṃ vaibhāṣikasautrāntikayoḥ sādhāraṇaṃ matamupanyasyāvāntarabhedaṃ tu nirākaraṇaprastāva eva vivakṣuryattāvaduktaṃ paramāṇusamudāya eva goghaṭādiprapañco na tvavayavī kaścidastīti tannirākartuṃ samudāya ubhayahetuke 'pi tadaprāptiriti sūtraṃ vyācaṣṭe- sa iti //

... sa samudāyo hi naikasmādeva yujyate // MAnuv_2,2.175ab //

NYĀYASUDHĀ:
yo 'yaṃ goghaṭādibuddhiviṣayatvenābhyupagataḥ samudāyaḥ sa kimekaparamāṇuhetukaḥ, kiṃvā anekaparamāṇuhetukaḥ /

nādyaḥ /
ekasmātparamāṇoḥ samudāyotpādānupapatteḥ /
na hyekaikasmiṃstarau tarusamudāyabuddhiḥ kasyāpi vidyate /
samudāyakalpanaṃ vānarthakamāpadyeta /
mahattvaindriyakatvayorasamarthitatvāt /
anena apiśabdalabdho 'rtho darśitaḥ /

dvitīyaṃ nirākaroti- neti //

nobhayośco- ... // MAnuv_2,2.175c //

NYĀYASUDHĀ:
ubhayagrahaṇamanekamātropalakṣaṇam /
sakāśāditi śeṣaḥ /
caśabdena samudāyo yujyata ityanukṛṣṭate /

kuto na yujyata iti cet /
anekahetukatve 'pi kimasamuditānekahetuko 'tha samuditānekahetuka iti vaktavyam /
ādye sarvatra(trāpi)goghaṭādibuddhiprasaktiḥ /
asamuditaparamāṇūnāṃ sarvatra bhāvāt /
samudāyasya ca tanmātrahetukatvāt /
samudāyāṅgīkāravaiyathyarprasaṅgaśca /
dvitīyānupapattau hetumāha- ubhayatvamiti //

... ścobhayatvaṃ yat samudāyavyapekṣayā // MAnuv_2,2.175cd //

NYĀYASUDHĀ:
yadyasmādubhayatvaṃ samuditānekatvaṃ samudāyasāpekṣam /
jāte hi samudāye 'nekeṣāṃ samuditatvaṃ (saṃ)bhavati /
tasmānneti sambandhaḥ /


*8,177*

samuditānekatvasya samudāyasāpekṣatve 'pi kutastataḥ samudāyotpādo na yujyata ityāśaṅkāṃ pariharatsūtrārthamupasaṃharati- ata iti //

ato 'nyonyāśrayatvena samudāyo na yujyate // MAnuv_2,2.176ab //

NYĀYASUDHĀ:
samudāyasya samuditānekeṣāṃ cetaretarāpekṣotpattikatvenetyarthaḥ /
samudāyānu(tpattau) cāṇūnāṃ mahāneka iti pratyakṣabuddhigocaratāyogādavaśyamaṅgīkaraṇīyo 'vayavīti /
kiñcāyaṃ samudāyaḥ kiṃ paramāṇūnāṃ saṃyogaḥ kiṃvānekatvasaṅkhayā /
uta dravyāntaram /
nādyadvitīyau /
anaṅgīkārāt /
aṅgīkāre 'pyatīndriyāśritayostayoraindriyakatvānupapattiḥ /
tṛtīye sa evāvayavī /
sāṃvṛto 'sāviti cet /
tarhi punarmahānityādipramānupapattistadavasthaiva /
bhrāntiriyamiti cet(na) /
bhrānterabhrāntipūrvakatvena kvacinmahattvādervāstavattvaprasaṅgāt /
anādivāsanāvaśādānādireveyaṃ bhrāntiriti cenna /
nīlādijñānasyāpi tathātvaprasaṅgāt /


*8,179*

nanu viṣamamidamucyate /
avayavini bādhakasadbhāvāt /
tathāhi /
avayavī kimavayaveṣu pratyekaṃ kārtsyena vartate /
kiṃ vaikadeśena /
ādye 'nekatvaprasaṅgaḥ /
na dvitīyaḥ /
tasyāvayavānvihāyaikadeśābhāvāt /
bhāve vā(ta) atrāpi vṛttivikalpaprasaṅgāt /

kiñca keṣucittantuṣu calatsu tadgato 'vayavī calati na vā /
neti pakṣe yutasiddhiprasaṅgaḥ /
ādye tu niścalāvayavāśrito na calatīti calācalatvalakṣaṇo viruddhadharmādhyāsaḥ /
evamāvṛttānāvṛtatvaraktāraktatvalakṣaṇāvapi viruddhadharmādhyāsau draṣṭavyāviti /

ucyate /
nāsmābhiravayavebhyo 'tyantabhinno 'vayavī gṛhyate /
kintu tatpariṇāmaviśeṣa eva /
tatra kuto vṛttivikalpāvakāśaḥ /
calācalatvādivirodhastu bhedābheda(dādi)virodhavadapākriyata iti nāvayavini bādhakasadbhāvaḥ /
naca vācyaṃ samudāyo bhavadbhiraṅgī(kriya)kṛta eva ta(taśca)trākṣepasamādhānasāmyamiti /
yato 'nekeṣāmekakāladeśakāryādyavacchedena melanaṃ samudāyo 'bhyupagamyate /
sa cāmilitebhya eva bhava(tī)ti /
sthāyitānāṃ ca tatsambhavo na kṣaṇabhaṅgavāda iti vakṣyati /


*8,181*

uktamarthamākṣipya samādadhatsūtram oṃ itaretarapratyayatvāditi cennotpattimātranimittatvāt oṃ //
iti /
tatrākṣepāṃśaṃ tāvadvayācaṣṭe- anyonyeti //

itaretarapratyayatvād iti cen notpattimātranimittatvāt | BBs_2,2.19 |

anyonyāpekṣayā puṃsaḥ samudāyatvavedanam // MAnuv_2,2.176cd //
syāt tatsadātanatve 'pi tacca sāmīpyahetukam /
iti cet ... // MAnuv_2,2.177a-c //


NYĀYASUDHĀ:
bhavedidamanyonyāśrayatvaṃ yadyayaṃ samudāyaḥ kādācitkaḥ syāt /
nacaivam /
sadātanaṃ tvimamabhyupagacchāmaḥ /
evaṃ tarhi sṛṣṭipralayavyavasthā na syāditi cenna /
yatastasya samudāyasya sadātanatve 'pi puṃsaḥ samudāyatvavedanaṃ syāt /
kadāciditi śeṣaḥ /
tatastadapekṣayā sṛṣṭayādivvayasthopapadyata iti bhāvaḥ /
samudāyasya sadātanatve tadvedanamapi kutaḥ kādācitkamityata uktam- tacceti //
tatsamudāyatvavedanaṃ paramāṇusāmīpyahetukam /
naca sāmīpyaṃ sadāstīti vedanasya kādācitkatvamiti /
samudāyatvavedanasya sāmīpyahetukatā kuta ityata (uktaṃ) āha- anyonyeti //
anyonyaparamāṇujñānāpekṣayā hi tadbhavati /
nacānyonyajñānaṃ sāmīpyena vinā bhavatīti /

nanu vedanameva pumāniti saugatā manyante /
tatkathaṃ puṃso vedanamiti /
ucyate /
jñānaṃ hi dvividhaṃ bhavati /
pravṛttijñānamālayajñānaṃ ceti /
tatrālayajñānaṃ pravṛttijñānaduḥkhasaṃskārāspadaṃ pumānityucyate /
pravṛttijñānaṃ tu samudāyatvavedanamiti na virodhaḥ /

etaduktaṃ bhavati /
aneke paramāṇava eva samudāyaḥ /
tadanekatvaṃ ca samudāyatvam /
tanmiliteṣviva viraleṣvapi vidyate /
kintu na sadā samudāyatvavedanaṃ bhavati /
itaraparamāṇusahitetaraparamāṇusahitetaraparamāṇujñāne sati hi samudāyatvajñānaṃ bhavati /
apekṣābuddheranekatvavyañjakatvāt /
nacetaretaraparamāṇujñāne sati hi samudāyatvajñānaṃ bhavati /
apekṣābuddheranekatvavyañjakatvāt /
nacetaretaraparamāṇujñāne sati hi samudāyatvajñānaṃ bhavati /
ma(thu)dhurāpāṭalīputrasthitayorvṛkṣayoritaretarapratyayo dṛṣṭaḥ /
kiñcādhipatisahakāryālambanasamanantarapratyayāścatvāro hi jñānahetavaḥ /
adhipatirindriyam /
naca viralānāṃ paramāṇūnāmindriyālambanaviralaparamāṇubhyastadālambanatayā tathātathā sannikṛṣṭāḥ paramāṇavo jāyante /
anadhipatīndriyebhyaścādhipatīndriyāṇi /
athedānīṃ samanantarapratyayabalādeko mahāniti jñānamutpadyate /
tena nānyonyāśrayatvam /
nāpi sṛṣṭayādyanupapattiriti /
etena pakṣāntaramapi sūcitam /
viralaparamāṇubhyaḥ sannikṛṣṭāḥ paramāṇavo jāyante /
tadeva teṣāṃ samudāyatvam /
ato na kaściddoṣa iti /


*8,185*

samādhānāṃśaṃ vyācaṣṭe- kāryeti //
... kāryasambhūtimātravyāpṛtikāraṇam // MAnuv_2,2.177cd //
natu kāryaviśeṣeṣu vyāpṛtaṃ kāraṇaṃ bhavet // MAnuv_2,2.178ab //


NYĀYASUDHĀ:
kāryasambhūtimātre vyāpṛtiryasya tattathoktaṃ kāraṇaṃ kāryasambhūtimātravyāpṛtiḥ yatastato neti śeṣaḥ /
yathānutametanna parihārakṣamam ato 'bhiprāyamāha- na tviti //

viśiṣṭanta iti viśeṣāḥ /
kāryāṇyeva viśeṣāḥ kāryaviśeṣāḥ /
kāraṇamiti jātāvekavacanam /
kāraṇāni khalu svasadṛśakāryajananavyāpārāṇi /
natu visadṛśakāryajanane vyāpṛtānītyarthaḥ /


kimato yadyevamityata āha- ata iti //


*8,186*

ato 'rthendriyasaṃyogirūpakāraṇatātmanaḥ /
saṃyogirūparāhityānnaiva tajjñānatāpi hi // MAnuv_2,2.178c-f //


NYĀYASUDHĀ:
sadṛśakāryajanakatvaniyamādityarthaḥ /
saṃyogirūpe grāhyagrāhakarūpe ye arthendriye tayoḥ kāryayoḥ kāraṇatā saṃyogirūpakāraṇatā /
arthendriyayoḥ saṃyogirūpakāraṇatā (arthendriyasaṃyogirūpakāraṇatā / ) sā naivopapadyate /
kutaḥ /
hi yasmātkāraṇasyātmano naiva tajjñānatāstīti yojanā /

idamuktaṃ bhavati /
kāraṇaṃ hi sadṛśakāryajananasvabhāvaṃ (vā) syāt, visadṛśakāryajananasvabhāvaṃ vā, ubhayasvabhāvaṃ vā, anubhaya(janana)svabhāvaṃ vā /


*8,186f.*

tatra yatrādyaḥ kalpo 'ṅgīkriyate tadendriyānālambanebhyo viralaparamāṇubhyastathābhūtā eva paramāṇavo jāyeran /
na punaḥ kadācidindriyālambanabhūtā militāḥ /
indriyebhyaścārthānadhipatibhyastathāvidhānyevendriyāṇyutpadyeran /
na jātvarthādhipatīndriyāṇi /
ātmānaścāsamudāyajñānāttādṛśa evātmā jāyeta /
na kadācittajjñānavān /
anyathā kāraṇaparamāṇvādīnāmapīndriyālambanatvādikamabhyupagantavyaṃ syāt /
itarathā sadṛśakāryajananasvabhāvabhaṅgāpatteḥ /
ubhayathā samudāyavedanasya kādācitkatvaṃ nopapadyata iti /


*8,188*

dvitīyamāśaṅkate- viśeṣeti //

viśaṣaṣakāryajanakaṃ yadi kāraṇamiṣyate // MAnuv_2,2.179ab //

NYĀYASUDHĀ:
tathācendriyānālambanavilaparamāṇvādibhyastadālambanamilitaparamāṇvādijanirupapadyata iti bhāvaḥ /
nirākaroti- kuta iti //

kutaḥ samānarūpatvaṃ kāryāṇāmapi sarvaśaḥ // MAnuv_2,2.179cd //

NYĀYASUDHĀ:
tarhīti śeṣaḥ /
sarvaśo 'pi kāryāṇāmiti sambandhaḥ /
atra kāryagrahaṇaṃ paramatānusāreṇa /
kāraṇasya visadṛśakāyarjananasvabhāvatāyāmākapālabhāvātsarveṣvapi ghaṭakṣaṇeṣu ghaṭākāratā na syāt /
kintu ghaṭakṣaṇādgajakṣaṇastato gardabhakṣaṇa utpadyate /
tathā nīlakṣaṇātpītakṣaṇastataḥ kapotakṣaṇo jāyeta /
nīlānuvṛttistu na syāditi /


*8,190*

astu tarhyubhayasvabhāvaṃ kāraṇamiti tṛtīyaḥ pakṣa iti cenna /
virodhenaikasyāpyajananaprasaṅgāt /
avirodhe tvāha- ata iti //

ato 'niyatyā yatkiñcid yasya kasyāpi kāraṇam // MAnuv_2,2.180ab //

NYĀYASUDHĀ:
prakṛtapakṣadvayaṃ samāhṛtyāta iti parāmṛśati /
aniyatyā ghaṭo ghaṭasyaiva nīlonīlasyaiveti niyatiṃ vinā /
yatkiñcit ghaṭādikaṃ nīlādikaṃ vā /
yasya kasyāpi ghaṭāderaghaṭādernīlāderanīlādeśca /
kāraṇaṃ syāt /
ghaṭakṣaṇasyobhayavidhakāryajananasvabhāvatve 'sau tadubhayaṃ janayet /
tathā copalabhyeteti yāvat /
kecididaṃ vākyaṃ pūrvavākyaśeṣatayā vyācakṣate /
sarvaśo 'pi kāryāṇāṃ samānarūpatvaṃ na syāt /
kintu visadṛśakāryajananasvabhāvatvādghaṭādikaṃ gajādeḥ kāraṇaṃ syāditi /

na caturthaḥ /
arthakriyārahitasyāsattvaprāpteḥ /
arthakriyākāritvaṃ sattvamiti (hi)saugatāḥ /

nanu ca kāryajananamātraṃ vastunaḥ svabhāva ityaṅgīkurmo na tūkteṣu kamapi pakṣamityata āha- ata iti //
buddhisthamimaṃ kalpamata iti parāmṛśati /
atiprasaṅgastu na tirohitaḥ /


*8,192*

syādetat /
yathā bhavanmate pramājananasvabhāvatve 'pīndriyāderdeṣasahakārivaśādapramājananam, tathā kāraṇasya sadṛśakāryajanakatve 'pyadṛṣṭādisahakārisāmarthyātkadācidvisadṛśakāryajananaṃ bhaviṣyati /
yadvā yathā sāṅkhayānāmindriyādīni pramāpramājananasvabhāvāni /
tatrāpramāpratipakṣāṇāṃ guṇānāmupanipāte pramāmevopajanayanti, pramāpratipakṣāṇāṃ doṣāṇāmupanipāte tvapramām, tathā kāraṇasyobhayasvabhāvatve 'pyadṛṣṭādivaśāttadanyatarajanmopapatsyate /
athavā yathā naiyāyikādīnāmindriyādīni jñānamātrajananasvabhāvāni /
guṇādisahakāryupanipātena pramādyu(tpa)papattiḥ, tathā kāraṇaṃ kāryajananasvabhāvameva /
adṛṣṭādisahakārisamavadhānāt (tu) tatsadṛśaṃ visadṛśaṃ vā janayiṣyatītyata āha- adṛṣṭamapīti //

adṛṣṭamapi tasyaiva viśeṣāpādakaṃ kutaḥ // MAnuv_2,2.180cd //

NYĀYASUDHĀ:
atrādṛṣṭagrahaṇamupalakṣaṇam (sahakārimātrasya) /


*8,193*

adṛṣṭamapi viśeṣasya, ādye visadṛśakāryajanakatvasya dvitīya'nyatarapratibandhasya, tṛtīye tūbhayajanakatvasyāpādaṃ kuta ityekaṃ vākyam /
tathāhi /
pūrvapūrvatarādyadṛṣṭakṣaṇāviśeṣānāpādakāstadāpādakā vā /
ādye tvasyādṛṣṭakṣaṇasya viśeṣāpādakatvaṃ na siddhayati /
kāraṇābhāvāt /
viśeṣānāpādakādṛṣṭakṣaṇājanyo 'pya(yama)dṛṣṭakṣaṇaḥ sahakārivaśādviśeṣamāpādayiṣyatīti cenna /
tatsahakāriṇyapyasya sāmyāt /
(a)tatrāpi sahakāryanatrānusaraṇe gauravamiti /

tasyaiva kāraṇasya viśeṣāpādakaṃ kuta ityaparaṃ vākyam /
tathāhi /
viśeṣāpavādakamapyadṛṣṭaṃ kiṃ vivakṣitasyaiva kāraṇasya viśeṣamāpādayati, kāraṇamātrasya vā /
nādyaḥ /
niyāmakayoḥ kāraṇajñāpakayorabhāvāditi /
yebhya indriyānālamabanaviralaparamāṇubhyastadālambanamilitaparamāṇūtpattirāśāsyate /
yataścārthānadhipaterindriyādarthādhipatīndriyasya /
yasmācca samudāyajñānarahitādātmanastadvadātmotpādaḥ /
tadidaṃ tasyaivetyucyate /


*8,195*

ubhaya(trāpi dvi)tra dvitīyau kalpau dūṣayati- yasyeti //

yasya kasyāpi yatkiñcid viśeṣamupapādayet // MAnuv_2,2.181ab //

NYĀYASUDHĀ:
atrāpi yatkiñcidadṛṣṭaṃ viśaṣamupapādayedityekaṃ vākyam /
yadi pūvarpūrvatarādyadṛṣṭasyāpyasti viśeṣāpādakatvaṃ tarhi tadapi pūvarpūrvatarādiparamāṇvādau viśeṣamāpādayedeva /
samarthasya kṣepānabhyupagamāt /
tathāca samudāyapratīteḥ samayaniyamo na syāditi /

yasya kasyāpi viśeṣamupapādayediti dvitīyam /
yadi kāraṇamātrasya viśeṣāpādakamadṛṣṭamaṅgīkriyate tadā sarveṣāmapi kāraṇānāṃ viśeṣamupapāditam /
tathāca ghaṭaparamāṇumelane sarveṣāmapi melanaṃ syāt /
natu kutrāpyabhilaṣitaparamāṇvavasthānaṃ bhavet /
naca yugapatsarvasamudāyo dṛśyata iti /

JOSHI-2


*8,196*

atha matam /
sarvamidaṃ svavyāhatam /
tathāhi /
tantavo yadi sadṛśakāryajananasvabhāvāstadā tantvantarameva janayeyurna tu paṭam /
yadi ca visadṛśakāryajananasvabhāvāstadā na tebhyaḥ pārthivapaṭasyotpattiḥ syāt /
kintu pāthasīyaṃ kimapi jāyeta /
ubhayasvabhāvatvaṃ tu viruddham /
anubhayasvabhāvatve paṭasyāpyanutpattiḥ /
sahakārivaśādvayavasthāṅgīkāre sahakāriṣvapīdaṃ samānam /
athocyeta /
asti(stu)tāvattantupaṭayoḥ kāryakāraṇabhāvaḥ /
pramitasyāpanhavānarhatvāt /
sa ca yathā yathopapadyate tathā tathā kalpayiṣyata iti /
samametatsamāpītyata āha- kāryaṃ ceti //

kāryaṃ ca kāraṇaṃ caiva yatkiñcid yasya kasyacit // MAnuv_2,2.181cd //
bhavenniyāmakābhāvād ... // MAnuv_2,2.182ab //



*8,197*

NYĀYASUDHĀ:
nityavināśitva itayetadvakṣyamāṇamatrāpi sambaddhayate /
yatkiñcinnīlādikaṃ yasya kasyacideva pītādeḥ kāryaṃ syāt /

yatkiñcitpītādikaṃ yasya kasyacideva nīlādeḥ kāraṇaṃ syāt /
kutaḥ /
nīlā nīlasyaiva kāryaṃ syāt na pītasya /
nīlameva nīlasya kāraṇaṃ na pītami(tyatra)tiniyāmakābhāvāditi yojanā /
caśabdau mithaḥ samuccaye /


etaduktaṃ bhavati /
sambhavati sthiravāde parihāro 'yam /
yadyatra samavetaṃ yadyenākāreṇa pariṇataṃ vā tattasya kāraṇaṃ kāryaṃ ceti niyāmakasadbhāvena kāyarkāraṇabhāvāvadhāraṇe sati tadupapādakakalpanopapatteḥ /
kṣaṇabhaṅgunaye tu pūrvottarakṣaṇayorniranvayavināśotpādayoḥ kāyarkāraṇabhāvāvadhāraṇopāya eva nāsti /
samavāyapariṇāmayorabhāvāt /
tathāca kasya balādupapādakaṃ kalpayiṣyata iti /


*8,198*

samavāyapariṇāmayārabhāve 'pi yadyadapekṣayā pūrvabhāvi tadeva tasya kāraṇam /
yacca yadapekṣayā paścādbhāvi tadeva tasya kāryamityavadhāraṇopapatterniyāmakābhāvo 'siddha ityataḥ kāryaniyamaṃ tāvannirākaroti- idamasyaiveti //


*8,197*

... idamasyaiva kāraṇam /
iti nityavināśitve kena mānena gamyate // MAnuv_2,2.182b-d //


NYĀYASUDHĀ:
idaṃ nīlama(sya nīla) syaiva kāraṇam, na tu pītasya, ityevaṃ nīlasya nīlakāryatvaṃ, nityavināśitve niranvayavināśotpādapakṣe, kena mānena na kenāpi /
paścādbhāvamātrasya nī(lasyeva pītasyāpi)lāpekṣayeva pītāpekṣayāpi sattvāditi bhāvaḥ /
sādeśyaṃ sārūpyaṃ vā niyāmakamiti cenna /
viralaparamāṇubhyo militānāṃ militebhyaśca viralānāmutpattyaṅgīkārāt /
kāraṇaniyamamapyapākaroti- idaṃ neti //

idaṃ na jāyate 'muṣmādityatrāpi na kāraṇam // MAnuv_2,2.183ab //

NYĀYASUDHĀ:
idaṃ nīlamamuṣmātpītānna jāyate kintu nīlādevetyatra nīlasya kāraṇatvāvadhāraṇe 'pi, kāraṇaṃ pramāṇaṃ, nāsti /
nīlasyeva pītasyapi nīlāpekṣayā pūrvabhāvitāyāḥ sattvāditi bhāvaḥ /


*8,199f.*

nanu yathā bhavatāṃ samavāyapariṇāmayorabhāve 'pi kuvindapaṭayoḥ kāryakāraṇabhāvāvadhāraṇaṃ tathā mamāpi bhaviṣyatītyata āha- idamasyeti //
nityavināśitve ātmana iti śeṣaḥ /
yujyate 'smākaṃ nimittakāraṇakāryayostadbhāvāvadhāraṇamanyatrānupakṣīṇānvayavyatirekābhyām /
natu parasya /
asmābhiranvayavyatirekānusandhāturātmanaḥ sthāyitvābhyupagamāt /
pareṇa(ca) kṣaṇikatāsvīkārāt /
nahi tathāvidho 'nvayavyatirekayoranyatrānupakṣayasya cāvadhṛterīṣya iti bhāvaḥ /
yojanā tu pūrvavadeva /


*8,200*

evaṃ samudāyaṃ nirākṛtya sarvasya kṣaṇikatāmadhunā pramāṇābhāvena tadvirodhena cāpākartumuttaro granthaḥ /
tathāhi /
na kevalaṃ samudāyo nopapadyate /
kinnāma sarvasya kṣaṇikatā ca /
tatra pramāṇābhāvāt /
nanu pratyakṣaṃ kṣaṇikatāmarthānāmavagamayati /
taddhi vartamānamātragocaramarthasya vatarmānakṣaṇamātrasambandhinīṃ sattāmavagāhate /
na pūrvottarakṣaṇasambandhanīmapi /
tatkathaṃ kṣaṇikatvamarthānāmaprāmāṇikamiti /
ucyate /
kimidaṃ kṣaṇikatvaṃ nāma /
kiṃ kṣaṇasambandhisattvam /
kiṃvā kṣaṇamātra evotpattināśavattvam /
yadvā kṣaṇāntarāsambandhitve satyekakṣaṇasambandhitvam /
ādyastviṣya eva /
sthāyino 'pyarthasyaikakṣaṇasattāsvīkārāt /
dvitīyatṛtīyau dūṣayati- vināśeti //

vināśotpattayaścaiva na dṛśyante sadātanāḥ // MAnuv_2,2.183cd //
NYĀYASUDHĀ:
anekapadārthasambandhitvena bahuvacanam /
caśabdastṛtīyapakṣasamuccayārthaḥ /
evaśabdasya naiveti sambandhaḥ /
sadātanāḥ pratikṣaṇabhāvinyaḥ /
pratyakṣaṃ khalvarthānāṃ vatarmānakālasattāmavagāhate na punaḥ kṣaṇamātrabhāvināvutpattivināśāvapi /
nāpi kṣaṇāntarasambandhitvam /
tathāca kathaṃ tena kṣaṇikatā siddhayediti /


*8,202*

nanu ca pratyakṣaṃ pūrvottarakṣaṇavatirtvamapyarthasya gṛhṇāti na vā /
nādyaḥ /
vartamānamātragrāhitvāt /
dvitīye tu pratyakṣānupalambhena parvottarakṣaṇayorasattvasiddheḥ kṣaṇikataiva si(dhyediti)ddheti cet /
dvitīyaṃ tāvadurarīkumarḥ /
nacaivaṃ kṣaṇikatāsiddhiḥ /
yogyānupalambhasyaivāsattvagamakatvāt /
naca pūrvottarakālavartinā pratyakṣayogyā /
vatarmānamātragrāhitāyāḥ pareṇaivoktatvāt /
astu vā'dyaḥ pakṣaḥ /
kasyācitpratyakṣasya vartamānamātragrāhitve 'pi tadevedamiti pratyabhijñānalakṣaṇasya tadabhāvādityāśayenāha- dṛśyata iti //

dṛśyate pratyabhijñātaḥ sthiratvaṃ sarvavastuṣu // MAnuv_2,2.184ab //

NYĀYASUDHĀ:
viṣayīkriyata ityarthaḥ /
tṛtīyārthe tasiḥ /
ekasyaivānekakṣaṇasambandhitvaṃ sthiratvam /
etena na kevalaṃ pratyakṣaṃ kṣaṇikatāṃ na gocarayati /
kintu sthāyi(tāṃ)tvamapi gocarayatītyapīti vadatā parapakṣe pramāṇavirodhaḥ svapakṣe pramāṇasadbhāvaścodito bhavati /


*8,203*

anena"anusmṛteśca'; iti sūtraṃ kṛtavyākhyānaṃ veditavyam /
sarvavastuṣvityanena saugatānāṃ pratyabhijñānirākaraṇaṃ vaiśeṣikādimatameva spṛśati na tvasmanmatamiti sūcayati /

tathāhi /
kimanayā pratyabhijñayā nityatvenābhyupagateṣu paramāṇvādiṣu sthiratvaṃ sādhyate kiṃvā ghaṭādiṣu /
nādyaḥ /
teṣāmatīndriyatvena pratyabhijñāpratyakṣagocaratvasyābhyupagantumaśakyatvāt /
na dvitīyaḥ /
ghaṭādiṣu pareṇāpi pratyabhijñāyā bhrāntitvasya svīkāryatvāt /
yadā hi ghaṭādau sūcyagrādinaiko 'pi paramāṇurapaiti tadā naṣṭavyameva tadārabdhena dvayaṇukena /
vibhāgenāsamavāyikāraṇasya saṃyogasya naṣṭatvāt /
dvayaṇukanāśe samavāyikāraṇanāśāttryaṇukanāśa ityanena krameṇa ghaṭanāśo 'pyavaśyambhāvī /
naca paramāṇuḥ pratyakṣo yena tadapagamānapagamau pratyakṣeṇa śakyaniścayau /
naca vācyaṃ nibiḍāvayaveṣu sphaṭikādiṣu pratyabhijñayā sthiratvaṃ setsyatīti /
tatrāpi paramāṇvapagamābhāvasya pratyakṣeṇa niścetumaśakyatvāt /
nibiḍāvayavatvaṃ ca na vibhāgāyogyāvayavatvam /
vibhāgasya pratyakṣasiddhatvāt /
kintu ghaṭādito 'pyutkṛṣṭakāraṇāpekṣatvam /
naca tadviśeṣābhāvaḥ śakyo 'smābhiravagantum /
dṛśyate hi kālataḥ sphaṭikādāvapi gurutvāpakarṣaḥ /
nacāvayavānapagame sa sambhavatīti /
nāpi guṇādau sthāyitvaṃ pratyabhijñayā siddhayati /
tasyāpi kasyacidatīndriyatvāt /
kasyacidghaṭāditulyatvāt sāmānyādikaṃ tu svarūpato nāstyeva /
sattve 'pi rūpādisamānameveti śaṅkitaprāmāṇyaṃ pratyabhijñānaṃ na kutrāpi sthairyasiddhau pramāṇayituṃ yuktamiti /


*8,206*

atrocyate /
syādayaṃ doṣaḥ paramāṇvārambhavādinām /
na pariṇāmavādināmasmākam /
tadeva (hi) vastvavayavopacayāpacayābhyāmanyathā vikriyate /
na punaranyadeva bhavatīti hi pariṇāmavādino manyante ataḥ pratyakṣayogyeṣu sarvavastuṣu pratyabhijñayā sthiratvagrahaṇaṃ yuktameveti /

nanu bhavanmate 'pi pratyabhijñā (bhrama eva) bhrāntireva /
pariṇāmavāde pūrvottaravastunorbhedābhedāṅgīkārāt /
tadevedamiti ca pratyabhijñayātyantābhedasyāvagāhanāt /
ucyate /
yadā tu (yadi hi) pūrvottarakālabhāvinorabhedaḥ pratyabhijñāviṣayo 'ṅgīkriyate /
tadā sāvadhāraṇasya pratyabhijñānasya bhramatve 'pi tadidamiti tu na bhramaḥ /
tenaiva ca sthāyitvasi(ddhi)ddheḥ /
yadā tu kālādidvayasambandho viṣayastadā sāvadhāraṇamapi na bhrama iti /

nanvidaṃ pratyabhijñānaṃ parilūnapunarjātakuntalāpādāviva bhrāntaṃ kinna syāditi cet (na) /
bādhakābhāvāt /
evameva bhrā(nta)ntitvābhyupagame nīlādipratyayānāmapi tathātvāpatte(tvaprāpte)ḥ /
naca pratyakṣaṃ bādhakamityuktam /


*8,211*

pratyakṣasyābādhakatve 'pyanumānaṃ bādhakaṃ bhaviṣyatīti śaṅkate- phalādīnāmiti //

phalādīnāṃ viśeṣeṇa sarvatrāpyanumīyate // MAnuv_2,2.184cd //
***[NOTE: jump in verse numbering, no lacuna in text!]***
sattvena kṣaṇikatvaṃ cedākāśasyāviśeṣataḥ /
aviśeṣo 'khilasyāpi sattvāt kiṃ nānumīyate // MAnuv_2,2.186 //



*8,211f.*

NYĀYASUDHĀ:
ādipadena dehadīpādigrahaṇam /
viśeṣeṇa parimāṇabhedena, kṣaṇikatvaṃ (tāvat)anumīyata iti sambandhaḥ /
tatastaddṛṣṭāntena sarvatra phalādivyatirikte 'pi vastuni sattvena hetunā pañcaskandhā ityanumānaṃ sthiratvaviṣayapratyabhijñāyā bādhakaṃ bhaviṣyati /
naca phalādidṛṣṭāntaḥ sādhyavikalaḥ /
yadviruddhaparimāṇaṃ tannānā dṛṣṭaṃ yathā ghaṭapaṭau, viruddhaparimāṇaṃ ca phalādikaṃ pūrvottarakṣaṇayoḥ, ityanumānena phalādīnāṃ kṣaṇikatāsiddheriti /
pariharati- ākāśasyeti //
aviśeṣataḥ pūrvottara(kṣaṇa)yorbhedarahitatvataḥ, aviśeṣaḥ pūrvottarakṣaṇayorbhedarāhityam /
akhilasyāpi vipratipannasya /
idamuktaṃ bhavati /
yatsattadakṣaṇikam yathā'kāśam /
sacca nīlādīti pratyanumānapratiruddhatvenānumānasyābhāsatvānna pratyabhijñābādhakatvaṃ sambhavatīti /
nacākāśadṛṣṭāntaḥ sādhyavikalaḥ /
"ākāśo dvau nirodhau ca nityaṃ trayamasaṃskṛtam'; itrata pareṇaivāṅgīkṛtatvāt kṣaṇikatāsādhakasya parimāṇabhedāderākāśe 'bhāvācca /
tadidamu(mapyu)ktaṃ aviśeṣataḥ parimāṇabhedādirahitatvata iti /


*8,213*

yadvā'kāśasyāviśeṣataḥ parimāṇabhedarahitatvataḥ /
taddṛṣṭāntenākhilasyāpi phalāderaviśeṣaḥ pūrvottarakālayoḥ parimāṇabhedābhāvaḥ sattvāt kiṃ nānumīyata iti yojanā /
etaduktaṃ bhavati /
nānumānaṃ pratyabhijñāyā bādhakaṃ bhavitumarhati /
anumānasya pratyakṣato dubarlatvena tadbādhyatvāt /
anyathā phalādikaṃ parimāṇabhedarahitaṃ sattvādākāśavadityapyanumānaprasaṅgāt /
nahyatra pratyakṣādibādhaṃ vinā kaściddoṣo 'sti /
tathāca taddṛṣṭānte kṣaṇikatvasādhakasyāsiddhatvātsādhyavikalatā syāt /
tataḥ pratyakṣavirodhenaivāsyānumānasyāprāmāṇyam /
anyathānyonyāśraya(tā)prasaṅga ityeva vaktavyam /
tacca samaṃ prakṛte 'pīti /
etena"ākāśe cāviśeṣāt'; iti sūtraṃ vyākhyātaṃ bhavati /
tadanena kṣaṇikatva(tā)sādhakānumānasya satpratipakṣatvaṃ bādhitaviṣayatvaṃ ca vadatā'kāśe '(nā)naikāntyamapi sūcitam /
bhavadanumānasyāpi phalādinānaikāntyamiti cenna /
tatrāpi kṣaṇikatābhāvasya vakṣyamāṇatvāt (iti) /


*8,214*

bhavedidaṃ yadyākāśasya sattvaṃ syāt /
nacaitadasti /
mūrtābhāvatvādākāśasya /
bhāvatvaṃ hi sattvamatra vivakṣitam /
sasvarūpatve 'pi vā sattve, abhāvo niḥsvarūpa ityaṅgīkṛtamityāśaṅkayāha- yadīti //

yadyākāśasya sattvaṃ na kuta eva narādiṣu // MAnuv_2,2.187ab //

NYĀYASUDHĀ:
yadyākāśasya sattvaṃ nāstītyaṅgīkṛtya pratyanumāne 'tiprasaṅgānumāne ca dṛṣṭāntasya sādhanavaikalyaṃ svānumānasyānaikāntikatvābhāvaścocyate /
tadā dehādiṣu sattvaṃ kuta eva siddhamiti brūmaḥ /
tathāca parakīyasyāpi dṛṣṭāntasya sādhanavaikalyaṃ syāt /
yadi ca vidhimukhapratyayavedyatvāddehādīnāṃ bhāvatvaṃ pramāviṣayatvātsattvaṃ cocyate /
tadā'kāśe 'pi samānamiti /

pramāṇāntareṇākāśasyābhāvatvaṃ vārayitumupodghātamāha- sa dharmīti //

sadharmipratiyogitvamākāśasyāvagamyate // MAnuv_2,2.187cd //


*8,216*

NYĀYASUDHĀ:
yatrābhāvaḥ sa dharmī /
yasyābhāvaḥ sa pratiyogī /
tadubhayavattvamabhāvasya niyāmakaṃ vyāpakam /
yo 'bhāvaḥ sa sarvo 'pi dharmipratiyogisahita eva /
yathā ghaṭādyabhāvaḥ /
sa hi bhūtalādidharmiṇā ghaṭādipratiyoginā copeta eveti /


nanvidamanupapannam /
abhāvasya hi dharmipratiyogisāhityaniyamaḥ kiṃ deśataḥ syāt, kiṃvā kālataḥ /
ādye dharmiṇā sādeśyaṃ tāvannāsti /
bhūtalasya svāśraye, abhāvasya tu bhūtale vṛtteḥ /
pratiyoginā tu viruddhameva /

dvitīyastu yadyapi dharmiṇā kathañcitsyāt /
tathāpi pratiyoginā nāstyeva /
prāgabhāvapradhvaṃsābhāvayoḥ pratiyogibhinnakālatvaniyamādityāśaṅkāṃ pariharannabhāvasya dharmipratiyogisāhityavyāptatvamupapādayati- tau vineti //

tau vinā na hy abhāvaś ca kvaciddṛṣṭaḥ kadācana // MAnuv_2,2.187*ab //

NYĀYASUDHĀ:
atra dṛṣṭa iti prakaraṇāttau vineti tajjñānaṃ vinetyatharḥ /
caśabdo 'bhāvo dṛśyamāno dharmipratiyogipratītāveva dṛśyata ityanvayasamuccayārthaḥ /
hiśabdenānvayavyatirekayoḥ prasiddhatvaṃ sūcayati /
tadanenānvayavyatirekābhyāmabhāvapratīterdharmipratiyogipratītipūrvakatayā vyāptirupapāditā bhavati /
yadvā tāvi(ti)tyanena na jñānamupalakṣaṇīyam /
abhāvaḥ pratīyamāno dharmipratiyogighaṭita evātredaṃ nāstītyādirūpeṇa pratīyate /
natu tau vinā kevala ityanvayavyatirekābhyāmekajñānasambandhena vyāpyavyāpakabhāvopapādanametadityavagantavyam /
prātargajādyabhāvajñānaṃ tvanyathopapādayiṣyāmaḥ /


*8,219*

kimato yadyevamabhāvasya yadyevamabhāvasya dharmipratiyogisāhityaṃ pratītau vyāpakamityata āha adharmīti

adharmipratiyogitvamākāśasyāvagamyate // MAnuv_2,2.187*cd //

NYĀYASUDHĀ:
pratītāvabhāvasya vyāpakaṃ sadharmipratiyogitvamākāśāttāvadvayāvartar(tya)te /
yasmādākāśa ityevāvagamyate na tvatredaṃ nāstīti /
iyamapi (ca) vastuto mūrtābhāvagocaraiva pratītiḥ pralayādivannañvarjitābhilāpasambandhādatādṛśīva prakāśata iti cenna /
nīlādipratiterapi tathātvaprasaṅgāt /
anānubhāvikatvasyobhayatrāpi sāmyāt /
tathāca parasyāpyasiddhayādyāpātaḥ /
vyāpakanivṛttyā(ca) vyāpyanivṛttiravaśyaṃbhāvinītyākāśasya nābhāvatvamiti /
tadayaṃ prayogaḥ /
ākāśo nābhāvaḥ dharmipratiyoginau vinaiva pratīyamānatvādrūpavaditi /
kiñca mūrtābhāvamākāśaṃ vadatā yo dharmī tasyocyate sa evāsmākamākāśa iti nāmnayeva vivādo 'vaśiṣyate /
vakṣyate caitadviyadadhikaraṇa iti /


*8,220*

sūtradvayārthamupasaṃharati- svīkāreti //

svīkāratyāgato 'dṛṣṭadṛṣṭayoḥ sarvavastuṣu /
guṇānunmatta evāsau vidadhātyadhikaṃ punaḥ // MAnuv_2,2.188 //


NYĀYASUDHĀ:
adṛṣṭasya kṣaṇikatvādeḥ svīkṛti(kāra)to dṛṣṭasya sthiratvādestyāgataḥ /
asau saugataḥ /
adhikaṃ svata iti śeṣaḥ /
unmattamapi svasmādadhikavivekavantaṃ (sthā)khyāpayatītyarthaḥ /
na hyunmattaḥ sarvatrāpramitaṃ svīkaroti nāpi pramitaṃ tyajatīti /


*8,220f.*

nanu (ca) yadi nīlādikaṃ na syāttadā sanna syāt /
arthakriyākāritvaṃ hi sattvam /
vyāptaṃ ca kramayaugapadyābhyām /
tṛtīyaprakārābhāvāt /
naca sthire tatsambhavaḥ prasaṅgatadviparyayābhyām /
tathāhi /
sthāyībhāvaḥ kiṃ (svī)svakīyāmarthakriyāṃ krameṇa kuryādyugapadvā /
ādye kālāntarabhāvinīmarthakriyāṃ pratīdānīṃ samartho na vā /
prathame tāmapīdānīṃ(nīmeva) kuryāt /
samarthasya kṣepāyogāt /
dvitīye tadāpi na kuryāt /
idānīmasamartho 'pi tadānīṃ samarthatvātkariṣyatīti cet /
tadā sāmarthyāsāmarthyalakṣaṇaviruddhadharmādhyāso bhāvaṃ bhindyāt /
dvitīye tvādyakṣaṇa eva kartavyasya sarvasya kṛtatvāt dvitīyādikṣaṇe 'sattvamavarjanīyameva /
tadevamanukūlatarkabalalabdhapratibandhasya kṣaṇikatvānumānasya balavattvātpratyabhijñāpratyanumāne tadbādhite na sthairyasādhanāyālamiti /
maivam /
eṣāṃ tarkāṇāṃ pratitarkaparāhatatvādinā'bhāsatvāt /


*8,223*

tathāhi /
yadyātmānātmaprapañcaḥ sarvo 'pi kṣaṇikaḥ syāttadā pramāpramārūpaḥ sarvo(kalo)'pyanumānāgamapratyabhijñālakṣaṇo vyavahāro lupyeta /
tarkasyāpyasya notthānaṃ syāt /
tasya tajjātīyasya vā tena tajjātīyena vā saha bhūyaḥ sambandhāvagame (na)ta tādātmyatadutpattyavadhāraṇena (vā) copādhyabhāvā(dya)vadhāraṇena vā vyabhicārābhāvaniścaye sati vyāptyavadhāraṇam /
avadhṛtavyāpteśca pakṣadarśanaṃ liṅgadarśanaṃ ca /
tato 'nubhūtavyāptismaraṇam /
atha yanmayā vyāptatvena jñātaṃ liṅgaṃ tadatra pakṣe 'stītyanusandhānam /
athedānīmanumitirityanumānaprakriyā /
na hyetatsarvaṃ kṣaṇikasyātmanaḥ sambhavati /
yena hi sakṛt dhūmo dṛṣṭo naṣṭa evāsau /
kasya bhūyodarśanaṃ kasya ca vyāptyavadhāraṇādi /
yasmiṃśca parvate dhūmo dṛṣṭo naṣṭa evāsau /
kutra punarvyāptiliṅgānusandhānam /
kutra ca sādhyādhyavasāyaḥ /


*8,224*

evamāgame 'pyekaikavarṇaśravaṇāni, padānusandhānam, samayagrahaḥ, punaḥ padaśravaṇam, samayasmaraṇam, vākyārthajñānamityanekasaṃvi(kānusandhā)ndhānam, nātmanaḥ kṣaṇikatāyāmupapadyate /
pratyabhijñānamapi yena pūrvāvastho 'rtho jñātastenaiva tasya vā tatsadṛśasya vā darśane bhavati /
tatkathaṃ kṣaṇikasyātmanaḥ syāt /


*8,225*

anumānena tarko 'pi vyākhyātaḥ /
pratikṣaṇamātmano 'nātmanaśca bhede 'pyanumā(nā)dyaṅgīkāre 'tiprasaṅgaḥ syāt /
yasya kasyacidvayāptijñāne nārikeladvīpavāsino 'pyagnipramā (bhavet) syāt /
parvate liṅgadarśanena hrade 'pyagniranumīyetetyādi /
pūrvottarakṣaṇavartināmātmanāṃ parvatādīnāṃ ca kāryakāraṇabhāvādupapanno 'numānādivyavahāra iti cet(na) /
anyatvasyānapāyāt /
anyathopādhyāyaśiṣyabuddhayādāvapi prasaṅgāt /


*8,226*

atha matam /
kāraṇakṣaṇāḥ kāryakṣaṇeṣu saṃskārānaparyanti /
ataḥ pūrvapūrvātmasaṃskārayogināmuttarottareṣāmātmanāmanumānādivyavahāro yujyate /
parvatādayo 'pi (pūrva)pūrvasaṃskārabhājaḥ pakṣāditvamaśnuvate iti /
etannirākaraṇāya sūtram /
oṃ uttarotpāde ca pūrvanirodhāt oṃ //
iti /
tadvayācaṣṭe- uttareti //

uttarotpāde ca pūrvanirodhāt | BBs_2,2.20 |

uttarotpattimātreṇa vināśāt pūvarvastunaḥ /
na saṃskārārpakatvaṃ ca yujyate kasyacit kvacit // MAnuv_2,2.189 //



*8,227*

NYĀYASUDHĀ:
kasyacit kāraṇasya, kacit kārye /
tataḥ kimityata āha- ata iti //

ato jñātaṃ mayetyādi na jñeyamanumā kutaḥ // MAnuv_2,2.190ab //

NYĀYASUDHĀ:
ātmanaḥ kṣaṇikatvātsaṃskārāparṇasya cā(vā)sambhavādityarthaḥ /
yanmayā vyāptatvena jñātaṃ tadatra vidyata ityādi yathā bhavati tathā na jñeyaṃ jñātumaśakyam /
tataścānumā kutaḥ /
āgamāderapyupalakṣaṇametat /


nanvasti tāvadanumānādivyavahāraḥ, sarvalokasiddhasyāpahnavāyogāt /
tadbalenālaukikamapyasahabhāvinaḥ saṃskārārpakatvaṃ kalpayiṣyata ityata āha- ekatvamiti //

ekatvamanubhūtisthaṃ tyaktavā nirmānakā bhidā /
kuta ātmādikeṣu syād ... // MAnuv_2,2.190c-e //


NYĀYASUDHĀ:
kimanumānādivyavahārānyathānupapattimātreṇālaukikaṃ kalpanīyam, kiṃvā'tmādeḥ kṣaṇikatve 'pi sati /
nādyaḥ /
ātmādeḥ sthāyitvenaiva tadupapatteḥ /
dvitīyastu syāt /
yadyātmādeḥ kṣaṇikatvaṃ siddhaṃ syāt /
naca tadasti /
pramāṇabādhitatvānniṣpramāṇakatvācceti bhāvaḥ /
ekatvaṃ bhidetyatra pūrvottarakālayoriti śeṣaḥ /
anubhūtisthaṃ pratyabhijñāsiddham /
kuto 'ṅgīkāryetyadhyāhārātsamānakartṛtāsiddhiḥ /


*8,229*

nanu ca pratyabhijñānaṃ bhrāntamityuktam /
tatkathamātmāderaikyaṃ tataḥ siddhayedityata āha- valyeveti //

... balyevānubhavo yataḥ // MAnuv_2,2.190f //

NYĀYASUDHĀ:
tarkabalenānumāne niravakāśatayā prabale sati hi tadvirodhātpratyabhijñānaṃ bhrāntaṃ syāt /
yadā tu tarkasyoktavidhayā'bhāsatvaṃ, tadā kutaḥ kṣaṇikatvānumānaprābalyam /
kutaśca pratyabhijñāyāstadbādhaḥ /
abādhitaśca pratyabhijñānubhavo yato balyeva /
ata ātmāderekatvaṃ tena siddhamiti sambandhaḥ /
etenānumānasiddhasya bhedasya kathaṃ nirmānakatvamityapi parāstam /
tadupajīvyasya tarkasyādyāpyanavasthānāt /


*8,230*

nanvastūttarotpāda eva pūrvasya nirodhastathāpi kutaḥ pūrvasyottarasminsaṃskārānādhāyakatvamityata āha- kāryakāraṇayośceti //

kāryakāraṇayoścaikakālīnatvaṃ vinā katham /
pūrvasaṃskārayogī syāduttaro niyamena ca // MAnuv_2,2.191 //


NYĀYASUDHĀ:
uttarotpāda eva pūrvasya nirodhātkāyarkāraṇayorekakālīnatvaṃ tāvannāstīti labhyate /
ekakālīnatvaṃ ca vinā pūrvāhitasaṃskārayogitvamuttarasya na yujyate /
niyamena cetyanena kvacidapi na yujyate kutaḥ sarvatreti sūcayati /
yadvaikakālīnasya eva saṃskārārpakatvaṃ dṛṣṭaṃ na bhinnakālatva iti vyāpterityarthaḥ /


nanvekakālīnatvābhāve 'pi kutaḥ saṃskārārpakatvaṃ na syādityata āha- sambaddhā eveti //

sambaddha eva saṃskāramanyatrādattate 'khilāḥ /
asambaddhaḥ kathaṃ pūrva uttare vāsanākaraḥ // MAnuv_2,2.192 //



*8,231*

NYĀYASUDHĀ:
yasmāt akhilāḥ saṃskārādhāyakāścāmpakakusumādayaḥ padārthāstailādibhiḥ sambaddhā eva anyatra tailādau saṃskāramādadhate, nāsambaddhā ityasti niyamaḥ /
naca bhinnakālīna(la)yoḥ sambandho yujyate /
tasmāduttareṇaśasambaddhaḥ pūrvastasminnuttare vāsanāṃ na kuryāditi /

uktamarthaṃ buddhayārohārthaṃ saṅkalayyāha- ekakālatayeti //

ekakālatayā yogaṃ vinā saṃskārataḥ katham // MAnuv_2,2.193ab //

NYĀYASUDHĀ:
atraikakālatayā vinā kāryakāraṇayoryogo na yujyate /
yogaṃ vinā kāraṇasya kārye saṃskārārpakatvaṃ ca na ghaṭate, saṃskārato vinā kathamanumānādivyavahāra ityadhyāhāreṇa yojanā /
saṃskārāparkatvaṃ ca na ghaṭate, saṃskārato vinā kathamanumānādivyavahāra ityadhyāhāreṇa yojanā /
yadīdaṃ saṅkalanaṃ na kriyeta tadā pūrvo(ktahetūnāṃ)ktānāṃ pratyekaṃ saṃskārānādhayakatve hetutvaṃ jñāyeta /
sarvatra sādhyanirdeśāt tatra ko doṣaḥ /
uktākāṅkṣākuṇṭhitatvameveti /

atraite prayogāḥ /
pūrvakṣaṇa uttarakṣaṇe saṃskārādhāyako na bhavati, tenāsambaddhatvāt /
yo yenāsambaddho nāsau tatra saṃskārādhāyakaḥ, yathā sampratipannaḥ /
yadvā yo yatra saṃskārādhāyakaḥ sa tatsambaddha eva dṛṣṭo yathā sammataḥ /
asambaddhasyāpi saṃskārādhāyakatve mṛgamado vasanamiva sarvaṃ vāsayedaviśeṣāt /
asambaddhaśca pūrva uttareṇa /
tato bhinnakālīnatvāt /
sampratipannavat /
bhinnakālīnayorapi sambandhe 'tiprasaṅgaḥ /
bhinnakālīnaśca pūrvaṃ uttareṇa /

tadutpāda eva vinaṣṭatvāt /
saṃmatavat /
prāgeva naṣṭasya tenaikakālīnatvaśaṅkā eva vyāhateti /
nanu lākṣārasāhitabījapūrakusumalauhityavatkinna syāditi cet(na) /
tatrāpi niranvayavināśotpādānabhyupagamāt /
atra ca parasiddhanyāyena parasya bodhanānnāśrayāsiddhayādi śaṅkanīyamiti /


*8,236*

bhavedetadyadi kāraṇasya kāryotpāda eva vināśaḥ syāt /
sa eva kutaḥ siddha ityata āha- kṣaṇamātramiti //

kṣaṇamātramavasthānaṃ svīkṛtaṃ sarvavastuṣu // MAnuv_2,2.193cd //

NYĀYASUDHĀ:
kāryakāraṇayostāvaduttarapūrvatvamāvaśyakam /
yaugapadye kāyarkāraṇabhāvavyāghātāt /
tataḥ pūrvakṣaṇavarti kāraṇaṃ yadi kāyarkṣaṇe 'pi syāttadā sarvavastūnāmaṅgīkṛtaṃ kṣaṇamātramavasthānaṃ bhajyeta /
ataḥ kṣaṇikatvābhyupagama evottarotpāde ca pūrvanirodhaṃ gamayatīti /

syādetat /
kāraṇaṃ kṣaṇasya pūrvavibhāge labdhasattākaṃ madhyavibhāge kāryamutpādyāparavibhāge tatra saṃskāramādhāya naśyatītyaṅgīkāre na ko 'pi doṣa ityata āha- pūrveti //

pūrvamadhyāparakalārahitaḥ kṣaṇa iṣyate // MAnuv_2,2.194ab //

NYĀYASUDHĀ:
atra vibhāgamātraṃ kalocyate /
pūrvāparayorabhāve tannirūpyamadhyābhāvaḥ siddhaḥ /
iṣyate saugataiḥ /


*8,237*

evaṃ tarkasya pratitarkaparāhatimabhidhāyedānīṃ yathā sthāyinaḥ sattvānupapattirevaṃ kṣaṇikasyāpi tadanupapatteranukūlatā nāma tarkadoṣa iti pratipādayituṃ sūtram oṃ asati pratijñoparodho yaugapadyamanyathā oṃ //
iti /
tadvayācakṣāṇastāvadvikalpena tatpṛcchati- pūrveti //

asati pratijñoparodho yaugapadyamanyathā | BBs_2,2.21 |

pūrvabhāvabhavaṃ kāryamuta tannāśasambhavam // MAnuv_2,2.194cd //


*8,237f.*

NYĀYASUDHĀ:
arthakriyākāritvaṃ hi sattvaṃ parasyābhimatam /
tacca vakṣyamāṇa(vi)kalpadvaya(yena)vyāptam /
tṛtīyaprakārānirūpaṇāt /
naca tatkṣaṇike sambhavati /
tathāhi kṣaṇikādbhāvādbhavatkāryaṃ kiṃ pūrvasya kāraṇasya bhāve bhavati /
kāraṇasattāsamānakālīnasattamiti yāvat /
uta tasya kāraṇasya nāśe sati sambhavatīti /


*8,238*

ādye doṣamāha- yaugapadyamiti //

yaugapadyaṃ sati bhavedutpādyānāmaśeṣataḥ // MAnuv_2,2.195ab //

NYĀYASUDHĀ:
sati kāraṇe /
kāryaṃ bhavati cet tarhīti śeṣaḥ /
kṣaṇikaṃ hi kāraṇam /
kāryaṃ ca tatsattāsamānakālīnasattaṃ cetkāryakāraṇayoḥ sahotpāda ityuktaṃ syāt /
kṣaṇe vibhāgābhāvasyoktatvāt tattatkāryāṇāmapyayameva nyāya iti tatsantānabhāvinā(pya)maśeṣakāryāṇāṃ yaugapadyaṃ syāt /
tacca pratyakṣādiviruddhamiti /
atra yadyapi yugapadbhavatoḥ kāryakāraṇabhāvānupapattirapi dūṣaṇam /
tathāpi tacchiṣyaireva jñātuṃ śakyata iti,"ubhayathā ca doṣāt'; iti sūtre kathitamiti vā(cā)tra noktam /

dvitīyaṃ nirākaroti- vināśe cediti //

vināśe cenna tatkāryaṃ ... // MAnuv_2,2.195c //

NYĀYASUDHĀ:
kāraṇasya kāryaṃ bhavettarhīti śeṣaḥ /
tattasya kāryaṃ na bhavatītyāpannam /
anyathā sarvasya sarvaṃ kāryaṃ syāt /
na hyānantaryamātreṇa kāryakāraṇabhāvaḥ /
tathātve vināśakāryatvaprasaṅgāt /
ānantaryasyānyāpekṣayāpi sattvāt /
sādeśyāderapākṛtatvāt /
evamanyasyāpi kāryaṃ na bhavatīti na kāryaṃ syādakāraṇaṃ vā /
ubhayathāpi pūrvasyārthakriyāvirahādasattvaprāptiriti /
sūtrakṛtā saugatābhyupagataṃ pakṣaṃ pradhānīkṛtya dūṣaṇamuktam /
bhāṣyakṛtā tvabhāvasya bhāvasāpekṣatvāttena krameṇāto 'rthavirodhābhāvaḥ /


*8,241*

nanvasti tāvatpratikṣaṇaṃ kāryotpattiḥ /
naca kāryaṃ kāraṇena vinotpattumalam /
tathā sati nityaṃ sattvamasattvaṃ ve(ce)tyāpatteḥ /
ataḥ kāryotpattirevānyatarapakṣadoṣamābhāsayiṣyati /
pakṣāntaraṃ vā grāhayiṣyatītyata āha- kāryotpattau ceti //

... kāryotpattau ca kā pramā // MAnuv_2,2.195d //

NYĀYASUDHĀ:
syādetadyadi pratikṣaṇaṃ kāryotpattiḥ pramāṇavatī syāt /
na caitadasti /
naca svāṅgīkāramātreṇārthāntarākṣepasāmarthyamatiprasaṅgāditi /
nanvasti, yatsattatkṣaṇikaṃ yathā dehādi, sacca vivādapadamiti pratikṣaṇaṃ kāryotpattau pramāṇamiti cenna /
asyaiva nirākriyamāṇatvāt /
dehādīnāma(deha)pi kṣaṇikatvābhāvena dṛṣṭāntasya sādhyavikalatvācca /

nanu dehādeḥ pūrvottarakṣaṇayoḥ parimāṇabhedena bhedasiddhau kṣaṇikatvasiddhirityuktamityasya āha- abhede 'pīti //

abhedena viśeṣeṇa dehadīpaphalādiṣu /
viśeṣadarśanaṃ yuktamasmākam ... // MAnuv_2,2.196a-d //




*8,241f.*

NYĀYASUDHĀ:
pūrvottarakṣaṇayoriti śeṣaḥ /
viśeṣeṇa ārambhavādadvailakṣaṇyena /
ādipadenāṅkurādi /
viśeṣadarśanaṃ parimāṇabhedadarśanam /
asmākaṃ pariṇāmavādināṃ mate /
ayamatharḥ /
ārambhavādino hi parimāṇaṃ yāvaddravyabhāvyabhyupayanti /
avayavasaṅkhayātiśayānatiśayāyattatvātparimāṇabhedasya /
avayavāpacaye dravyavināśasyāvayavopacaye ca tadutpādasyāvarjanīyatvāt /
atasteṣāṃ parimāṇabhedo dravyaṃ bhindyādeva /
asmākaṃ tvavasthitameva dravyamavayavopacayāpacayābhyāṃ ta(tta)tparimāṇakatayā vikriyata iti darśanam /
tatra parimāṇabhedo na bhedamākṣipatīti /


*8,242*
kiñca phalādīnāṃ pūrvottarakṣaṇayorbhedaḥ sādhyate, utābhedābhāvaḥ /
ādye siddhasādhanam /
bhedasyāsmābhirapyaṅgīkṛtatvāt /
tāvatā kṣaṇabhaṅgāsiddheḥ /
dvitīye doṣamāha- anubhūtita iti //

... anubhūtitaḥ // MAnuv_2,2.196d //
viśeṣadarśanaṃ mānaṃ yadi na sthairyadṛk kutaḥ // MAnuv_2,2.197ab //


NYĀYASUDHĀ:
tadidaṃ phalamiti pratyabhijñayā pūrvottarakṣaṇayorabhedasiddherbādhitaviṣayamanumānamiti śeṣaḥ /
bhrāntā pratyabhijñā nābhedaṃ sādhayitumalamiti cet /
tarhi bhrāntaṃ parimāṇabhedadarśanaṃ na bhedasādhanāyālamiti brūmaḥ /
parimāṇabhedadarśanaṃ bādhakābhāvātpramāṇameveti cettatrāha- viśeṣeti //


*8,243*

tarhi sthairyadṛkkuto na mānam /
tasyā api bādhakarahitatvāt /
viśeṣadarśanaṃ bādhakamiti cet /
tarhi sthairyadarśanaṃ kuto na bādhakam /
ato 'nupalabhyamānaviśeṣayo(ranayor)bādhyabādhakabhāvāyogādanyonyapratipakṣatānanubhavāccānyatarapakṣapātaṃ parityajya bhedābhedaviṣayatayaiva vyavasthāpanaṃ yuktam /
anyathā dṛṣṭānte sādhyasandehenāpi parānumānaṃ duṣyaṃ syāditi /
evaṃ tarkāṅgāntaravaikalyaṃ svayamūhanīyam /


*8,244*

nanvetāni sūtrāṇi kuto vyutkrameṇa(mato)vyākhyātāni /
ucyate /
upodghātaprakriyayā sūtrakāreṇaivādau bādhakāni nirākṛtyānte niṣkaṇṭakā pratyabhijñopanyastā /
bhāṣyakāreṇa tu subodhatvāya śiṣyākāṅkṣākrameṇādau pratyabhijñāmabhidhāyānantaraṃ tadbādhakāni parihṛtānīti /


*8,245*

duḥkhābhāvaṃ sukhaṃ cāhuriti yadanūditaṃ tannirākaroti- digiti //

diksukhe ca khadṛṣṭāntād bhāvau saccet kvacid bhaved // MAnuv_2,2.197cd //

NYĀYASUDHĀ:
svadṛṣṭāntādityākāśasya bhāvatve yo nyāyo 'bhihitastasmāditi hetvatideśaḥ /
dharmipratiyoginirapekṣameva vidhirūpeṇa pratīyamānatvādityarthaḥ /
sadbhāvaḥ kvacidbhaveccettaddṛṣṭānteneti śeṣaḥ /
anenānyathā rūpādināmapi bhāvatvaṃ na syādaviśeṣāditi bādhakaṃ sūcayati /
yadyapi diśo nākāśādbhidyante /
tathāpyākāśasya bhāgasadbhāvaṃ jñāpayituṃ tāsāṃ grahaṇam /
ekavacanaṃ tu jātyabhiprāyam /

etenākāśe cāviśeṣāditi sūtraṃ prakārāntareṇa vyākhyātaṃ bhavati /
ākāśādīnāṃ bhāvatvasamarthanena pañcaskandhātmakaṃ viśvamiti nirastam /
ātmano jñānātmakatvaṃ tu nāsmākaṃ aniṣyam(viruddham) /
kṣaṇabhaṅgitāyā nirastatvāt /
jñānasyāpi grāhakatāyāḥ pareṇābhyupagatatvāt /
mokṣastu caturthe parīkṣiṣyate /


*8,247*

syādetat /
vaibhāṣikasautrāntikayoryaḥ sādhāraṇaḥ svamataviruddhaḥ siddhāntaḥ sa eva nirākṛtaḥ /
yastu sautrāntikasya siddhāntaviśeṣaḥ"pramāṇaṃ tāvadvividham /
prameyadvaividhyāt /
tatra jñānātiriktaḥ sarve 'pi rūpādiprapañco 'numeya eva na tu pratyakṣaḥ /
jñānaṃ (tu) nīlādyākāraṃ pratyakṣavedyam'; iti /
sa kasmānna nirākṛta ityata āha- viśvamiti //

viśvaṃ pratyakṣagaṃ tyaktavā tayoryo 'numitaṃ vadet /
māyāvādivadevāsāvupekṣyo bhūtimicchatā // MAnuv_2,2.198 //


NYĀYASUDHĀ:
tayoḥ vaibhāṣikasautrāntikayormadhye yaḥ sautrāntiko viśvaṃ rūpādikaṃ pratyakṣagaṃ tyaktvā rūpāderviśvasya pratyakṣavedyatāṃ vaibhāṣikādibhirabhyupagatāmanabhyupagamyeti yāvat /
anumitaṃ vadet rūpāderviśvasyānumānavedyatāmaṅgīkuryāt /
māyāvādinā tulyaṃ vartata iti māyāvādivat /
etaduktaṃ bhavati /
yathā sarvānduḥsamayānapākurvatā('pi) sūtrakṛtā na māyāvādo 'tra pāde nirākṛtaḥ /
tasyātyantanirdalasyopekṣaiva kāryā /
na tvīṣatsadalaiḥ sāṅkhayādisamayaiḥ saha nirāsa iti jñāpanārtham /
tathā bāhyānumeyatāvādo 'pīti /
nanu māyāvādaḥ sūtrotpattyuttarakālabhāvī /
tasya kathaṃ nirāsaprasaktiḥ /
maivam /
"anādikālato vṛttāḥ'; ityaktatvāt /
anyathā sāṅkhayādinirāsasyāpyaprasakteriti /
Vyāsa-3


*8,249*

nanvapratiṣiddhamanumānaṃ bhavatīti nyāyena nīlāderviśvasyāpratyakṣatvaṃ sūtrakārasyābhimatameveti kuto na kalpyate /
(naivaṃ) nacaivaṃ śakyam /
pramāṇāviruddhaḥ pramāṇānusārī ca sūtrakārasyābhiprāyaḥ kalpanīyaḥ /
nacāyamarthastathetyāśavānāha- sarveti //

sarvapramāṇasiddhaṃ yad buddherbhedena sarvadā /
kathaṃ nu tasya buddhitvaṃ ... // MAnuv_2,2.199a-c //


NYĀYASUDHĀ:
ayamatrottarakramaḥ /
nīlāderarthasyāpratyakṣatvaṃ na vaktuṃ śakyate /
nīlādipratīteraparokṣatāyāḥ sākṣisiddhatvāt /
indriyavyāpārabhāvabhāvitvenānumānasiddhatvācca /
atha matam /
yenārthena yajjñānaṃ jāyate tat tadākāraṃ bhavati /

tacca jñānaṃ svaprakāśatayā svagataṃ nīlādyākāramapi sākṣātkurute /
ato 'parokṣatayopalabhyamānasya nīlādyākāranikarasya buddhigatatvānna kaściddoṣa iti /
atredamupatiṣṭhate /
yadaparokṣatayāvabhāsamānaṃ nīlādyākāracakraṃ buddherbhedena sarvadā sarvapramāṇasiddham /
tasya kathaṃ nu buddhitvamaṅgīkriyate /
bahirmukhatayedantena hyayaṃ nīlādyākāro 'parokṣamavabhāsate /
na jātvantarmukhatayāhaṃ nīlamiti /
tathā nīlāparokṣajñānasamanantaraṃ nīlārthī niyamena bahiḥ pravartate /
tenānumīyate 'nena bahirartha eva sākṣātkṛta iti /
na hyanyatra jñānamanyatra pravṛttiriti yujyate /
atiprasaṅgāt /
madhye 'numānaṃ tu nirasiṣyate /
evamāpto 'pi kimaparokṣatayā paśyasīti pṛṣṭo 'ṅguliṃ prasāryedamiti bāhyameva bravītyatastribhirapi pramāṇairaparokṣatayāvabhāsamānasya nīlādyākārasya buddhito bheda evāvasīyate /
na cedaṃ sarvaṃ bhrāntam /
kadāpyanyathāpratītyabhāvāt /
vinaiva bādhakena bhrāntitvābhyupagame 'tiprasaṅgāt /
ato 'parokṣatayāvabhāsamāno nīlādyākāro bāhya eva, natu buddhigata iti /


*8,251*

kiñca bāhyārthasyāpratyakṣatve tadasiddhireva syāt /
pramāṇābhāvāt /
tathāca bāhyārthābhyupagamo riktaḥ syādityāha- viśvamiti //

... viśvamanyacca kimpramam // MAnuv_2,2.199d //

NYĀYASUDHĀ:
anyat jñānamiti śeṣaḥ /
kā pramā yasya tat kiṃpramam /
anumeyo bāhyākāra iti cet(na) /
sarvathāsiddhasya pakṣīkaraṇāyogāt /
liṅgābhāvādvayāptyasiddheśca /
syādetat /
buddhigatastāvadākāro 'parokṣamavabhāsate /
sa kādācitkatvātkimapi kāraṇamepakṣamāṇo bāhyaṃ nīlādyanumāpayiṣyatīti /
maivam /
bāhyatayaiva nīlādyākārasya sphuraṇāt /
kutra cedamulabdham, yatkādācitkaṃ tatkāraṇavaditi /
jñāna eveti cet(na) /
bāhyāpratyakṣatvavāde tatrāpi kāraṇatvānavadhāraṇāt /
jñānaṃ pūrvajñānakāraṇakamupalabdhamiti cet /
tarhyākāro 'pi pūrvākārajanyaḥ kalpyatām /
kiṃ bāhyārthavyasanena /
nīlajñānānaṃ(notpādāna)ntaraṃ pītajñānotpādadarśanānneti cet(na) /
sadṛśajanyatvasya pareṇa kvāpyanupa(gantavya)labdhatvāt /


*8,253*

kiñca vāsanādikamāntarameva sahakārīkṛtya visadṛśa(meva)mapi jñānaṃ janayatīti kalpanīyam /
na bāhyam /
dṛṣṭenaiva kathañcidupapattāvadṛṣṭakalpanānupapatteḥ /
ato bāhyo '(pyar)thaḥ pratyakṣasiddha iti śaṅkānāspadatvādidaṃ matamatra na dūṣitamityuktam /
yadvā sphuṭatarānalpadoṣatvena śiṣyaireva heyatayā jñātuṃ śakyatvādityāśayenāha- sarveti //

sarvaloko bibhetyañjo yasmādanubhavāt sadā /
tasyāpalāpinaḥ kiṃ na niṣpramāṇakavādinaḥ // MAnuv_2,2.200 //


NYĀYASUDHĀ:
mādhyamikādayo 'pi bāhyārthā(dvaya)napahnuvānā api hyanubhavādbibhyataḥ sāṃvṛvasattvādyabhyupayanti /
tataḥ sarvairanusaraṇīya evāyamanubhavaḥ /
tamapi yaḥ sautrāntiko 'palapati, anubhavasiddhāyā aparokṣasya nīlā(dyā)kārasya bāhyatāyā apākaraṇāt /
tathā niṣpramāṇakaṃ vadati, nīlādyākārasya buddhisthatāyāṃ pramāṇābhāvāt /
tasya(syāpya) anubhavasya apalāpinaḥ niṣpramāṇakavādinastasya sautrāntikasya kiṃ dūṣaṇaṃ na bhavet /
sarvamapi bhavediti /


*8,254*

"ekatvamanubhūtistham'"khadṛṣṭāntāt'"tasyāpalāpinaḥ'; iti parapakṣe tatra tatrānubhavavirodho 'bhihitaḥ /
sa kathamityato 'bhinayena taṃ darśayati- so 'hamiti //


*8,255*

so 'haṃ tadidamevāhaṃ sukhī sad gaganaṃ diśaḥ /
satyā ityādyanubhavāḥ sadā tatpratipakṣagāḥ // MAnuv_2,2.201 //


NYĀYASUDHĀ:
atra sa evāhamityātmaikatvāgrāhī pratyabhijñānubhavo darśitaḥ /
tadidamityanātmana /
ahaṃ sukhīti sukhasya vidhitvānubhavaḥ /
sat bhāvarūpaṃ gaganaṃ, diśaḥ satyā bhāvarūpā iti gaganasya (ca) diśāṃ ca bhāvatvānubhavaḥ /
ādipadādidaṃ nīlaṃ nāhaṃ nīlamityādeḥ (parigrahaḥ) grahaṇam /
tatpratipakṣagāḥ tadabhyupagatātharviruddhaviṣayāḥ /

vaibhāṣikasautrāntika(mata)samayanirākaraṇamupasaṃharati- ata iti //

ato nirmānamakhilapramāṇapratipakṣagam /
durmataṃ ko nu gṛhṇīyād vināsuratatiṃ kvacit // MAnuv_2,2.202 //


NYĀYASUDHĀ:
akhilapramāṇapratipakṣagaṃ sarvapramāṇaviruddhārthaviṣayam /
ata eva durmatam /
diṅnāgaprabhṛtibhirbahubhirgṛhītatvātkathaṃ ko nu gṛhṇīyādityākṣepa ityata uktam- vineti //
satpuruṣaviṣaya evāyamākṣepa iti bhāvaḥ /
nacaivaṃ nirākaraṇavaiyarthyam /
uktārthānusandhāne ko nu gṛhṇīyāditi vyākhyānāditi /
// iti śrīmannyāyasudhāyāṃ samudāyādhikaraṇam //


___________________________________________________________________________


*8,257*


[======= JNys_2,2.VIII: asadadhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ śūnyavādāpākaraṇam //

// oṃ nāsato 'dṛṣṭatvāt oṃ //
mādhyamikamatamatrāpākriyate /
tasyoktārthaviruddhatāṃ darśayituṃ tattāvadupanyasyati- apara iti //

nāsato 'dṛṣṭatvāt | BBs_2,2.26 |

aparaḥ śūnyamakhilaṃ manovācāmagocaram /
nirviśeṣaṃ svayambhātaṃ nirlepamajarāmaram // MAnuv_2,2.203 //
aśeṣadoṣarahitamanantaṃ deśakālataḥ /
vastutaśca ... // MAnuv_2,2.204a-c //


NYĀYASUDHĀ:
aparo mādhyamikaḥ, "iti brūmaḥ'; iti vakṣyamāṇena sambandhaḥ /
śūnyameva tattvaṃ na tato 'nyadastīti śeṣaḥ /
nanu pañcaskandhāstato 'tiriktāḥ santītyata uktam- akhilamiti //
pañcaskandhātmakamakhilaṃ jagacchūnyameva, na tato 'nyadityatharḥ /
tacchūnyaṃ kutaḥ siddhamityata uktam- svayambhātamiti //
svayaṃbhātatvaṃ ca na svakarmakaprakāśatvam /
kintvaparāprakāśya(śa)tvamevetyāśayenoktam- mana iti //
pramāṇamātropalakṣaṇametat /
kutaḥ pramāṇāviṣayatvaṃ śūnyasya, nirdharmakatvāt /
sadharmaka eva pramāṇapravṛttirityuktam- nirviśeṣamiti //
nikhilajagadātmakaṃ cecchūnyam, tarhi taddharmā lepajarāmaraṇaduḥkhaparicchedādayastasyaiva syuriti kathaṃ nirviśeṣatvādikamityata āha- nirlepamiti //
lepo dharmādharmasambandhaḥ /
doṣā duḥkhādayaḥ /
vastutaścānantaṃ vastvantarapratiyogikānyonyābhāvarahitam /
yadvā śuddhaṃ sarvagataṃ nityaṃ sarvātmakaṃ śūnyamabhilapyate /
tatkathaṃ nirviśeṣa(mu)mityucyata ityata etaduktam /
lepādidoṣābhāvamātreṇa śuddhamucyate /
deśādiparicchedābhāvamādāya sarvagatatvādivādo, natu kamapi dharmamāśrityeti /


*8,260*

upāyopeyabhāvāvasthitapadārthakhyāpanaṃ śāstradharmaḥ /
atastattvaviṣayāṃ vipratipattiṃ darśayitvā vipratipanne upāyopeye darśayati- tadasmīti //

... tadasmīti nityopāsāparokṣitam /
rāgādidoṣarahitaṃ tadbhāvaṃ yoginaṃ nayet // MAnuv_2,2.204c-f //


NYĀYASUDHĀ:
tacchūnyamahamasmīti nityopāsayāparokṣīkṛtam /
tacchūnyaṃ rāgādidoṣarahitaṃ yoginaṃ tadbhāvaṃ śūnyatvalakṣaṇaṃ mokṣaṃ nayediti sambandhaḥ /
yathoktam /
"pradīpasyeva nirvāṇaṃ vimokṣastasya tāyinaḥ(tāpinaḥ) (bhāvinaḥ)'; iti /


*8,261*

yadi śūnyamuktarūpaṃ kathaṃ tarhyakhilaṃ śūnya(mityukta)mityata āha- tasyaiveti //

tasyaivānādisaṃvṛttyā nānābhedātmakaṃ jagat /
sadivābhāti ... // MAnuv_2,2.205a-c //



*8,261f.*

NYĀYASUDHĀ:
śūnyasyaiva /
saṃvriyate 'nayeti saṃvṛtiravidyā /
saṃvṛteḥ satyatve 'dvaitahānirāropitatve tu saṃvṛtyantarāpekṣetyato 'nādītyuktam /
nānābhedātmakaṃ pañcaskandhātmakam /
śūnyāvidyākalpitatvādakhilaṃ śūnyamityucyate /
na punastadeva taditi /
tatkimasadevedam /
tathātve vā kathaṃ saditi pratibhāsaḥ /
sattvāropāt /


*8,263*

pakṣāntaramāha- satyatvamiti //

... satyatvaṃ sāṃvṛtaṃ tasya ceṣyate // MAnuv_2,2.205cd //

NYĀYASUDHĀ:
tasya āropitasya api jagataḥ, sāṃvṛtaṃ satyatvamiṣyate 'to na satpratyayavirodhaḥ /
asti cet jagataḥ sattvaṃ kathaṃ tarhyasat /
yena sadivābhātītyuktamityata āha- pāramārthiketi //

pāramārthikasattvaṃ tu śūnyādanyasya na kvacit // MAnuv_2,2.206ab //

NYĀYASUDHĀ:
sarvathābādhyatvaṃ pāramāthirka(sa)ttvaṃ tadabhāvādasadidaṃ jagadudgīyata iti /
pāramārthikasattvābhāve kathaṃ jagatyarthakriyādivyavahāra ityata āha- sāṃvṛtenaiveti //

sāṃvṛtenaiva satyena vyavahāro 'khilo bhavet // MAnuv_2,2.206cd //

NYĀYASUDHĀ:
akhilo hānopādānopekṣābhijñābhivādanārthakriyālakṣaṇaḥ /
vyavahārasyāpyasattvāt /
svapna iveti śeṣaḥ /
pāramārthikasattvameva vyavahāravirodhi /
tasya sarvakriyārahitatvāt /
natu tadabhāva iti bhāvenoktam- sāṃvṛtenaiva sattveneti //


*8,265*

sṛṣṭipralayaviṣa(yaṃ)ye vigānaṃ darśayati- śūnyāditi //

śūnyāt saṃvṛtiyogena viśvametat pravartate /
sṛṣṭikāle punaścānte stimitaṃ śūnyatāṃ vrajet /
iti brūte ... // MAnuv_2,2.207a-e //



*8,266*

NYĀYASUDHĀ:
sṛṣṭikāle pravartata jāyate /

śūnyasya niṣkriyatvātkathaṃ viśvakartṛtvamityata uktam- saṃvṛtiyogeneti /
ante pralayakāle /
stimitaṃ niṣkriyam /
anena kriyāvibhāgādinyāyena yā viśvasya satyatvavādināṃ pralayaprakriyā sā nirākriyate /
svāpnagajādiriveti śeṣaḥ /

evamupanyastamatanirāsāthartvenādhikaraṇamavatārayati- tamuddiśyeti //

... tamuddiśya jagāda jagatāṃ guruḥ // MAnuv_2,2.207ef //

NYĀYASUDHĀ:
yattāvaduktaṃ śūnyādevedaṃ jagadutpadyata iti tadyathāśrutamapākartuṃ sūtram oṃ nāsato 'dṛṣṭatvāt oṃ iti /
tadvayācaṣṭe- nāsata iti //


*8,267*

nāsato 'dṛṣṭatvāt | BBs_2,2.26 | [second time!]

nāsato jagato bhāvo ... // MAnuv_2,2.208a //

NYĀYASUDHĀ:
asataḥ sarvaviśeṣanirmuktatvena gaganakusumasamānācchūnyājjagato bhāvo janma nopapadyate /
kuta ityata āha- na hīti //

... nahi dṛṣṭāsato janiḥ /
sataḥ kvacit ... // MAnuv_2,2.208bc //


NYĀYASUDHĀ:
sato bhavataḥ kāryasyeti yāvat /
kvacit /
asato janirna dṛṣṭā yataḥ /
atra sarvatra śūnyasyāsattvamāpādya

dūṣaṇābhidhānamiti jñātavyam /


*8,268*

syādetat /
pramāṇābhāvaḥ prameyābhāvaṃ sādhayati /
na punaḥ pramāṇaviśeṣābhāvaḥ /
mā hi bhūdasmadādipratyakṣavyāvṛttyā dharmādyabhāvasiddhiḥ /
tadatrāpi pramāṇābhāvāditi heturvaktavyaḥ /
"adṛṣṭatvāditi'; pratyakṣābhāvakathanaṃ tu katham /
anaikāntikatvādityata āha- pramāṇaṃ ceti //

... pramāṇaṃ ca dṛṣṭirevākhilād varam // MAnuv_2,2.208cd //

NYĀYASUDHĀ:
dṛṣṭiḥ pratyakṣameva akhilāt anumānādagamācca varaṃ pramāṇam /
ayamabhisandhiḥ /
nāsato jagato bhāva iti pratijñāya kuta ityākāṅkṣāyāṃ tatra pramāṇābhāvāditi hetuṃ manasi nidhāya kataṃ tatra pramāṇābhāva iti jijñāsāyāmanumānāgamayoḥ pratyakṣamūlatvena tataḥ pratyakṣameva varaṃ pramāṇamiti, ādāvadṛṣṭatvāditi tadabhāvo 'yaṃ darśito natu pradhānapratijñāyāṃ hetutvena, yenoktadoṣaḥ syāditi /

tarhyanumānādyabhāvo ('pi) vaktavya ityata āha- pramāṇaṃ ceti //
ayamāśayaḥ /
vedādeḥ śūnyavādinā prāmāṇyaṃ nāṅgīkriyate /
tadīyāgamasya tvasmābhirityato nāstyatrāgamaḥ sampratipanna iti śiṣyaireva śakyate jñātum /
pratyakṣābhāvenānumānasyāpyabhāvaḥ siddha eva /
pratyakṣasyānumānopajīvyatvāt /
pratyakṣeṇa kvacidupalabdhameva hyanumānena (kvacitsā)sādhanīyam /
ato 'numānā(dya)bhāvasyānuktāvapi lābhādadṛṣṭatvādityevoktaṃ sūtrakṛteti /
ata eva prāguktam- kvaciditi //


*8,270*

mā bhūcchūnyājjagadutpattau pratyakṣaṃ pramāṇam /
mā ca bhūdāgamaḥ /
tathāpyanumānaṃ bhaviṣyati /
asataḥ sadutpattau pratyakṣābhāvena dṛṣṭānumānānupapattāvapi sāmānyato dṛṣṭasyopapatteḥ /
kāraṇasya hi sattve niṣiddhe 'sata eva janma setsyatītyāśaṅkayānumānānāṃ tarkapratighātaṃ vaktuṃ sūtram- oṃ udāsīnānāmapi caivaṃ siddhiḥ oṃ iti //
tadvayācaṣṭe- yadyevamiti //

udāsīnānām api caivaṃ siddhiḥ | BBs_2,2.27 |

yadyevaṃ saptamarasānmadhurādiva pīnatā /
bhavejjanasya mārjārṛṅgaṃ goriva ghātakam // MAnuv_2,2.209 //


NYĀYASUDHĀ:
yadyasata eva yatkiñcitkāryaṃ jāyeta tadā madhurādiva saptamarasāñjanasya pīnatā syāt /
goḥ śṛṅgamiva mārjārṛṅgamapi janasya ghātakaṃ bhavedaviśeṣādityanena evaṃ satyudāsīnānāṃ heyo(pādeyo)pekṣaṇīyabuddhayaviṣayāṇāṃ saptamarasādīnāmapi sakāśāt pīnatvādikāryasya siddhiḥ prasajyeteti sūtraṃ vyākhyātaṃ bhavati /


*8,273*

prakārāntareṇa vyākhyāti- kāryārthīti //

kāryārthī kāraṇaṃ sacca nopādadyāt kathañcana // MAnuv_2,2.210ab //

NYĀYASUDHĀ:
yadyasata eva kāryamutpadyate tadā paṭādikāryārthī kuvindādiḥ sat tantvādikāraṇaṃ sarvathā nopādadīta /
asata eva paṭādyutpatteḥ /
atiprasaṅgāntaramāha- neti //

na pravarteta ceṣyāya śūnyādeveṣyasambhavāt // MAnuv_2,2.210cd //

NYĀYASUDHĀ:
na kevalamasataḥ kāryotpattau satkāraṇopādānānupapattiḥ /
kintviṣyāya paṭādyutpādāya na pravarteta /
na prayateta ca /
kutaḥ /
śūnyādeveṣyasambhavāt /
etena tantvādyupādānādu(dyu)dāsīnānāṃ cikīrṣādirahitānāṃ ca puṃsāṃ paṭādisiddhiḥ syāditi sūtraṃ vyākhyātaṃ bhavati /


*8,274*

prakārāntareṇa vyākhyāti- deśeti //

deśakālādiniyamo niṃha śūnyāt sato bhavet // MAnuv_2,2.211ab //

NYĀYASUDHĀ:
śūnyātsataḥ śūnyādeva bhavataḥ kāryasya deśakālāvasthāniyamo na bhavet /
tathāhi /
yadi jagacchūnyādeva bhavet tadā godhūmāḥ kṛṣṇabhūmau sampadyante na pāṇḍubhūmau /
vasante kiṃśukāḥ puṣpitā bhavanti /
na varṣāsu /
trihāyiṇyeva gaurgarbhaṃ dhatte nānyathā /
satuṣā eva vrīhayo 'ṅkurānutpādayanti netarathetyādideśakālādiniyamaḥ kāryotpattau na syāt /
śūnyasya sarvatrāviśiṣṭatvāt /
anenodāsīnānāṃ deśakālādiniyamānapekṣāṇāmapi kāryāṇāṃ siddhirutpattiḥ syāditi sūtraṃ vyākhyātaṃ bhavati /
śūnyādeva kāryotpattau kurtrupādānanimittāpekṣā na syāditi samudāyārthaḥ /


*8,275*

nanvādisṛṣṭāveva śūnyātkāryotpādaṃ brūmo na sarvadā /
anyadā tu kartrādikāṇagaṇādeva /
ato nātiprasaṅga ityata āha- puruṣeti //

puruṣecchānusāreṇa yadi kiñcit prajāyate // MAnuv_2,2.211cd //
kiṃ nānumīyate tadvad vastutvāt puruṣād bhavaḥ /
sarvasyāpi ... // MAnuv_2,2.212a-c //


NYĀYASUDHĀ:
kiñcidityadhunātanaṃ kāryam /
vastutvāt kāryatvāt /
sarvasyāpīti /
ādikālīnasyāpi kāryasyetyarthaḥ /
anane nā puruṣaḥ, sataḥ ādikālīnasya kāryasya kartānumātavyaḥ /
kutaḥ /
dṛṣṭatvāt adhunātanānāṃ kāryāṇāṃ puruṣakartṛtvasya niścitatvāditi prathamasūtraṃ prakārāntareṇa vyākhyātaṃ bhavati /
sūtrabhāṣyayoḥ puruṣagrahaṇaṃ tu upādānādyupalakṣaṇam /


*8,276*

nanvidaṃ sarvamapi svavyāhatam /
tathāhi /
yaduktaṃ nāsato 'dṛṣṭatvāditi /
tatsataḥ kāraṇatve 'pi samānam /
nahi sataḥ kāraṇatvamapi kvāpyāvayoḥ sammatam /
nanu ca madhurādiva goḥ śṛṅgamivetyādinā sataḥ sṛṣṭisaṃhārakāritvaṃ nidarśitam /
maivam /
sarvasyāpi jagato 'sattvena tadantaḥpātino madhurāderapi sattvābhāvāt /

yaścāyamatiprasaṅgaḥ"asataḥ kāraṇatve saptamarasāderapi madhurādi(vat) kāryakāritvaprasaṅgaḥ'; iti /
so 'pi sataḥ kāraṇatve tantvādīnāṃ mṛdādikāryakāritvaprasaṅgena tulyaḥ /
tathāpi kāraṇatvamātraṃ sato 'stīti cet (na) /
tatsattvāsammateruktatvāt /
nahi sakalavikriyātītasya kāraṇatvaṃ śakyasambhāvanam /
madhurādīnāṃ saptamarasādīnāṃ cāsattvāviśeṣe 'pi sadbuddhibhāvābhāvābhyāṃ viśeṣāt /

yadapi kāryārthītyādi /
tadīśvarasya sarvakāraṇatve tata eva paṭādisambhavāttantvādyupādānaṃ na syāt /
kuvindādericchādikaṃ ca vyarthaṃ syāditi samānam /
etena deśakālādīti prasaṅgo 'pi samīkṛto veditavyaḥ /
yacca puruṣecchānusāreṇetyuktam /
(tadapi) tanmahadādikāryasya kulālādijanyatāsādhanasamānayogakṣemamiti /


*8,278*

atra yadviśvasyāsattvamuktaṃ tattāvannirākartuṃ sūtram oṃ nābhāva upalabdheḥ oṃ //
iti /
tadvayācaṣṭe- naceti //

nābhāva upalabdheḥ | BBs_2,2.28 |

... nacābhāvo viśvaṃ saditi gamyate // MAnuv_2,2.212cd //
yato ... // MAnuv_2,2.213a //


NYĀYASUDHĀ:
bhavatīti bhāvaḥ /
na bhāvo 'bhāvaḥ /
asaditi yāvat /
saditi gamyate yata ityanena viśvasatyatve pratyakṣaṃ pramāṇamuktaṃ veditavyam /
pratyakṣeṇa sadityanubhūyamānamapi viśvamasaccetko doṣa ityata āha- anubhaveti //

... 'nubhavarodhe tu vacanaṃ vādinaḥ kutaḥ // MAnuv_2,2.213ab //

NYĀYASUDHĀ:
anubhava(vi)rodhe tu kriyamāṇa iti śeṣaḥ /
(tatra) yadi sattvenopalabhyamānamapyasatsyāttadottaraṃ vadatyapi śūnyavāditi noktaṃ tvayetyataste 'pratibheti bruvāṇaṃ paraṃ prati śūnyavādinaḥ svavacanasādha(no)kopāyābhāvātparājaya evāpadyeta /
yadi ca prāśnikādyavagataṃ kathaṃ madvacanaṃ nāstīti brūyāt tadāṅgīkṛtaṃ pratyakṣasya prāmāṇyamiti sattvena tadavagataṃ viśvaṃ katamasatsyāditi /


*8,279*

uktadoṣaparihāraṃ śaṅkate- svapneti //

svapnabhrāntivadevedaṃ saṃvṛttyaivopalabhyate // MAnuv_2,2.213cd //
yadi sattvena ... // MAnuv_2,2.214a //


NYĀYASUDHĀ:
svapnaśca bhrāntiśca tayoriva svapnabhrāntivat /
yadyapi parasya svapno 'pi bhrantireva /
tathāpi gobalīvardanyāyena lokavyavahāramapekṣya pṛthaguktiḥ /
yathā svapne bhrāntau cāsadeva gajādikaṃ sapādikaṃ ca sadityupalabhyate tathāsadevedaṃ viśvaṃ sa(tyatve)ttvenopalabhyate /
etadeva viśvasya śūnyakāraṇatvaṃ nāma /
nāparam /
tatra kathaṃ sadityupalambhena viśvasya sa(tya)tvasiddhiḥ /
nacaivamadhiṣṭhānasya draṣṭuḥ karaṇānāṃ taddoṣāṇāṃ ca sattvamaṅgīkāryam /
anyathā bhrāntivaicitryādyanupapattiriti vācyam /
asatprakāśanaśaktyā saṃvṛtyaiva sarvasyopapattau tadaṅgīkāravaiyathryāt /
evaṃca na vacanāsiddhiḥ /
sāṃvṛtasattvasya vacanasya pratyakṣeṇaiva siddheḥ /
tāvataiva vyavahāropapattau pāramārthikasattvasyopayogābhāvāditi /


*8,282*

etatparihārāya oṃ vaidharmyācca na svapnādivat oṃ //
iti sūtram /
tadvayācaṣṭe- kiñceti //

vaidharmyāc ca na svapnādivat | BBs_2,2.29 |

... kiñcātra bhramo naiva nivartate // MAnuv_2,2.214ab //

NYĀYASUDHĀ:
bhavedevaṃ yadi prapañce rajjusarpādāviva sattvapratyayo bhramaḥ syāt /
nacaivam /
tathātve atra prapañce satvabhramaḥ kimiti naiva nivartate /
jñānānāṃ bhramatvāvadhāraṇaṃ hi bādhabodhādhīnam /
sampratipannasthale tathā darśanāt /
pratyayatvamātrādhīnatve prāgapi bādhabodhodayādrajjusarpādijñāne laukikaparīkṣakāṇāṃ bhramatvāvadhāraṇaṃ syāt /
nacaivaṃ kvaciddṛṣṭam /
naca prapañcasattāvagamasya bādhakaṃ paśyāmaḥ /
tato na bhramatvāvadhāraṇaṃ yuktamiti /
svapnasya bhrāntitvābhāvo, bhramasya cādhiṣṭhānādyapekṣāniyamaḥ, sāṃvṛtasattvasya vyavahāranirvāhakatvasyābhāvaścānyatra samarthito 'trānusandheyaḥ /


*8,284*

syādetat /
kiṃ prapañcapratyayasyedānīṃ bādho nāstītyucyate /
utottarakāle 'pi /
ādye na tāvatā bhavato 'pi viśvasatyatvāvadhāraṇaṃ, śuktirajatādau tadayogāt /
dvitīyastu nāsti /
prapañcapratyayo bādhiṣyate pratyayatvātsampratipannavat /
ityāgāmibādhasiddherityata āha- anāderiti //

anāderasya viśvasya nivṛttiryadi ceṣyate /
nivṛttiśca nivarteta tasyā bhrāntitvasambhavāt // MAnuv_2,2.214c-f //



NYĀYASUDHĀ:
anādito 'nuvṛttasyetyarthaḥ /
viśvasya tatpratyayasya, nivṛttiḥ bādhaḥ /
nivarteta bādhyeta /
yadi pratyayatvātprapañcapratyayasya bādho 'numīyate, tadāvaśyaṃ bādhapratyayasyāpi bādhena bhāvyam /
anyathā pratyayatvahetostatra vyabhicārāpatteḥ /
bādhakapratyayasya bādhyatve prapañcapratyayasya yāthārthyasiddhiḥ /
tiṣṭhatu tāvatparamārthacintā, vyāvahārike tu tathā dṛṣṭameva /
na kevalamidamāpādanaṃ kintu sambhāvitaṃ caitat /
yatprapañcapratyayasya yāthārthyaṃ tannāstitāpratyayasya bādhyatvāt /
anādito 'nuvṛttasyānekasajātīyavijātīyasaṃvāda(va)to yāthārthyasambhavāt /
kādācitkasya saṃvādavidhura(ruddha)tvena bhramatvasambhavāditi /


*8,285*

nanu ca prapañcanivṛttirnāma śūnyameva /
tacca paramārtharūpaṃ na kalpitamadṛṣṭatvāt /
tatkathaṃ tatpratyayasya bādhyatā syāt /
kintu prapañcasya dṛṣṭatvena kalpitatvasambhavāttatpratyaya eva bādhyaḥ /
hetuśca prapañcapratyayatvena vivektavya ityata āha- dṛṣṭasyeti //

dṛṣṭasya bhrāntitā cet syādadṛṣṭe na bhramaḥ kutaḥ // MAnuv_2,2.215ab //

NYĀYASUDHĀ:
bhrāntitābhramaśabdābhyāṃ kalpitatvamucyate /
idamuktaṃ bhavati /
viparatīmetaduktaṃ yatsarvapramāṇadṛṣṭasya prapañcasya kalpitatvamādāya tatsattāpratyayasya bādhyatvasvīkaraṇam /
kenāpi pramāṇenādṛṣṭasya śūnyasyākalpitatvaṃ gṛhītvā tatsattvapratyayasyābādhyatvopādānam /
prāmāṇikamakalpitam aprāmāṇikaṃ cāṅgīkriyamāṇaṃ kalpitamiti sarvasammatatvāditi /


*8,286*

etadeva dṛṣṭāntena darśayati- gavāmiti //

gavāmaśṛṅgibhāvena nahi syācchaśaśṛṅgitā // MAnuv_2,2.215cd //

NYĀYASUDHĀ:
aśṛṅgibhāvena sahiteti śeṣaḥ /
kaścidgavāṃ śṛṅgitavamastītyāha- kaścicchaśasyeti /
tatra paroktarītyā gavāṃ śṛṅgitā kalpitā, dṛṣṭatvāt /
śaśaśṛṅgitā tvakalpitādṛṣṭatvāditi syāt /
na hyevaṃ loke pratītiḥ lokānusāreṇaiva ca paramārtho boddhavyo nānyathā /
lokanyāyasyaiva tadbodhopāyatvāditi /


tadevaṃ pratyakṣabalena viśvasatyatā sādhitā /
tadbādhakaśaṅkā ca parihṛtā /
tataḥ kiṃ siddhamityato yaduktaṃ pūrvapakṣiṇā sato 'pi kāraṇatve pramāṇābhāva iti tatparihṛtamiti vadansamīkaraṇāntaramapi pariharati- asmākaṃ tviti //

asmākaṃ tu pramāṇena prasādādīśvarasya ca /
uktabhaṅgayā'gamānāṃ ca prāmāṇyād yujyate 'khilam // MAnuv_2,2.216 //



*8,286f.*

NYĀYASUDHĀ:
satkāraṇatvavādinām akhilaṃ pareṇākṣiptaṃ yujyate /
katham /
bādhavidhureṇa pramāṇena jagataḥ satyatvasiddhau madhurādīnāṃ puṣyayādikāraṇānāṃ sattvasiddheḥ /
tantvādīnāṃ ca vicitrasvabhāvatayā pramāṇena siddhānāṃ na mṛdādikāryakāritvaprasaṅgaḥ /
nahi sata ivāsato 'pi svabhāvabhedo 'sattvavyāghātāt /
pramāṇenaiva sataḥ kāraṇatvopalabdheranupapattirābhāsabhūtaiva /
pramāṇena sattayā pramitānāṃ madhurādīnāṃ sadbuddhimātravailakṣaṇyakalpanā tyayuktaiva /
anyathā sadbuddhayāvagatātsaptamarasādapi pīnatā satī syāt /
īśvarasya sarvakāraṇatve 'pi tantvādyapekṣā puruṣaprayatnādyapekṣā deśakālādiniyamaśca yujyata eva /
tantvādyapekṣayaiva kāryamutpadyatāmitīśvarasya prasādāt saṅkalpāt /
nacaivaṃ nirviśeṣasya śūnyasya saṅkalpo yujyate /
nacaitadaprāmāṇikam /
ārambhaṇādhikaraṇoktarītyātrāgamānumānādīnāṃ pramāratvāt /
naca vedādyāgamaprāmāṇyamasiddham /
prathamasūtroktarītyā'gamaprāmāṇyasya siddhatvāt /
anumāne 'tiprasaṅgo 'pyāgamaprāmāṇyenaivāpāsta iti /
brahmādīnsṛṣṭayādāvīśvarasteṣu kṛpayāpekṣate parameśvaraniyogānuṣṭhāne teṣāṃ paramapuruṣārthalābhāditi jñāpayituṃ prasādādityuktam /


*8,289*

prāgviśva(sya)satyatvasādhanāyopanyastasya pratyakṣasyānyathāsiddhimāśaṅkaya tatparihāratvena vaidharmyācca na svapnādivaditi sūtraṃ vyākhyātam /
idānīṃ viśvamithyātve parābhihitasya anumānasya dūṣakatvenāpi (tadvayā)vyākhyātuṃ mithyātve 'numānaṃ tāvacchaṅkate- dṛśyatvāditi //

dṛśyatvād vimaṃta mithyā svapnavacced ... // MAnuv_2,2.217ab //

NYĀYASUDHĀ:
sarvaṃ mithyetyukte sampratipannamithyātve śuktirajatādau siddhasādhanatā, śūnye bādhaḥ (ca) syāt /
ataḥ satyatvamithyātvābhyāṃ vimatamityuktam /
vimataṃ gaganādikaṃ mithyā dṛśyatvāt svapnavadityanumānena viśvamithyātvasiddheḥ kathaṃ (tatsa)satyatvamaṅgīkriyata ityarthaḥ


*8,291*

dūṣayituṃ pṛcchati- iyaṃ ceti //

... iyaṃ ca mā // MAnuv_2,2.217b //

NYĀYASUDHĀ:
tiṣṭhatu tāvadviśvam /
iyaṃ ca mā idameva dṛśyatvānumānam /
mithyā satyaṃ (tyā ve) veti śeṣaḥ /
ādyaṃ dūṣayati- mithyeti //

mithyā cet sādhyasiddhir na ... // MAnuv_2,2.217c //

NYĀYASUDHĀ:
nahi śabde 'vidyamānena cākṣuṣatvena śabdānityatvaṃ siddhayatīti bhāvaḥ /
dvitīye dṛśyatvaṃ dṛśyamadṛśyaṃ vā /
prathamaṃ dūṣayati- vyabhicāra iti //

... vyabhicāro na ced bhavet // MAnuv_2,2.217d //

NYĀYASUDHĀ:
dṛśyatvaṃ mithyā na cedatha ca dṛśyam /
tadā (dṛśyatvasya) dṛśyatva eva vyabhicāro bhavet /
dvitīye tvajñānāsiddhatā hetoriti bhāvaḥ /


*8,292*

syādetat /
mithyaiva dṛśyatvamiti brūmaḥ /
nacaivaṃ sādhyāsādhakatvam /
varṇadairghyādīnāṃ mithyābhūtānāmapi sādhakatvasyobhayasiddhatvāt /
cākṣuṣatvādīnāṃ tvāropābhāvāt /
ārope 'pyasāṃvyāvahārikatvādasādhakatvaṃ, na tu mithyātvādityata āha- sādhakatvamiti //

sādhakatvamasatyasya sādhyaṃ vipratipattitaḥ // MAnuv_2,2.218ab //

NYĀYASUDHĀ:
yatrodāharaṇe mithyātvaṃ sampratipannaṃ tatra sādhakatve, yatra ca sādhakatvaṃ saṃmataṃ tatra mithyātve vipratipattito 'satyasya sādhakatvaṃ sādhyameva, na punarasmākaṃ siddhamiti /


*8,293*

vipratipattau sādhakatvaṃ mithyātvaṃ vā sādhayiṣyāmīti cet /
kiṃ satyena pramāṇenota mithyābhūtena /
ādye tūktamevottaram /
dvitīye doṣamāha- tasya ceti //

tasya ca- ... // MAnuv_2,2.218c //

NYĀYASUDHĀ:
nahi kvāpyasmākaṃ mithyābhūtasya sādhakatvaṃ sammatam /
atastasyāpi sādhakatvaṃ sādhyameva /
tasyāpi sādhakatvaṃ sādhayiṣyāmītyata āha- itīti //

... ityanavasthā syāt ... // MAnuv_2,2.218c //

NYĀYASUDHĀ:
pūrvoktaprakāreṇetyarthaḥ /
nahi sarvamasatyaṃ sādhakamityekaṃ pramāṇamasti /
nāpi sadvādī kadāpi sattvāsattvodāsīnena pramāṇena sādhyasiddhimaṅgīkuryāt /
yenānavasthāśāntirbhavediti /


*8,294*

evamasiddhivyabhicārābhyāmanumānaṃ nirākṛtya pramāṇabādhaṃ cāha- sattvaṃ ceti //

... sattvaṃ cāsyānubhūtitaḥ // MAnuv_2,2.218d //

NYĀYASUDHĀ:
asya prapañcasya /
anubhūtitaḥ siddhamato bādhitaviṣayaṃ cānumānamiti śeṣaḥ /
na kevalaṃ dṛśyatvānumānasyānena doṣeṇābhāsattvaṃ, kintu yadanyadapi prapañcamithyātve 'numānaṃ jaḍatvaṃ vā paricchinnatvaṃ vā parairucyate tasyāpītyāha- anubhūtīti //

anubhūtivirodhena mithyātve mā na kācana // MAnuv_2,2.219ab //

NYĀYASUDHĀ:
upalakṣaṇametat /
pūrvoktavyabhicārāsiddhibhyāṃ cetyapi draṣṭavyam /
tathāhi /
jaḍatvādikaṃ satyaṃ mithyā vā /
ādye jaḍatvādimanna vā /
prathame vyabhicāraḥ /
dvitīye 'pasiddhāntaḥ /
mithyā cetsādhyasiddhirneti /


*8,295*

bhavedasattvamanumānānāṃ yadyanubhavavirodho bhavet /
na cāsāvasti, mithyātvāparaparyāyaṃ bādhyatvaṃ hyanumānasādhyam /
naca tadabhāvaḥ pratyakṣeṇa vedyaḥ /
tasya vartamānamātraviṣayatvena kathañcidvartamānakālīnābādhābhāvaviṣayatve 'pi kālāntara(gata)bhāvibādhābhāvaviṣayatvāyogādityata āha- atīteti //


*8,296*

atītānāgatau kālāvapi naḥ sākṣigocarau // MAnuv_2,2.219cd //

NYĀYASUDHĀ:
atrātītagrahaṇaṃ prāsaṅgikam /
na kevalaṃ vartamāna ityaperarthaḥ /
naḥ sarveṣām /
anyathā tadviśiṣṭavyavahārānupapa(tte)ttiriti bhāvaḥ /


*8,297*

kimato yadyevamavartamāno 'pi kālaḥ sākṣigocara ityata āha- taditi //

tatsambandhitayā sattvamapi ... // MAnuv_2,2.219ef //

NYĀYASUDHĀ:
kālāntarasambandhitayā sattvamabādhyatvam /
na kevalaṃ vartamānakālīnabādhābhāvo 'nubhavavedyaḥ /
kintu sarvakālagato 'pītyarthaḥ /
tatkathamityata uktam- dṛṣṭasyeti //

... dṛṣṭasya sākṣigam // MAnuv_2,2.219f //

NYĀYASUDHĀ:
pratyakṣādipratītiviṣayasya /
pratyakṣādipratītīnāṃ prāmāṇyasya sākṣiṇā grahaṇāditi bhāvaḥ /


*8,298*

nahi viṣayasya traikālikābādhyatvamanantarbhāvya tatpratīteḥ prāmāṇyaṃ śakyagrahaṇam /
yadi pratītiṃ gṛhṇan sākṣī tatprāmāṇyagrahaṇasvabhāvatvāttadgṛhṇaṃstadviṣayasya traikālikābādhyatvaṃ vyavasthāpayettadā śuktirajatādipratīterapi sa eva grāhaka iti tasyā api prāmāṇyaṃ gṛhṇīyāt /
tathāca tadviṣayasyāpi rajatādestraikālikābādhyatvaṃ siddhayedityato dṛṣṭaśabdaṃ vyākhyāti- dṛḍheti //

dṛḍhadṛṣṭaṃ tu yad dṛṣṭaṃ dṛṣṭābhāsastato 'param // MAnuv_2,2.220ab //

NYĀYASUDHĀ:
yannirdeṣatvenāvadhṛtayā pratītyā viṣayīkṛtaṃ, tadeva dṛṣṭamityuktam /
kutaḥ /
itarasya sammugdha(sya)dṛṣṭasya dṛṣṭābhāsatvāt /
mukhyāmukhyayośca mukhyagrahaṇasya nyāyyatvāt /
kṛtavyutpādanaṃ caitatprāk /


*8,299*

satpratipakṣāṇi ca dṛśyatvādyanumānānītyāśayavānāha- bhrānteriti //

bhrānteḥ saṃvṛtisatyasya viśeṣo 'vyabhicāravān /
tenāpyaṅgīkṛtaḥ samyak sa naḥ satyatvameva hi // MAnuv_2,2.220d-f //



*8,299f.*

NYĀYASUDHĀ:
bhrāntiviṣayatvena sampratipannācchuktirajatādikādityarthaḥ /
saṃvṛtisatyasya tathātvenābhyupagatasya viśvasya viśeṣo vailakṣaṇyam avyabhicāravān kadācitkvacidapi sampratipannamithyābhāve avartamānaḥ /
tena śūnyavādināpi, samyagiti asandehena /
sa eva viśeṣo, naḥ asmākaṃ mate viśvasya satyatvaṃ sādhayiṣyatīti śeṣaḥ /
tataḥ satpratipakṣāṇi dṛśyatvādyanumānānīti /
atra tenāpi samyagaṅgīkṛta ityanena pakṣadharmatā samarthitā /
avyabhicāravānityanena tu vyāptiḥ /
ayamatra prayogaḥ /
viśvaṃ kālatrābādhyam, prātītikavilakṣaṇatvāt /
vyatirekeṇa śuktirajata(tādi)vaditi /


*8,300*

nanu ca śuktirajatādīnāṃ prāk śūnyatattvajñānācchuktyādijñānenaiva nivṛttiḥ bhavati /
prapañcasya tu śūnyajñānena kadācinnivṛttirbhaviṣyatītyevaṃ mayā prātītikasāṃvṛtayoḥ vailakṣaṇyamaṅgīkṛtam /
nacedaṃ viśvasatyatve bhavatā hetūkartuṃ śakyam, virodhādityata āha- vijñānāditi //

vijñānād vyabhicāro 'sya kadācit syāditi pramā /
naiva dṛṣṭā ... // MAnuv_2,2.221a-c //


NYĀYASUDHĀ:
vyabhicāro nivṛttiḥ /
nāyaṃ viśeṣo 'ṅgīkartuṃ śakyate, aprāmāṇikatvāt /
na hyaprāmāṇikena śṛṅgeṇāśvo 'nyato vi(śi)śeṣyamāṇo dṛśyata iti /
nanvidaṃ kadācidbādhiṣyate dṛśyatvācchuktirajatādivadityanumānasya sattvātkathamatra pramāṇābhāva ityataḥ (tasyo)svoktaṃ doṣaṃ smārayati- prameti //

... pramā sā ca na bhavet svavirodhataḥ // MAnuv_2,2.221cd //


NYĀYASUDHĀ:
yā ca śaṅkayate setyarthaḥ /
svavirodhata iti /
svaviṣayasya svasya ca bādhyatvāpādakatvādityarthaḥ /
anyathā vyabhicārāpatteḥ /
yasya viṣayo 'san(yat)svayaṃ ca bādhyaṃ, kathaṃ tatpramāṇaṃ bhavet /
ato 'sya viśeṣasyāprāmāṇikatvenāṅgīkartumaśakyatve yo 'nyo viśeṣaḥ prāmāṇikaḥ pramāṇāvirodhī cāṅgīkartavyaḥ, so 'smākaṃ satyatve heturbhaviṣyatīti /
sa ca pramāṇagamyatvamarthakriyākāritvaṃ ceti hṛdayam /


*8,301*

nanu tarhyevameva kuto nocyate /
tathocyamāne pramāṇānāṃ tattvāvedakatvamatharkriyāyāḥ sattvamasati tadabhāva ityādi bahu saṃvidheyaṃ syāt /
lāghavārthaṃ tvevamuktaṃ, tadapi yathāvasaramupapāditameva /


*8,303*

yadvā prapañcasyābādhyatve pariśeṣapramāṇamanenoktam /
tathāhi /
jagato bādhyatvamabādhyatvaṃ ca prasaktam /
tṛtīyaprakārābhāvāt /
bādhyatvaṃ ca prasiddhapadārthatattvajñānena, anyena vā /
tatrādyaṃ vādiprativādibhyāmanabhyupagamāt /
dvitīyaṃ tu pramāṇābhāvanirastam /
pariśeṣādabādhyatvameva siddhayatīti /

athavā vyāpakānupalabdhiliṅgakamanumānam(anena)etena ślokadvayenoktam /
bādhyatvaṃ hi prasiddhapadārthataditaratattvajñānanivatyartvena vyāptam /
tacca vyāpakamanabhyupagamapramāṇābhāvābhyāṃ jagato vyāvartamānaṃ svavyāpyaṃ bādhyatvamiti vyāvartayati /
JOSHI-4


*8,304*

evaṃ prapañcamithyātvānumānāni nirākṛtyedānīṃ tadanugrāhakatvena, satyatvapratyakṣasya pratikūlatvena ca parotprekṣitaṃ tarkamapi nirākartumāśaṅkate- bheda iti //

bhedo viśeṣyadharmyādigrahaṇāpekṣayā yadi /
anyonyāśrayatāhetordurgāhya iti yan ... // MAnuv_2,2.222a-d //


NYĀYASUDHĀ:
ādipadena viśeṣaṇapratiyāginorgrahaṇam /
yadi gṛhyata iti śeṣaḥ /
tarhīti ca /
ayamarthaḥ /
yadi prapañco sāṃvṛto na syāttadā pratyakṣo 'pyasau na syāt /
tathāhi /
anekamedabhinno hi prapañca iṣyate /
bhedasya cāpratyakṣatāyāṃ so 'pyapratyakṣa eva /
vinā bhedena tatpratītāvadvitīyaśūnyapratītyāpatteḥ /
naca bhedapratītirupapadyate /
bhedo hi pratīyamāno ghaṭapaṭau bhinnāviti ghaṭapaṭayovirśeṣaṇatayā, ghaṭapaṭayorbheda iti tābhyāṃ viśeṣyatayā vā pratyetavyaḥ /
bheda ityeva pratīterabhāvāt /
yadvā ghaṭātpaṭo bhinna iti, ghaṭātpaṭasya bheda iti vā ghaṭapratiyogitayā paṭadharmikatayā ca bhedagrahaṇameṣyavyam /
tatrobhayatrāpyanyonyāśrayatvaṃ, viśeṣyayorghaṭapaṭayorjñāne sati hi tadviśeṣaṇatayā bhedo jñātavyaḥ /
nahi devadattādarśane daṇḍasya tadviśeṣaṇatayā darśanaṃ yujyate /
viśeṣyajñānaṃ ca bhedāpekṣam /
nahi bhedāpratītau ghaṭapaṭāviti dvitvaviśiṣṭārthapratītiḥ sambhavati /
evaṃ viśeṣyatayā bhedapratītāvapi draṣṭavyam /
tathā dharmipratiyogijñāne sati bhedajñānam tannirūpyatvāt /
bhedajñā(na eva)ne sati ca dharmipratiyoginorjñānam /
nahi bhedāgrahe dharmipratiyogibhāvo 'vagantuṃ śakyate /
tathātve ghaṭādghaṭasya bheda(ityapi) pratītiḥ syāt /
naca parasparāśrayāṇi kāryāṇi sambhavanti /


*8,305*

ato vāstavatve bhedasya pratītyanupapattau prapañcasyāpi tadāpatteravicāritaramaṇīyaḥ saṃvṛtibhaya evāyamaṅgīkaraṇīya iti /
nirākaroti- neti //

... na tat // MAnuv_2,2.222 //



*8,310*

NYĀYASUDHĀ:
yaduktaṃ bhedasya durgrāhyatvaṃ tannāstītyarthaḥ /
tatkathamityata āha- svarūpamiti //

svarūpaṃ vastuno bhedo ... // MAnuv_2,2.223a //

NYĀYASUDHĀ:
yat yasmādbhedo vastunaḥ svarūpaṃ tasmāt tasya vastuno gra(he)haṇe sati paścādbhedagraha iti nāsti /
kintu vastugraha eva bhedagrahaḥ /
tathāca kvānyonyāśrayatvaṃ yena bhedo durgrahaḥ syāditi /

... yanna tasya grahe grahaḥ // MAnuv_2,2.223b //


NYĀYASUDHĀ:
yasmādvastuno grahe tasya bhedasyāgraho nāsti tasmādbhedo vastunaḥ svarūpamiti sambandhaḥ /
ayamatra prayogaḥ /
vimato bhedo ghaṭasvarūpaṃ bhavitumarhati ghaṭagrahe 'gṛhyamāṇatvarahitatvāt ghaṭasvarūpavadeveti /

yadi atra tasya grahe gṛhyamāṇatvādityevocyeta tadā ghaṭapaṭāviti ghaṭajñānena jñāyamānena paṭenānaikāntikatvaṃ syāt /
tadarthaṃ"tasya grahe 'graho na'; ityuktam /
nahi ghaṭagrahe gṛhyamāṇo 'pi paṭo ghaṭagrahe sarvathā gṛhyata eveti niyamo 'sti /
yajjñāne yatsarvathopalabhyate tattatsvarūpamiti vyāptāvucyamānāyāṃ daṇḍijñāne daṇḍo 'pyavaśyaṃ sphuratyeva /
nacāsau daṇḍinaḥ svarūpamityato viśeṣaniṣṭhaiva vyāptirabhidhātavyā /


*8,311*

kiñca viśiṣṭaṃ nāma viśeṣaṇasambandhanimitto viśeṣyasyākārabheda iti pī na viśiṣṭapratyaye viśeṣaṇasphuraṇamasti /
kinnāma viśeṣaṇajñānaṃ viśiṣṭajñānakāraṇam /
āśubhāvācca na kramo lakṣyate /
yadvā ghaṭabhedau pakṣīkṛtya niyamenānyatarapratītāvanyatarasya sphuraṇenānyonyābhinnatvaṃ sādhyam /
nahi daṇḍipratītau daṇḍa(sya)sphuraṇe 'pi, daṇḍapratītau sarvathā daṇḍi(naḥ)sphuraṇamastīti /


*8,314*

bhavedetadyadi bhedo vastugraha eva gṛhyeta /
nacaivam /
kinnāma vastupratītyuttarakālameva /
nirvikalpake (hi) ca pratyaye vastumātramavabhāsate /
bhedasta vastudarśanottarakālaṃ pratiyogismaraṇe satyavabhāsate /
yathā sādṛśyamabhāvaścetyata āha- anyatheti //

anyathāsyāmunā bheda iti vaktuṃ na yujyate // MAnuv_2,2.223cd //

NYĀYASUDHĀ:
yadi bhedo vastupratītau na pratīyeta tadāsyāmunā bheda ityuttarakālaṃ savikalpaka(vi)jñānamapi na jāyeta /
tathāca tathā vyavahāro 'pi na syāt /
asyāmuneti (hi) dharmipratiyogitayā vastudvayamuddiśya bhedo jñāyate /
na cāgṛhītabhedaṃ tathoddeṣyuṃ śakyate /
ekasminnapi tatprasaṅgāt /
bhedasattāmātreṇa tadupapattiriti cet(na) /
dūrasthavanaspatyorabhedapratyayābhāvaprasaṅgāt /
doṣāttatra tatheti cenna /
bhedasya svarūpasattayaivopayoge doṣasyākiñcitkaratvāditi /


*8,316*

na kevalaṃ vastudarśane bhedasphuraṇamanabhyupagacchato 'syāmunā bheda iti paścātkālīnaṃ savikalpakajñānaṃ tathā vyavahāraśca nopapadyate /
kiṃ tarhītyata āha- agṛhīta iti //

agṛhīto yadā bhedastadā svasmāditi grahaḥ /
syāt ... // MAnuv_2,2.224a-c //


NYĀYASUDHĀ:
yadi ghaṭadarśane 'pi tadbhedo na dṛṣṭastada(dā)nantaraṃ smaryamāṇaro gṛhyamāṇo vā pratiyogī paṭo 'pi vinā bhedenopalabdhavyaḥ /
bhedādarśane cāvaśyamabhedajñānaṃ syāt /
tathā cottarakālaṃ svasmātsvayaṃ bhinna iti savikalpako bhedagrahaḥ syāditi /
asvevamityata āha- pratītīti //

... pratītivirodhācca ... // MAnuv_2,2.224c //

NYĀYASUDHĀ:
caśabdasyottaratra sambandhaḥ /
paṭādghaṭo bhinna ityeva hi savikalpikā pratītiranubhūyate /
na jātu svasmātsvayaṃ bhinna iti /
ataḥ pratītivirodhādevaṃvidhaḥ savikalpakagraho nāṅgīkartumucita iti śeṣaḥ /
kiñca yadi svasvātsvayaṃ bhinna iti savikalpako bhedagrahaḥ syāt /
tadā kadācittathāvidho vāgvyavahāro 'pi syāt /
nacaivamityāha- nahīti //

... nahi kaścit tathā vadet // MAnuv_2,2.224d //


*8,317*

NYĀYASUDHĀ:
etena kimikapratītivirodhaḥ uta sarvapratītivirodhaḥ /
nādyo vyabhicārāt /
na dvitīyaḥ /
asiddherityapi parāstam /
kadāpi kasyacidapi tathā vyavahārābhāvena viparītavyavahāreṇa ca sarvapratītisiddheriti /
ato vastupratītāveva bhedasya sphuraṇāttatsvarūpatvameveti /


*8,318*

nanvevaṃ bhedasya vastusvarūpatvena tatpratītibhedābhāvāditaretarasāpekṣatvasya sutarāmabhāvānnānyonyāśrayatvamityuktam /
tatra kiṃ bhedo dharmiṇaḥ svarūpam, uta pratiyogino 'pi /
na tāvaddvitīyaḥ /
ekasyaiva bhedasyobhayasvarūpatve 'dvaitaprasaṅgāt /
ādye tu yadyapi dharmijñānabhedajñānayornānyonyāśrayatvam /
tathāpi pratiyogijñānāpekṣayānyonyāśrayatvaṃ kathaṃ pariharaṇīyam /
maivam /
bhedasya svarūpato jñāne pratiyogiviśeṣajñānānapekṣaṇāt /
pratiyogisvarūpajñāne caitadbhedajñānānapekṣaṇāt /
astu tarhi viśeṣajñāne 'nyonyāśrayatvam /
taddhi ghaṭātpaṭo bhinna ityutpadyate /
tatra dhamirṇo bhedena pratipannasya vā pratiyogitā, anyathā vā /
natāvaddvitīyaḥ /
svato 'pi bhedapratītyāpatteḥ /
ādye pratiyogisvarūpabhedapratītau dharmiṇaḥ pratiyogitāyāṃ sa eva nyāyaḥ /
tathāca paṭādghaṭasya bhedapratītau ghaṭātpaṭasya bhedapratītirityanyonyāśrayatvamiti /
maivam /
vastuto 'nyonyapratiyogikayorghaṭapaṭasvarūpabhedayoḥ pratītayoḥ satorasati sādṛśyādau pratibandhake 'nyonyapratiyogikatayā viśiṣṭabhedapratītau bādhakābhāvāditi /


*8,321*

evaṃ svamatena bhedapratītāvanyonyāśrayatvaṃ parihṛtya bhinnabhedavādināṃ parihāramāha- dharmitveti //

dharmitvapratiyogitvatadbhedā yugapad yadi /
viśeṣaṇaṃ viśeṣyaṃ ca tadbhāvaścaiva gṛhyate // MAnuv_2,2.225 //


NYĀYASUDHĀ:
upalakṣaṇaṃ caitat /
dharmipratiyoginau ce(tyapi)ti draṣṭavyam /
tadbhāvo viśeṣaṇatvaṃ viśeṣyatvaṃ ca /
atra viśeṣaṇaviśeṣyayoranyataratvādbhedasya pṛthaggrahaṇābhāvaḥ /
ayamarthaḥ /
kiṃ nirvikalpakapratītāvanyonyāśrayatvamucyate uta savikalpakapratītau /

nādyaḥ /
tatra dharmipratiyogisvarūpayostadbhāvayostadbhedasya bhedayorvā yugapa(dubhaya)davabhāsanāt /
tathā viśeṣaṇa(viśeṣya)bhūta(bhāva)yorghaṭapaṭayorbhedasya ca tadbhāvayośca yugapatpratīteḥ /
yugapadeva

sarvasyendriyasannikṛṣṭatvāt /

darśanayogyatvācca /
nanu dharmipratiyoginorviśeṣaṇaviśeṣyayo(śca)ḥ tadbhāvo 'paro bhinnabhedavādibhirneṣyate /
tatkathametat /
maivam /
bhūṣaṇakārādibhistasyāṅgīkṛtatvāt /
teṣāmeva cāyaṃ parihāra iti /
nanu yatra pratiyogī paścātpratīyate tatra yugapadavabhāso nāstīti taddṛṣṭāntena sarvatrāpyevamanumīyata iti cenna /
asannihitavatsannihitasyāpyajñānasādhane pratitivirodhāt /
yatra(ca)pratiyogī na sannihitastatrāpi dharmidharmitvabhedānāṃ tāvadyugapatpratītirnānupapannā /
tadidamuktam- ko virodha iti //

ko virodhaḥ ... // MAnuv_2,2.226a //

NYĀYASUDHĀ:
dvitīyaṃ nirākaroti- svarūpeṇeti //

... svarūpeṇa gṛhīto bheda eva tu /
asyāmuṣmāditi punarviśeṣeṇaiva gṛhyate // MAnuv_2,2.226 //



*8,321f.*

NYĀYASUDHĀ:
asyāmuṣmādityupalakṣaṇam /
anayorbhedo bhinnāvimāvityapi grāhyam /
nivirkalpakapratītārthānāmanyonyavaiśiṣyayamātraṃ savikalpakajñāne 'vabhāsate nādhikamiti na tatrāpītaretarāśrayatvamiti /
tathā(cā)hurbhinnabhedavādinaḥ /
ekasyāmeva nirvikalpikāyāṃ saṃvidi bhedasya bhedinośca yugapadavabhāsane sati tatraikaṃ bhedinamava(dhiṃ kṛtvai)dhīkṛtyaitasmādayaṃ bhinna iti savikalpakabodhodayā(tkathama)nna vyatiriktabhedapakṣe 'nyonyāśrayatvamiti /


*8,324*

nanu kimarthamayaṃ paramatopanyāsaḥ /
bhedapārthakyamantareṇa viśeṣapratītāvasmākama(pyevame)pyayameva parihāra iti jñāpanārtham /
tarhīdameva vākyaṃ tathā vyākhyāyatām /
nai(cai)vaṃ (śaṃ)śakyam /
tadbhedaśceti pṛthagbhedagrahaṇavirodhāt /
viśeṣaṇaviśeṣyabhāvena grahaṇamapi na dharmipratiyogiprakārādbhidyata iti vaiśeṣikaparīkṣāyāmuktam /
ato nātra vyutpādanamapi kṛtamiti /


*8,327*

evamāpādakānabhyupagamenānyonyāśrayatvaprasaṅgaṃ nirākṛtyedānīṃ dūṣaṇāntaraṃ pratijānīte- kiñceti //

kiñca ... // MAnuv_2,2.227a //

NYĀYASUDHĀ:
anyaccetyarthaḥ /
kathamiti cet /
kimatra yadi dharmyādipratītyapekṣayā bhedaḥ pratīyeta tadānyonyāśrayatvaṃ syādi(tyā)tyevāpādyate, kiṃvā yadi bhedaḥ pratīyeta tadānyonyāśrayatvaṃ syāditi /

ādye doṣamāha- bheda iti //

... bhedaḥ kathaṃ grāhya iti yaḥ paripṛcchati /
dharmyādibhedagrahaṇāt tenokto 'nyonyasaṃśrayaḥ // MAnuv_2,2.227 //


NYĀYASUDHĀ:
kathamityākṣepe /
paripṛcchatīti mṛdūktiḥ /
ākṣipatīti yāvat /
dharmyādibhedagrahaṇāt dharmyādigrahaṇasāpekṣabhedagrahaṇāt /
kathamidaṃ labhyate /
dharmyādipadasya tadgrahaṇopalakṣaṇatvāt /
ādipadasya ca kāraṇārthasyā'vṛtteḥ /
tadetatparasparaṃ vyāhatamiti śeṣaḥ /
tathāhi /
bhedo durgraha iti pratijñāya tadupapattaye hīdamucyate /
anena ca yadi bhedo dharmyādipratītimapekṣya pratīyeta tadānyonyāśrayatvaṃ syāt /
tathāca na pratīyetetyāpādanena pratīyate cāto na dharmyādigrahaṇāpekṣā tatpratītiriti labdhaṃ bhavet /
tathāca"bhedo durgrahaḥ'"pratīyate ca'; ityetayoḥ kathaṃ na pūrvottaravirodha iti /


*8,329*

dvitīye pṛcchāmaḥ /
kiṃ pareṇa kvāpi bhedo na gṛhītaḥ kiṃvā kvacidgṛhīta iti /
ādyaṃ dūṣayati- anyatveti //

anyatvāgrahaṇe proktaḥ kathamanyonyasaṃśrayaḥ // MAnuv_2,2.228ab //

NYĀYASUDHĀ:
yadyanyatvaṃ kvāpi na gṛhītaṃ tadānyonyāśrayatvāpādanameva na śakyam /
nirāśrayatvāt /
taddhi pratītayordvayoḥ kāryakāraṇabhāvāśrayaṇe satyāpadyate /
antato vādiprativādinoḥ dūṣyadūṣakayorāpādyāpādakayorbhedāgrahe 'nutthānamevāpādanasya /
dvitīyaṃ dūṣayati- anyatvamiti //

anyatvaṃ yadi siddhaṃ syāt kathamanyonyasaṃśrayaḥ // MAnuv_2,2.228cd //

NYĀYASUDHĀ:
siddhaṃ pratītam /
anyonyāśrayatve hi bhedapratītireva na syāt /
nahyanyonyāśrayāṇi kāryāṇi kvāpi dṛṣṭāni prakalpyante /
tathācāsti cedbhedapratītiḥ nūnamābhāsabhūtamevedamanyonyāśrayatvamapratibandhakatvāditi /
asti bhedapratītiḥ sā na prameti tu tātparyamiti cenna kimanyonyāśrayatvamanyonyotpādaṃ pratibadhanātīti mataṃ, kiṃvā taddharmam /
ādye kathamapramāpi bhedapratītirutpadyate /
na dvitīyaḥ /
anyayoranyonyāśrayatvamanyattu lupyata ityasyānyāyatvāt /
sāṃvṛtī pra(tīti)tipattiriti cet /
tatkiṃ paṭa; sāṃvṛta iti yebhyastantubhyo jātasteṣāmeva kāraṇaṃ bha(va)viṣyatīti /


*8,331*

nanvanenāsya tarkasya kiṃ dūṣaṇamuktaṃ syādityata āha- etādṛśasyeti //

etādṛśasya vaktārāvubhau jātyuttarākarau /
māyī mādhyamikaścaiva ... // MAnuv_2,2.229a-c //


NYĀYASUDHĀ:
na kevalametajjātyuttaraṃ kintu yadanyadapi tadīyaṃ vacanam /
tathāhi /
bhedasyāpi bhedāntarabhedyatve 'navastheti /
tathā bhinne bhedaniveśaścettenaiva bhedena bhinnatāyāmātmāśrayatvaṃ, bhedāntarāṅgīkāre tvanavasthā /
abhinne bhedaniveśaścetsvato 'pi paṭasya bhedāpattiriti /

tathā na tāvatpratyakṣeṇa bheda eva dṛśyate /
bheda ityeva pratīteranubhavāt /
vastuno 'pi pratītau na tāvadbhedapūrvaṃ vastupratītiḥ /
uktadoṣāt /
nāpi vastupratītipūrvikā bhedapratītiḥ /
abhedena pratīte bhedapratītāvatiprasakteḥ /
naca yugapat /
bhedapratītiṃ prati vastupratīteḥ kāraṇatvena yaugapadyāyogāt /
naca prakārāntaramastīti /

tathā sattāvatkāraṇaṃ vā kāraṇe sattā vā /
ādye kāraṇasyāsattvam /
dvitīye 'sata eva kāraṇatvamityādi /

tatsarvaṃ jātyuttaramiti jñāpayitumetādṛśasyetyuktam /
sarvasyāpi svavyāghātakatvāt /
bhedasya sattāyāśca svarūpātiriktayorayuktayoḥ (ktāyāḥ) (ktatāyāḥ) ayuktāyāḥ) evāṅgīkaraṇācca /

katameyaṃ jātiriti cenna /
sāmānyalakṣaṇasadbhāve 'sya nirbandhasya vyarthatvāt /
ahetuprasaṅganityasamāsvantarbhāvācca /

māyāśabdasya vrīhyāditvānmāyīti sādhuḥ /
śūnyavādinirāse(naiva)na māyāvādo 'pi nirasto veditavya ityatideśajñāpanāya māyī cetyuktam /
evaśabdasyottaratrata sambandhaḥ /

*8,339*

nanvetadanyonyāśrayatvādikaṃ sūtrakṛtaiva kuto na nirākṛtamityata āha- taditi //

... tadupekṣyau bubhūṣubhiḥ // MAnuv_2,2.229d //

NYĀYASUDHĀ:
tasmājjātyuttarākaratvādupekṣyāveva /
natu parihārāya prativādīkartavyau /
etaduktaṃ bhavati /
sadalameva pūrvapakṣivacanaṃ nirākartavyaṃ bhavati na nirdalam /
anyathātiprasaṅgāt /
etacca jātyuttaratvena nirdalamityupekṣitaṃ sūtrakṛtā /
asmābhistu śiṣyavyutpādanāya nirākṛtamiti /

syādetat /
śūnyāvādī śūnyaṃ jagatkāraṇaṃ manyate /
māyāvādī tu brahma /
tatkathaṃ nāsato 'dṛṣṭatvādityādiśūnyavādanirāsāya māyāvāde 'tideśaḥ /
matavaiṣamye 'tideśāsambhavādityata āha- yadīti //

yacchūnyavādinaḥ śūnyaṃ tadeva brahma māyinaḥ // MAnuv_2,2.230ab //

NYĀYASUDHĀ:
tasmādatideśo yukta iti śeṣaḥ /
tatkathamityata āha- nahīti //

nahi lakṣaṇabhedo 'sti nirviśeṣatvatastayoḥ // MAnuv_2,2.230cd //


*8,340*

NYĀYASUDHĀ:
lakṣaṇabhedena hi vipratipanno bhedo bodhanīyaḥ /
nā(cā)sau śūnyabrahmaṇoḥ sambhavati /
dvayorapi nirviśeṣatvāṅgīkārāt /

nanu nirviśeṣatvena bāhyalakṣaṇabhedābhāve 'pi satyajñānānantānandātmakatvaṃ brahmaṇaḥ svalakṣaṇaṃ māyāvādināṅgīkṛtam /
na śūnyasya śūnyavādinā /
tena brahmaśūnyayorbhedo bhaviṣyatītyata āha- anṛtādīti //

anṛtādivirodhitvamubhayośca svalakṣaṇam // MAnuv_2,2.231ab //

NYĀYASUDHĀ:
brahmaṇaḥ satyajñānādyātmakatvaṃ nāmānṛtajaḍādivirodhitvamevābhimataṃ māyāvādino 'nyasyāsambhavāt,"anṛtajaḍavirodhirūpamantatrayamalabandhanaduḥkhatāviruddham'; iti tad vyākhyānācca /
anṛtādivirodhitvaṃ ca śūnyavādī śūnyasyāpi manyate /
"jāḍyasaṃvṛtiduḥkhāntapūvardeṣavirodhi yat'; iti vacanāt /
tato naitadapi bhedakamiti yukta evātideśaḥ /


*8,341*

syādetat /
prapañcamithyātvānumānanirāsārthaṃ vaidharmyācca na svapnādivaditi sūtram /
tatra yat"bhrānteḥ saṃvṛvisatyasya'; iti dūṣaṇamuktam /
tadeva vaidharmyāditi sūtre pratīyate /
yatpunaruktaṃ dṛśyatvasya satyatve tatraiva vyabhicāraprasaṅgāttasya mithyātvaṃ vācyam /
tathācāsādhakatvamiti tatsūtre na dṛśyate /
tatkathametadvayākhyānamityata āha- svavākyeti //

svavākyābhāvasaṃvādānna kṛtyaṃ prativādinaḥ // MAnuv_2,2.231cd //
tatpakṣa iti vaidharmyānna svapnādivadityajaḥ /
aprayatnānnirācakre ... // MAnuv_2,2.232a-c //


NYĀYASUDHĀ:
atra vākyamiti hetuvākyārtho dṛśyatvaṃ lakṣyate /
tatpakṣa iti viṣayasaptamī /
tanmithyātvasādhanaviṣaya iti yāvat /
iti śabdo hetau /
aprayatnāt prayatnamavidhāya,"vaidharmyācca na svapnādivat'; ityanena nirācakra iti sambandhaḥ /
etaduktaṃ bhavati /
dṛśyatvasya mithyātvaṃ śūnyavādinaivābhyupagatam /
mithyābhūtasyā(cā)sādhakatvaṃ suprasiddhameva /
ata e(vai)tadviṣaye sadvādinaḥ kimapi kṛtyaṃ nāstyeva /
sphuṭadūṇavyutpādane sūtratvavyāghātāt /
tasmādetaddūṣaṇavyutpādane sūtrakṛtā prayatno na vihitaḥ /
asmābhistu tadabhiprāyaḥ sphuṭīkṛta iti /


*8,342*

tathāpi"sattvaṃ cāsyānubhūṣitaḥ'; iti yatprapañcamithyātvasya pratyakṣaviruddhatvamuktam /
yacca"mithyātve mā na kācana'; iti niṣpramāṇatvaṃ, tadubhayaṃ sūtre na dṛśyata ityata āha- ceti //

... ceti dṛṣṭiviruddhatām /
niṣpramāṇatvamapyasya sūcayāmāsa viśvakṛt // MAnuv_2,2.232d-f //


NYĀYASUDHĀ:
asya mithyātvasya /
nanvanuktasamuccayārthena caśabdenedaṃ dūṣaṇadvayaṃ sūcitamiti yathā vyākhyāyate /
tathā tadapi cāśabdārthatayā vyākhyāyatām /
kimanuktatvāṅgīkāreṇa /
maivam /
"na kṛtyaṃ prativādinaḥ'; ityuktvāt /
sūtre hetuviśeṣasyānupādānānniṣpramāṇakatvaṃ jñāpitamityastu /
kiṃ cāśabdasyobhayasūcakatvagrahaṇena /
na /
sati śabde sāvakāśajñāpakādaraṇānupapatteḥ /
svapnādivaditi sūtraṃ svapnavaditi vyākhyātam /
ko 'trābhiprāyaḥ /
ucyate /
bahusthaleṣu gṛhīteyaṃ vyāptirityato na vyabhicāramarhatīti pūrvapakṣiṇo 'bhimānaṃ sūcayituṃ sūtrakāreṇādipadaṃ prayuktam /
tathāpi prayogavelāyāmeka eva dṛṣṭānta upādeyo 'nyathā'dhikyaṃ prasa(jyate)jyeteti /
yathā'ha /
hetūdāharaṇādikam adhikamiti /
etajjñāpanāya bhāṣyakāreṇa svapnavadityevoktamiti sarvaṃ sustham /
// iti śrīmannyāyasudhāyāṃ asadadhikaraṇam //


___________________________________________________________________________


*8,344*


[======= JNys_2,2.IX: anupalabdhyadhikaraṇa =======]

// atha śrīmannyāyasudhāyāṃ anupalabdhyadhikaraṇam //

// oṃ na bhāvo 'nupalabdheḥ oṃ //
atra yogācārāṇāṃ matamapākriyate /
tadarthaṃ tadupanyasyati- jñānameveti //

na bhāvo 'nupalabdheḥ | BBs_2,2.30 |

jñānamevaikamakhilajñeyākāraṃ prabhāsate // MAnuv_2,2.233ab //

NYĀYASUDHĀ:
vijñānameva tattvaṃ, na rūpādayaścatvāraḥ skandhāḥ, iti yogācārā manyanta ityatharḥ /
vijñānāṅgīkāre 'pi viśeṣamāha- ekamiti //
advitīyamityarthaḥ /
nanu jñeyamapi rūpādikaṃ pratyakṣādisiddhaṃ tatkathaṃ vijñānameva tattvamityata āha- akhileti //
jñānameva jñeyakāram /
na jñeyaṃ nāma jñānādbhinnamastītyarthaḥ /
kuto jñeyasya jñānātmakatvamityata āha- prabhāsata iti //
jñānaṃ hi prakāśate /
tena prakāśamānatvasya jñānatvena vyāptau siddhāyāṃ nīlāderapi prakāśamānasya jñānatvaṃ siddhamityarthaḥ /
yadvā prabhāsate nīlādinā sahaiveti śeṣaḥ /
tena"sahopalambhaniyamādabhedo nīlataddhiyoḥ'; ityuktaṃ bhavati /


*8,346*

nanvayukto jñānajñeyayorabhedaḥ /
bhedasya pratibhāsanāt /
ekamiti cāyuktam /
vijñānasantatīnāṃ bhedasya ekaikasyāpi santatau vijñānabhedasya ca vidyamānatvāt /
kiñca āstāmanyo bhedaḥ /
bhedābhāvastāvadabhyupagamyate /
tenaiva vijñānasya sadvitīyatvāprāpternaikatvamupapadyata ityata āha- tatreti //

tatra santatibhedaśca svabhedo bheda eva ca /
kalpitāḥ pratibhāsante nānāsaṃvṛtibhūmiṣu // MAnuv_2,2.233c-f //


NYĀYASUDHĀ:
tatra jñānajñeyayoḥ bheda iti sambandhaḥ /
santatibhedaḥ santatīnāṃ parasparaṃ bhedaḥ /
svabhedaḥ ekaikasyāmapi santatau pūrvottarajñānabhedaḥ /
kalpitā eveti sambandhaḥ /
nānāsaṃvṛtibhūmiṣu anekājñānasthāneṣvantaḥkaraṇeṣu /
yadvā nānāsaṃvṛtikāraṇakāsu vāsanāsviti nimittasaptamī /
taduktam"bhedastu bhrantibuddhayaiva dṛ(dṛśya indā)śyetendāvivādvayaḥ'; iti /


*8,347*

evamanūditaṃ matamapākaroti- ityetadapīti /

ityetadapi no yuktaṃ ... // MAnuv_2,2.234a //


*8,348*

NYĀYASUDHĀ:
pūrvamatasamuccayārtho 'piśabdaḥ /

anena"na bhāve'; iti sūtrāṃśo vyākhyātaḥ /
jagat bhāvo jñānaṃ na bhavatītyarthaḥ /
bhavateranubhavārthatvāt /
upasargā hi dhātulīnāsyārthasya vyañjakā eva /


*8,350f.*

kuto na yuktamiti cet /
kiṃ jñeyaṃ svarūpeṇāsadeva vijñāne samāropitaṃ vijñānātmaka(mityu)mucyate, kiṃ vā paramārthasata eva jñeyasya jagato vijñānātmakatvaṃ bhedamātraṃ tvasaditi /
ādyastvatītādhikaraṇarītyā nirastaḥ /
na dvitīyaḥ /
jagato jñānābhede pramāṇābhāvāt /
na tāvattatra pratyakṣamastītyāha- na hīti //

... na hi jñānatayā jagat /
bhāsate ... // MAnuv_2,2.234bc //


NYĀYASUDHĀ:
anenānupalabdherityetadvayākhyātaṃ bhavati /
mā bhūtpratyakṣeṇa jñānārthayorabhedasiddhiḥ /
prakāśamānatvādyanumā(nāttu)nena tu bhaviṣyatītyata āha- anubhavasyaiveti //

... anubhavasyaiva viruddhatvādapeśalam // MAnuv_2,2.234cd //
tanmataṃ ... // MAnuv_2,2.235a //


NYĀYASUDHĀ:
sambandhamātre ṣaṣṭhī /
evaśabdenānubhavasyānumānataḥ prābalyaṃ sūcayati /
tanmataṃ tadabhimatamanumānamiti śeṣaḥ /
jñānajñeyayoraikyamiti (ca) vā /
jñānajñeyayoḥ sphuṭaṃ bhedasyaiva sākṣisiddhatvātkālātyayāpadiṣṭatvamanumānasyetyarthaḥ /
anenānupalabdherityetadupalabdhivirodhāditi ca vyākhyātam /

nanu bhedagrāhakaṃ pratyakṣaṃ bhrāntamiti cenna /
bādhakābhāvāt /
anumānaṃ bādhakamiti tu na vācyam /
pratyakṣasyānumānato balavattvāt /
anyathā kālātītatocchedaprasaṅgāt /
pratyakṣasya bhrā(nti)ntatve 'numānaprāmāṇyaṃ tasmiṃśca pratyakṣasya bhrāntatvamityanyonyāśrayatvācceti /


*8,353*

anumānavirodhaṃ cānumānasya pratipādayituṃ sūtram oṃ kṣaṇikatvācca oṃ //
iti /
tadvayācaṣṭe- kṣaṇikatvācceti //

kṣaṇikatvāc ca | BBs_2,2.31 |

... kṣaṇikatvācca jñānasya sthirarūpataḥ /
jñeyasyoktaprakāreṇa ... // MAnuv_2,2.235a-c //


NYĀYASUDHĀ:
āśutaravināśitvādityarthaḥ /
naca jñānasya kṣaṇikatvaṃ bhrāntam /
abādhitapra(tīti)tyayasiddhatvāt /
sthirarūpataḥ āśutaravināśitārahita(tvāt)tvataḥ /
anusmṛteścetyādyuktaprakāreṇa /
atra kṣaṇikatvākṣaṇikatvalakṣaṇaviruddhadharmādhyāsaṃ bhedahetuṃ vadatā'ntarabāhyatvādiraneko viruddhadharmasaṃsarga upalakṣito boddhavyaḥ /


*8,354*

evaṃ pratyekaṃ nirākṛtāni bauddhamatāni sādhāraṇadoṣeṇa dūṣayituṃ sūtram- oṃ savarthānupapatteśca oṃ //
iti /
tadvayākhyāti- sarveti //

sarvathānupapatteś ca | BBs_2,2.32 |

... sarvaśrutivirodhataḥ /
anubhūtiviruddhatvādapi pakṣā ime 'śivāḥ // MAnuv_2,2.235d-f //


NYĀYASUDHĀ:
śrutiprāmāṇyasya samarthitatvādavaidikaṃ pratyapi śrutivirodhakathanaṃ yuktameva /
abhyupagataśrutiprāmāṇyaṃ (śiṣyaṃ) prati vā /
teṣāṃ pakṣāṇāmaśivatvamanena jñāpyata iti /
nanvanubhūtivirodhaḥ prāgukta eva punaḥ kasmāducyate /
upasaṃhārārthamityadoṣaḥ /
yadvā tadīyaprameyāntare 'pīti /

// iti śrīmannyāyasudhāyāṃ anupalabdhyadhikaraṇam //


___________________________________________________________________________


*8,355*


[======= JNys_2,2.X: naikasminnadhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ naikasminnadhikaraṇam //

// oṃ naikasminnasambhavāt oṃ //
jainamatamatra nirākriyate /
nirākāryāṃśajñāpanāya tadupanyasyati- āheti //

naikasminn asaṃbhavāt | BBs_2,2.33 |

āha kṣapaṇako viśvaṃ sadasad dvayamadvayam /
dvayādvayamatatsarvaṃ saptabhaṅgisadātanam // MAnuv_2,2.236 //


NYĀYASUDHĀ:
dvividhaṃ tāvadviśvaṃ, jīvājīvātmakaṃ nirīśvaram /
tatpunaḥ ṣaḍdravyātmakam /
tāni ca dravyāṇi jīvadharmādhamarpudgalakālākāśanāmāni /
tatra jīvāstrividhāḥ /
baddhā yogasiddhā muktāśceti /
dharmo gatiheturjagadvayāpī /
adharmaḥ sthitiheturvyāpaka eva /
pudgalo rūparasagandhasparśavat dravyam /
tat dvividham /
paramāṇurūpaṃ saṅghātarūpaṃ ca /
kālaḥ, abhūdbhavati bhaviṣyatīti vyavahāraheturapyaṇurūpaḥ /
ākāśa eko 'nantapradeśaśca /
sa dvividho lokākāśo 'lokākāśaśceti /
(e)teṣvaṇuvyatiriktānyastikāyaśabdāni /
anekadeśavartini dravye 'stikāyaśabda(pra)vṛtteḥ /
te ca jīvāstikāyo dharmāstikāyo 'dharmāstikāyaḥ pudgalāstikāya ākāśāstikāya iti pañca /

atra ca mokṣopayoginaḥ sapta padārthā jīvājīvāsravabandhanirjarasaṃvaramokṣāḥ /
jīvo jñānadarśanasukhavīryaguṇaḥ /
ajīvo jīvopabhogyaṃ vastujātam /
asravaḥ tadbhogopakaraṇamindriyādikam /
bandho dvividhaḥ /
ghātikāghātikacatuṣyayabhedāt /
ādyaṃ jīvaguṇānāṃ jñānā(nandā)dīnāṃ pratibandhakam /
dvitīyaṃ śarīrasaṃsthānatadabhimānatatsthititatprayuktasukhaduḥkhahetubhūtam /
nirjaro mokṣasādhanaṃ tapaḥ /
saṃvara indriya(nirodhaḥ) nigrahaḥ /
mokṣaḥ svābhāvikātmasvarūpāvirbhāvaḥ /
mokṣagrahaṇenaiva mokṣamārgo 'pi saṅgṛhītaḥ /
sa ca samyagjñānasamyagdarśanasamyakcāritryākhyaratnatrayātmakaḥ /

tadetadviśvaṃ saptabhaṅgi pratyekaṃ saptaprakārakamā(mityā)ha kṣapaṇakaḥ /
katham /
sadityekaprakāraḥ /
asaditi dvitīyaḥ /
dvayaṃ sadasadātmakamiti tṛtīyaḥ /
advayam avaktavyamiti caturthaḥ /
dvayādvayamiti pañcamaṣaṣṭhau /
tatra sadavaktavyaṃ ceti pañcamaḥ, asadavaktavyaṃ ceti ṣaṣṭhaḥ /
atatsarvamiti saptamaḥ /
sarvamiti sadasadātmakam, ataditi avaktavyam /


*8,362*

atra saptabhaṅgitvanirāsārthaṃ naikasminnasambhavāditi sūtraṃ vyācaṣṭe- naitaditi //

naitat padārtha ekasmin yuktaṃ dṛṣṭivirodhataḥ // MAnuv_2,2.237ab //


*8,363*

NYĀYASUDHĀ:
etatsaptaprakāratvaṃ kutaḥ /
asambhavāt /
so 'pi kathaṃ, dṛṣṭivirodhataḥ /
sarvaṃ hi svopādhau sat paropādhāvasat /
svarūpeṇa bhāvo 'nyātmatvādinābhāvaḥ /
dravyarūpeṇa nityamavasthābhedena anityam /
svarūpādinābhinnaṃ svaguṇādinā bhinnābhinnamityeva pratīyate /
nāto 'nyena prakāreṇa /
ato vyavasthayā niyamagrāhakapratyakṣādivirodhenāsambhavādayuktamevānekāntamatamiti /


nanvekāntadarśanasya mithyādṛṣṭitvena na tadvirodho 'sambhavamāhavatītyata āha- bhāveti //

bhāvābhāvatayā viśvaṃ yena rūpeṇa mīyate /
tadrūpameva taditi niyamaḥ kena vāryate // MAnuv_2,2.237c-f //


NYĀYASUDHĀ:
yena rūpeṇetyasyaiva vivaraṇaṃ bhāvābhāvatayeti /
tacca vyavasthitasadasattvādyupalakṣaṇaṃ boddhavyam /
yadvā bhāvābhāvatayānyena ca yena sattvādi(nā)rūpeṇeti yojanā /
athavā yena bhāvābhāvatayā rūpeṇeti sāmānādhikaraṇyena yojyam /
yadi vā bhāvābhāvatayetyasya viśeṣaṇametat /
yena vyavasthitena rūpeṇeti /
kena pramāṇenetyākṣepaḥ /
bhavedetanniyamadarśanasya mithyādṛṣṭitvam /
yadi dṛṣṭasya niyamasya nivārakamanekāntasādhakaṃ prabalapramāṇaṃ syāt /
na caitadasti /
naca bādhakena vinā pratyayānāṃ mithyātvaṃ kalpayituṃ yuktamatiprasaṅgāditi /


niyamasya bādhakamāśaṅkate- tattaditi //

tattaddoṣanivṛttyarthaṃ svīkṛtā tattadātmanā /
yadi ... // MAnuv_2,2.238a-c //


NYĀYASUDHĀ:
sadvādino hi sattvaṃ viśvasya pramāṇaiḥ prātiṣṭhipastadanaṅgīkāre doṣāṃśca nyarūpayan /
evamasadvādino 'pyasattvasthāpanaṃ tadanaṅgīkāre dūṣaṇaṃ ca vyutpāditavantaḥ /
tathānye 'pi svapakṣasādhanaṃ tadanabhyupagame bādhanaṃ ca kṛtavantaḥ /
tathāca yadi sa(tya)tvaṃ nāṅgīkriyate tadā tu tadupanyastaṃ pramāṇamuparudhyeta dūṣaṇaṃ cānuṣajyeta /
evamasattvādyanaṅgīkāre 'pi /
atastaddoṣaparihārārthaṃ tattatpramāṇānusaraṇārthaṃ ca tattadātmatā viśvasya mayā svīkṛtā /
tathācānekānte prabalapramāṇasadbhāvātkathaṃ niyame bādhakābhāva iti /
pariharati- tairiti //


*8,365*

... tairakhilairdeṣairlipyate caladarśanaḥ // MAnuv_2,2.238cd //

NYĀYASUDHĀ:
tarhīti śeṣaḥ /

idamatra vaktavyam /
sadvādimatānusaraṇasamaye 'sattvādibhaṅgīraṅgīkaroṣi (vā) na veti /
evamasadvādicaraṇaśaraṇapraveśavelāyāṃ sattvādiprakārānūrīkaroṣi vā na veti /
evamanyeṣvapi pakṣeṣu vikalpaḥ /
yadyādyastadāsau acaladarśanaḥ sadā sakalapakṣāṅgīkāravān tairdeṣairakhilai(tairakhilairdeṣai)rlipyate /
tathāhi /
sadvādino hi na kevalaṃ sattve pramāṇaṃ tadanaṅgīkāre ca dūṣaṇaṃ ca vyutpādya nivṛttāḥ /
kintvasattvādipakṣeṣu doṣānapi vyutpāditavantaḥ /
evamasadvādino 'pi nāsattve pramāṇaṃ tadanabhyupagame bādhakaṃ cābhidhāyaivoparatā, kinnāma sattvādipakṣeṣu doṣānapi upapāditavantaḥ /
evamanye 'pi /
tathāca sakalapakṣakakṣīkāre (tu) tattadvādyuktapakṣāntaradoṣalepaḥ kathaṃ na syāt /
atha manyase /
na te doṣāḥ kintvābhāsāḥ /
te ca nānekāntavādaṃ bādhanta iti /
tadā kathaṃ tāni pramāṇāni /
anaṅgīkāre doṣāśca nābhāsāḥ /
(ye nānuma)yenānusaraṇīyāḥ /
tasamttattadvādivyutpāditapramāṇādyanusāreṇa saptabhaṅgīraṅgīkurvāṇena taduktavipakṣadoṣānusāreṇa tatparityāgo 'pi kāryaḥ syāt /
tathā cāṅgīkāraparityāgābhyāmubhayata ākṛṣṭo 'yaṃ kaṣṭāṃ daśāmāviṣyaḥ syāt /
nanvekānto dvedhā /
kramākramabhedāt /
tatra kramānekānte tāvannāṅgīkāraparityāgau viruddhau /
akramānekānte 'pi yena rūpeṇa nityatvaṃ tenaivānityatvamityādyanaṅgīkārānna virodhaḥ /
tathāca saptabhaṅgayaṅgīkāriṇā mayā tāni pramāṇāni dūṣaṇāni ca vyavasthāpitāni bhavantīti noktadoṣaḥ /
maivam /
tattatpramāṇādīnāṃ vyavasthānarhatvāt /
na khalu tatta(tpramāṇavā)dvādibhistāni tāni pramāṇādīni sāvakāśānyupanyastāni /
tasmātsarveṣvapi (vādiṣu) vādeṣu paramāstikasya kathitaiva gatiḥ /

*8,366*

api caivamapi saptabhaṅgayaṅgīkāro nirmūla eva /
na hyevaṃvādino vādinaḥ prasiddhāḥ /
sambhāvanayā tadaṅgīkāre ca na saptatvapariniṣṭhā /
sambhāvanāvakā(ko)śasya niḥsīmatvāt /
kiñca sarvāṅgīkārapakṣe syādasti ca nāsti ceti pakṣātsyādasti syānnāstīti pakṣadvayaṃ na bhidyate /

dvitīyapakṣe tu caladarśana ityeva dūṣaṇam /
apasiddhāntī syāditi /

tadevaṃ saptabhaṅgayaṅgīkāraḥ pramāṇaviruddho 'prāmāṇikaścetyuktam /
akhilairdeṣairlipyata ityanena parasparavyāhatiścetyapi sūcitam /
JOSHI-5


*8,368*

evambhūtasyāpi saptabhaṅginayasya svīkāre 'tiprasaṅgaṃ cāha- atihāyeti //

atihāya pramāṇāptaṃ niyamaṃ sadasattayā /
aśeṣamāviruddhaṃ ca nirmānaṃ vyāhataṃ sadā // MAnuv_2,2.239 //
sarvaprakāraṃ vadato dṛṣṭahāniramagrahaḥ /
svavyāhatatvamityādyā doṣāḥ sarve bhavanti hi // MAnuv_2,2.240 //


NYĀYASUDHĀ:
aśeṣamāviruddhaṃ vadata ityasyopapādanaṃ vyavasthitayā sadasattayā pramāṇāptaniyamamatihāyeti /
sarve prakārā yasya viśvasya tattathoktam /
tataścāsau prakāraśceti vā /
nanu kramānekānte tāvatkālabhedena na vyāghātaḥ /
akramānekānte 'pi rūpabhedenetyata uktam- sadā sarvaprakāraṃ vadata iti //
sadeti rūpābhedasyāpyupalakṣaṇam /


*8,369*

ayamāśayaḥ /
yadi krameṇa vā rūpabhedena vāneprakāratvam tadā nāyamanekāntavādaḥ samarthanīyaḥ /
sarvairapi vādibhiraṅgīkṛtatvāt /
nahi ko 'pi vādī padārthānāṃ kālato rūpataścāvasthāvaicitryamanaṅgīkurvāṇo 'sti /
yaṃ pratyanekāntavādāvatāraḥ saṅgaccheta /
kevalaṃ kṣaṇabhaṅgo vātyantasatkāryavādo vāvasthāvatoratyantabhedo vāpākaraṇīyaḥ /
ataḥ anekāntavādamavatārayatā kṣapaṇakena sadā rūpābhedenaiva ca sarvaprakāra(ka)tvamityeva vaktavyam /
tathāca na vyāghātanistāra iti /


*8,370*

aśeṣamāviruddhaṃ sadā sarvaprakāratvaṃ vadato dṛṣṭahāniḥ syāt /
nirmāna ca sadā sarvaprakāraṃ vadato amagraho aprāmāṇikasvīkāraḥ syāt /
vyāhataṃ sadā sarvaprakāraṃ vadataḥ svavyāhatatvaṃ syāditi yojanā /
dṛṣṭahānādyanuṣaṅgidoṣāntarasaṅgrahārthamityādyā ityuktam /
hiśabdaḥ sarvatra prasaṅgahetusūcanārthaḥ /
ayamarthaḥ /
yadi pramāṇaviruddhamapi sarvaprakāratvaṃ viśvasya svīkriyate tadā dahanaśaityaṃ vā gavālambhanāderdharmasādhanatvādikaṃ vā(cā)'ṅgīkāryaṃ syāt /
pramāṇavirodhena pratipakṣanirākaraṇaṃ ca na syāt /
kintu pratyabhijñādiviruddhamapi kṣaṇikatvādikamaṅgīkartavyaṃ syāt /
aviśeṣāt /
yadi cāprāmāṇikamapi sarvaprakāratvamurarīkriyate tadā kharaviṣāṇādikaṃ vā gomāṃsādibhakṣaṇasya dharmasādhanatvaṃ corarīkaraṇīyaṃ syāt /
pramāṇābhāvena paramatanirāso 'pi na kāryaḥ syāt /
tada(pya)bhyupagamanīyameva bhavedaviśeṣāt /
tathāca dūṣyopādeyahīnasya śāstranirmāṇamapi na syāt /
yadi ca vyāhatamapi sarvaprakāratvamaṅgīkuryāt tadā māturapi vandhyatvaṃ, jinopadeśasya pramāṇatayābhyupagatasyāpyaprāmāṇyaṃ, baddhasyāpi muktatvaṃ, muktasyāpi baddhatvaṃ, siddhasyāpi rāgitvaṃ, śvapacasyāpi siddhatvamityādisarvamapyaṅgī(kuryāt)kāryaṃ syāt /
anyathānekāntabhaṅgaprasaṅgāt /
evaṃca na śāstrapraṇayanaprayāsaḥ kāryaḥ /
mattonmattādibhirevāsya kṛtatvāditi /


*8,371*

evaṃ viśvasya kṣapaṇakoktaṃ sarvaprakāratvaṃ nirākṛtya taduktamarthāntaramapi nirākartumanuvadati- vaktīti //

vakti svaprabhamātmānaṃ dehamānaṃ ... // MAnuv_2,2.241ab //


*8,371f.*

NYĀYASUDHĀ:
kṣapaṇaka iti vartate /
svaprabhaṃ svaprakāśaṃ, dehasya mānaṃ parimāṇamiva mānaṃ yasyāsau tathoktaḥ /
atra dehamānatvameva vipratipanno 'rthaḥ /
svaprabhatvaṃ tu sammatamevāsmākam /
yadvā svaprabhamiti kriyāviśeṣaṇam /
vinā pramāṇena svīyayā prabhayotprekṣyaiva vaktīti /
athavānena dehaparimāṇatve jainoktaṃ pramāṇābhāvasamanuvadati /
tatra svaśabdena svīyo deha ucyate /
tatra prabhā yasyāsau tathoktaḥ /
tathāca prayogaḥ /
devadattātmā, taddeha eva, tatra sarvatraiva ca vidyate /
tatraiva tatra sarvatraiva ca svāsādhāraṇaguṇādhāratayopalambhāt /
yo yatraiva, yatra savartraiva svāsādhāraṇaguṇādhāratayopalabhyate, sa tatraiva, tatra sarvatra ca vidyate /
yathā devadattagṛha eva tatra sarvatraiva copalabhyamānasvāsādhāraṇabhāsvaratvādiguṇaḥ pradīpaḥ /
tathācāyaṃ tasmāttatheti /
anyathā kamanīyatanayāliṅganena sarvatrāhlā(dāka)dakarasya (sva)sukhasyānanubhavaprasaṅgaḥ /
tathāca sarvāṅgīṇaromāñcādikāryānudayaḥ syāditi /
yadvā pradīpasyeva svānapāyinī prabhā yasyāsau svaprabha iti /


*8,374*

atrātmanaḥ kāyaparimāṇatvanirāsārthaṃ sūtram //
oṃ evañcātmākātsnaryam oṃ //
iti /
tasya tātparyamāha- tadapīti //

evaṃ cātmākārtsnyam | BBs_2,2.34 |
na ca paryāyād apy avirodho vikārādibhyaḥ | BBs_2,2.35 |


... tadapyalam /
duṣyaṃ nānāśarīreṣu praveśādanyathābhavāt // MAnuv_2,2.241b-d //


NYĀYASUDHĀ:
kutaḥ /
akātsnaryādiprasaṅgāditi śeṣaḥ /
pipīlikādidehasthasya tatparimāṇasyātmanaḥ karmavipākavaśādgajagavayādidehaprāptau tatrākātsnaryaṃ syāt /
gajādidehagatasya ca tatparimāṇasya pipīlikādidehe 'tirekaḥ syādityubhayathā kāyaparimāṇatvānupapattireveti /
etadarthatvena (vā) ca nānāśarīreṣviti vākyaṃ yojyam /
tatrānyathābhāvāditi kāyaparimāṇatvābhāvāpatterityarthaḥ /


*8,375*

syādetat /
yaṃ yaṃ dehaṃ prāpnotyātmā tattatparimāṇo bhavatyato noktadoṣa ityāśaṅkānirāsārthaṃ sūtram oṃ naca paryāyādapyavirodho vikārādibhyaḥ oṃ //
iti /
tasya tātparyamāha- tadapyalamiti //


cittasthaṃ parimāṇaparyāyaṃ tacchabdena parāmṛśati /
"nānāśarīreṣu praveśādanyathābhāvāt'; iti sthūlasūkṣmaśarīreṣu praveśātsthūlasūkṣmaparimāṇopaja(na)ne sati parimāṇatadvatoratyantabhedānabhyupagamādātmana evānyathābhāvaprasaṅgādityarthaḥ /


*8,376*

astvātmana evānyathābhāvāstataḥ ko doṣa ityata āha- anyatheti //

anyathābhāvi yad vastu tadanityamiti sthitiḥ /
tanmate ... // MAnuv_2,2.242a-c //


NYĀYASUDHĀ:
sthitiḥ vyāptiḥ /
tanmata jainadarśane /
aṅgīkṛteti śeṣaḥ /
tato 'pi kimityata āha- taditi //

... tadanityatvaṃ ... // MAnuv_2,2.242c //

NYĀYASUDHĀ:
yata evaṃ vyāptiryataścānyathābhāvitvamaṅgīkṛtaṃ tat tasmādātmano 'nityatvamāpatatīti śeṣaḥ /
atra dṛṣṭāntaḥ- pudgaleti //

... pudgalasyānivāritam // MAnuv_2,2.242d //


*8,377*

NYĀYASUDHĀ:
ivaśabdo 'dhyāhāryaḥ /
pudgalasya dehasyeveti /
yadvā pudgalaśabdo jarajjainairātmavācitvena svīkṛta ityatrātmavācī /
(yadvā) yadi vā svamatenāyamātmani prayuktaḥ /
yathā'huḥ /
"pudgalo nirayayaṃ giran'; iti /
nanvavasthāparyāyarūpeṇā(pyā)tmano 'pyanityatvamaṅgīkriyata eva /
tatkathamanityatvāpādanamityato vā pudgalasya dehasyevetyuktam /
yathā dehasya dehākāranāmaparityāgena bhasmībhāvalakṣaṇānityatvaṃ tathāvidhamātamno 'pyāpādyata iti /
nanu anyathābhāvasyaivaṃ vidhānityatvena vyāptirnāsti paramāṇvādau vyabhicārāt /
tatkathamāpādanam /
maivam /
parimāṇavyatyayalakṣaṇasyānyathābhāvasyaivaṃvidhānityatvavyāptatvena dehādau dṛṣṭatayā tadvato 'pyātmanastathāvidhānityatvasya nivārayitumaśakyatvāt /
tadidamuktam- anivāritamiti //


*8,378*

nanvasmanmatavadbhavanmate 'pyātmano 'nyathābhāvo 'styeva sukhaduḥkhābhyāmuccanīcatvābhyupagamāt /
anyathābhāvinaśca dehāderanityatopalabdhā /
tasmādbhavanmate 'pyātmano 'nityatā durvāretyata āha- neti //

nānityatāsmatpakṣe tu caitanyāderviśeṣiṇaḥ /
lakṣaṇasya nivṛttau tu syānna taccetane kvacit // MAnuv_2,2.243 //



*8,378f.*

NYĀYASUDHĀ:
anyathābhāvavato 'pyātmanaḥ prasajyata iti śeṣaḥ /
tatkathamityata āha- caitanyāderiti //
asmanmata iti vartate /
anityateti ca /
tuśabdo 'vadhāraṇe /
asmanmate caitanyāderlakṣaṇasya nivṛttāveva viśeṣiṇo lakṣaṇavato 'rthasyānityatā syāt /
natu jainānāmivānyathābhāvamātreṇa /
etaduktaṃ bhavati /
yasya vastuno yallakṣaṇaṃ tannivṛttirūpo 'nyathābhāva eva tadanityatānibandhanaṃ nānyathābhāvamātramiti /
evaṃ tarhi śabdādilakṣaṇābhāvādgaganādīnāṃ mahāpralaye vināśaḥ syāt /
ceṣyāśrayatvābhāvāccharīrasya suptyādau vilayo bhavedityata uktam- viśeṣiṇo lakṣaṇasyeti //
viśeṣavato lakṣaṇasya na tu lakṣaṇamātrasyetyarthaḥ /


*8,379*

kimato yadyevamityata āha- neti //
taditi sāmānyena vākyārthaṃ parāmṛśati /
anityatvakāraṇatvenoktaṃ viśeṣiṇo lakṣaṇasya nivartanaṃ cetane kvacidapi na syāt /
atastasyānityatāpi na syāt /
yadvā taditi lakṣaṇaparāmaśarḥ /
cetane vartamānaṃ kvacinna nivartata iti śeṣaḥ /


*8,380*

viśeṣiṇo lakṣaṇasya nivṛttau lakṣasyānityatā syādityuktam /
tadviśadayati- oteti //

otaprotātmakatvaṃ tu paṭe dehe 'ṅgasaṃsthitiḥ /
ityādilakṣaṇasyaiva nivṛttau syādanityatā // MAnuv_2,2.244 //


NYĀYASUDHĀ:
otaprotātmakatvaṃ nāma tantūnāṃ saṃyogaviśeṣaḥ paṭe lakṣaṇamiti śeṣaḥ /
aṅgasaṃsthitiḥ karacaraṇādyaṅgānāṃ sanniveśaviśeṣaḥ /
ādiśabdaḥ prakāravacanaḥ /
anityatā lakṣyasyeti śeṣaḥ /
yāvallakṣyabhāvināṃ lakṣaṇānāṃ nivṛttireva lakṣyānityatvanimittam /
tādṛśaṃ cātmanaścaitanyam /
tacca kadāpi na nivartate iti kathaṃ tasya vināśaprasaṅga iti /
yaduktamātmā svaprabha iti tadapyasat /
svaprabhāvataḥ pradīpāderiva rūpasparśāpatteḥ /
rūpādimatvācca vināśitvāpatteḥ /
yadrūpādimattadanityatvamiti pareṇaiva vyāpteraṅgīkṛtatvāt iti /


*8,381*

nanu siddhānte 'pyātmano rūpādimattvamaṅgīkriyata eva /
rūpādimato 'nityatvamiti vyāptiśca /
"rūpādimattvācca viparyayo darśanāt'; ityuktatvāt /
tatkathamanityatvaparihāra ityata āha- bhautikaṃ tviti //

bhautikaṃ tveva rūpādi vyāptaṃ nāśena no mate // MAnuv_2,2.245ab //


*8,382*

NYĀYASUDHĀ:
tuśabdo viśeṣārthaḥ /
sa eva bhautikamiti vivṛtaḥ /
na rūpādimātramityevārthaḥ /
naca bhautikaṃ rūpādikamātmanyasti /
tasmānnānityatāprasaṅga iti bhāvaḥ /

yathā bhavadbhiranyathābhāvo viśeṣyate /
yāvallakṣyabhāvi(viśeṣa)lakṣaṇavyāvṛttirūpo 'nyathābhāvo 'nityatvavyāpta iti /
rūpādimattvaṃ ca bhautikatvena /
tathāsmanmate 'pi viśeṣaṇaprakṣepe noktadoṣa ityata āha- naivamiti //

naivaṃ tasya ... // MAnuv_2,2.245c //

NYĀYASUDHĀ:
tasya kṣapaṇakasya mate naivamanyathābhāvo rūpādimattvaṃ ca viśeṣyate /
kintu sāmānyamevānityatvavyāptatayāṅgīkriyate tato noktadoṣaparihāra ityarthaḥ /
tatkathamityata āha- anyatheti //

... anyathābhāvo yasyānityatvamīritam // MAnuv_2,2.245cd //
rūpādiyuktasya tathā jagannāśitvasiddhaye // MAnuv_2,2.246ab //


NYĀYASUDHĀ:
bhūbhūdharādejargato nāśitvasiddhaye yasyānyathābhāvastasyānityatvamīritaṃ kṣapaṇakena /
tathāśabdaḥ samuccaye /
rūpādiyuktasyāpyanityatvamīritamiti /
yadvā yat rūpādiyu(ktaṃ tatta)k tattathānityamīritamita yojanā /
tasyetyata yasyetyanenānvayaḥ /
anyathā tu yacchabdaśravaṇāttacchabdādhyāhāraḥ /
pūrvavākyāttasyetyanuvartate vā /
etaccopapādayiṣyate /


*8,383*

uktamupasaṃharati- vyāptyeti //

vyāptyā tayānyathābhāvādātmano 'nityatā bhavet // MAnuv_2,2.246cd //

NYĀYASUDHĀ:
yadanyathābhāvi tadanityaṃ yacca rūpādimattadanityamiti vyāptyā /
anyathābhāvādityupalakṣaṇam /
rūpādimattvāccetyapi draṣṭavyam /
syādetat /
sampratipannavyāptikavyāpyāropo(ṇa) aniṣyavyāpakāro(paḥ)paṇaṃ tarkaḥ /
atra ca na cedvayāptiḥ sammatā kathaṃ tarhi tarkatvam /
maivam /
vyāpyavadvayāpterapi parābhyupagatatve 'pi tarkatvāvirodhāt /
evameva kvacidāśrayasyobhayāsammatāvapi na doṣaḥ /
vakṣyati caitat"paranyāyaistu dūṣaṇam'; iti /


*8,385*

kṣapaṇoktaṃ prameyāntaraṃ nirākartuṃ sūtram oṃ antyāvasthiteścobhayanityatvādaviśeṣāt oṃ //
iti /
tatrāntyāvasthiteścetyetāvattāvadvayākhyāti- nityeti //

antyāvasthiteś cobhayanityatvād aviśeṣaḥ | BBs_2,2.36 |

nityordhvagatirapyeṣā yā muktiriti kathyate /
alokākāśamāptasya kathaṃ na vikṛtiśca sā // MAnuv_2,2.247 //



*8,386*

NYĀYASUDHĀ:
apiśabdaḥ prameyāntaranirākaraṇasamuccayārthaḥ /
caśabdaḥ parimāṇaparyāyeṇa saha samuccaye /
yā eṣā nityordhvagatirmuktiriti jainaiḥ kathyate sā ca kathamātmano vikṛtirno bhavet /
bhevedeva /
tatkatham /
alokākāśamāptasya /
prāk lokākāśastho hyayamātmā nirantarordhvagatyālokākāśamāpnoti /
tathācānyathābhāvādātmano 'nityatvāpattiriti bhāvaḥ /
anenāntyā (yā)avasthitiḥ santatordhvagatilakṣaṇā /
tataścātmano 'nityatvāpattiriti sūtrakhaṇḍasyārtha ukto bhavati /


nanvanyathābhāvamātramanityatvasya prayojakamiti na tāvadbhavadīyaḥ pakṣa ityuktam /
nāpi madīyaḥ pakṣaḥ /
tatkathaṃ pradeśaviśeṣasaṃyogamātrarūpānyathātvena muktātmano 'nityatvaprasañjanamityato jainapakṣo 'yamiti samarthayituṃ tāvatpṛcchati- kīdṛśaśceti //


*8,387*

kīdṛśaścānyathābhāvo nāśahetutayeṣyate // MAnuv_2,2.248ab //

NYĀYASUDHĀ:
kṣapaṇakena hi kṣityādeḥ sarvasya nityatvādyanekāntaṃ samarthayamānena dravyaparyāyābhyāṃ nityatvamanityatvaṃ cetyuktam /
dravyākārasya kadāpyanapāyānnityatvam /
paryāyo 'nyathābhāvaḥ tasmādanityatvamiti /
tatra vaktavyam /
kīdṛśo 'trānyathābhāvo nāśaṃ prati hetutayeṣyate /
kiṃ saṃsthānādilakṣaṇāpagamarūpo vā, sadhāraṇo veti bhāvaḥ /

ādyaṃ śaṅkate- saṃsthāneti //

saṃsthānāpagamaścet ... // MAnuv_2,2.248c //

NYĀYASUDHĀ:
saṃsthānagrahaṇaṃ lakṣaṇopalakṣaṇam /
nāśahetutayeṣyata iti sambandhaḥ /
pratiṣedhati- sa neti //

... sa nahi bhūsāgarādiṣu // MAnuv_2,2.248d //

NYĀYASUDHĀ:
vaktuṃ śakyata iti śeṣaḥ /
kuto netyata āha- sa na hīti //
yāvallakṣyabhāvilakṣaṇāpagamalakṣaṇo 'nyathābhāvo bhūsāgarādiṣu pakṣaikadeśabhūteṣu na hīdānīṃ pramitastato hetoḥ sandigdhāsiddhatvaṃ syādityarthaḥ /
pramitatve tu tasyānityatve 'pi saṃśayo nāstītyanumānaṃ vyarthamāpadyate /


*8,388*

tarhi dvitīyo 'stviti śaṅkate- yaḥ kaściditi //

yaḥ kaścidanyathābhāvo yadi ... // MAnuv_2,2.249ab //

NYĀYASUDHĀ:
pūrvavadeva sambandhaḥ /
avivakṣitaviśeṣa ityarthaḥ /
evaṃ tarhi muktātmano 'pyanityatvāpādanaṃ susthitamiti bhāvenāha- muktiśceti //

... muktiśca tādṛśī // MAnuv_2,2.249b //

NYĀYASUDHĀ:
tādṛśī anyathābhāvasvarūpā /
evamapyātmano nityatve bhūbhūdharādīnāmapi nityatvaṃ syāt /
anyathā hetoranaikāntyāt /
tadidamuktaṃ sūtrakṛtā /
"ubhayanityatvāt'; iti /

avayavopacayāpacayalakṣaṇo 'nyathābhāvo 'nityatve heturiti cet (na) /
sphaṭikādau pakṣaikadeśe sandigdhatvāt /
rūpādimattvaṃ saviśeṣaṇamupādīyate cetko doṣa iti cenna /
parasya vaiyarthyaprasaṅgāt /
nahi paro rūpādimatkiñcinnityamabhyupaiti /
ātmanastu prabhayā rūpādimattvamāpāditameva /
yadvā ātmano rūpādimattvaṃ svasiddhānta eva /
rūpādimato 'nityatvamiti vyāptyaṅgīkāre pūrvoktānityatvaprasaṅgo vyākhyātavyaḥ /


*8,391*

kṣapaṇakoktamarthāntaraṃ dūṣayitumanuvadati- deheti //

dehamāne vikāraḥ syāditi sthāsnūnanātmanaḥ // MAnuv_2,2.249cd //
āha ... // MAnuv_2,2.250a //



*8,391f.*

NYĀYASUDHĀ:
dehamāne dehamānatve /
pramite (satī)ti śeṣaḥ /
vikāraḥ syāt sthāvarāṇāṃ sātmakatvāṅgīkṛtāvātmana iti śeṣaḥ /
iti sa mā bhūdityevamartham /
sthāsnūn vṛkṣādīn /
anātmanaḥ ātmānadhiṣṭhitān /
āha kṣapaṇakaḥ /
atra kṣapaṇakaḥ sthāvarānanātmana āhetyetāvatyeva vaktavye yadātmano dehaparimāṇatvasya pramitatvāt vṛkṣādīnāmapi sātmakatve tatparimāṇatvāpattāvaṅkurāvasthāyāmaṇumātrasya mahāvṛkṣāvasthāyāṃ ca mahato vikāritvaṃ vikāritvādanityatvaṃ ca prasajyeta /
tanmā prāsāṅkṣīdityetada(prasañjītyevamar)thati hetukathanaṃ, tatpūrvoktaprameyadṛḍhīkaraṇārtham /
yadi vikāritvamātramanityatve prayojakaṃ jaino nābhyupeyāt /
tadā vikāritvenānityatvaprasaṅgādbibhyatā sthāvarāṇāmanātmatvaṃ yattenābhyupagataṃ tadanupapannaṃ syāt /
nahi sthāvarāṇāṃ sātmakatāyāmātmano lakṣaṇāpagamo bhavati /
kintvanyathābhāvamātramiti /
yadvā dūṣaṇasaukaryārthaṃ hetvanuvādaḥ /


*8,393*

tadidaṃ vikāritvāpattibhayātsthāvarāṇāmanātmatvāṅgīkaraṇamayuktam /
tathā sati hastyādiśarīrāṇāmapyanātmatvasyāṅgīkāyartvaprasaṅgāt /
tatkathamityata āha- hastyādīti //

... hastyādideheṣu hyapi syādanyathābhāvaḥ // MAnuv_2,2.250ab //

NYĀYASUDHĀ:
pipīlikādidehasthasya tatparimāṇasya hastyādideheṣu prāpteṣvanyathābhāvaḥ syāt hi tasmāt iti /
athavā śarīramātrasyānātma(ka)tvamāpādya tadupapādanamidaṃ kriyate /
hastyādisarvadeheṣvapi ātmano 'nyathābhāvaḥ syāt /
utpattisamaye

dehānāṃ hastavita(styādimā)stimātraparimāṇatvāt yauvane tūtkṛṣṭaparimāṇatvāditi /
anenāviśeṣāditi sūtrakhaṇḍasyārtha ukto bhavati /


*8,394*

nanu ca viṣamo 'yamupanyāsaḥ /
alpaiva hi hastyādideheṣvātmano vikṛtiḥ /
vṛkṣādau tu mahatī /
tato vṛkṣādīnāmanātmatve hastyādīnāmapi ta(dupa)dāpādanamanucitamityata āha- aṇudehasyeti //

aṇudehasya jīvasya gajatve vikṛtirhi yā /
dehavyāptyai viśeṣaḥ kastasyāḥ sthāsnutanau ca nuḥ // MAnuv_2,2.250c-f //



*8,394f.*

NYĀYASUDHĀ:
aṇudehasya pipīlikādidehasya jīvasya gajatve prāpte /
yadvotpattisamaye aṇudehasya hastavitastyādiparimitadehasya, mahāgajatve prāpte dehavyāptau (yā) yāvatī vikṛtiḥ, sthāsnutanau ca nuḥ puruṣasya, yā vikṛtistasyāstasyāśca parasparaṃ ko viśeṣaḥ /
na ko 'pi /
ayamarthaḥ /
ātmanaḥ kiṃ mahatī vikṛtiranityatvahetutvādanabhyupagantavyā /
kiṃvā vikṛtimātram /
nādyaḥ /
mahattvasyāpariniṣṭhitatvātpariniṣṭhākalpane keṣucidvṛkṣādiṣu tadabhāvāt /
tadanurodhenāpi pariniṣṭhāṅgīkāre hastyādāvapi tadbhāvāt /
dvitīye tūbhayorvikāritvenāviśeṣādvṛkṣādivat hastyādāvapi anātmatvamaṅgīkāryam /
hastyādivadvṛkṣādīnāmapi sātmakatvaṃ na parityājyamiti /
etena aviśeṣādityasyārthāntaramuktaṃ veditavyam /


*8,396*

syādetat /
na vayaṃ vikāritvāpattibhayādvṛkṣādīnāmanātmakatvamācakṣmahe /
kintu sātmakatve pramāṇābhāvāt bādhakapramāṇasadbhāvācca /
vṛkṣādīnāṃ dehatve tadvayāpakamindriyavattvamapi syāt /
naca tadasti /
tatkāryasya śravaṇāderabhāvāt /
so 'pi tajjñāpakasyābhāvāt /
adehatve ca na sātmakatvaṃ śilādivadityata āha- gītāditi //

gītāt puṣpaphalāvāptiḥ sparśāt kārśyaṃ rasāt sthitiḥ /
api vṛkṣasya dṛśyanta iti nānātmatā bhavet // MAnuv_2,2.251a-d //


NYĀYASUDHĀ:
gītāttāvadvṛkṣasyāpi puṣpaphalāvāptirdṛśyate /
tayā śravaṇamanumīyate /
vimataḥ śravaṇavān gītasānnidhye sati labdhavikāsatvādrājādivaditi /
na cāyaṃ svabhāva eva /
rājāderapi tatprasaṅgāt /
śravaṇena ca śrotrasadbhāvo 'numīyate /
evaṃ śītoṣṇasparśaviśeṣātkārśyaṃ dṛśyate /
tena sukumāraśarīravatsparśajñānamanumīyate /
tena ca tvagindriyasattvam /
tathodakādirasātsthitiraśuṣyato 'vasthānaṃ dṛśyate /
tena sammatadehavadrasajñānaṃ tato rasanendriyasadbhāvo 'numīyate /
evaṃ kamanīyakāntāvalokanenotkorakatvaṃ tilavṛkṣasyopalabhyate /
tena darśanakāmau /
tato nayanamanasī siddhayataḥ /
dhūpopayāgena cātiśayadarśanādghrāṇasiddhiriti prasiddhaśarīrāviśeṣātsthāvarāṇāmanātmatā na siddhayet /

kecinmūle niṣiktānāmapāmupari sarpaṇādādhyātmikavāyusambandhamanumāya sātmakatvamanumiyate /
tadasat /
bhasmagulikādau vyabhicārāt /

etenāviśeṣādityetatprakārāntareṇa vyākhyātaṃ bhavati /

*8,397*

"vakti svaprabham'; ityādikamutsūtritaṃ kasmādvarṇitamiti mandāśaṅkāṃ nivārayituṃ sūtrārūḍhaṃ karoti- evañceti //

evañcātmākārtsnyamiti tata evāha vedavit // MAnuv_2,2.251ef //


*8,398*

NYĀYASUDHĀ:
iti trisūtīmiti śeṣaḥ /
tata eva tadarthameva /
uktasyārthasya pratipādanārthameva /
evamanyatrāpi sūtrānupanyāsena vyākhyāne 'pi naivamāśaṅkanīyamiti jñāpayitumidamabhihitamiti /
// iti śrīmannyāyasudhāyāṃ naikasminnadhikaraṇam //


___________________________________________________________________________


*8,399*


[======= JNys_2,2.XI: patyuradhikaraṇa =======]




// iti śrīmannyāyasudhāyāṃ patyaradhikaraṇam //

// oṃ patyurasāmañjasyāt oṃ //
iha mahādevaṃ puraskṛtya pravartamānānāṃ matamapākriyate /
te caturvidhāḥ śaivāḥ pāśupatāḥ kālāmukhā mahāvratāśceti /
teṣāṃ satyapyavāntarabhede sādhāraṇameva prameyaṃ vedavādasyātiviruddhatvādapākartumanuvadati- sarvajñatvādikairiti //

patyur asāmañjasyāt | BBs_2,2.37 |

sarvajñatvādikaiḥ sarvairguṇairyuktaṃ sadāśivam /
jagadvicitraracanākartāraṃ doṣavarjitam // MAnuv_2,2.252 //
āhuḥ pāśupatās ... // MAnuv_2,2.253a //



*8,399*

NYĀYASUDHĀ:
paśupaterime pāśupatā iti caturvidhā api gṛhyante /
te sadāśivaṃ jagadvicitraracanākartāramāhuḥ /
tato janmādyasya yata ityuktamasaditi /
ajñānādidoṣayuktaṃ kathaṃ jagatkartāramāhurityata uktam- doṣavarjitamiti //
sārvajñādyabhāve 'jñānādivarjanaṃ cetanasya nopapadyata ityataḥ sarvajñatvādikaiḥ sarvairguṇairyuktamityuktam /
yadvā sarvajñatvādikaiḥ sarvairguṇairyuktaṃ doṣavarjitamiti pradhānalakṣaṇaviruddhārthopanyāsaḥ /
jagadvicitraracanākartāramiti śrautabrahmalakṣaṇaviruddhārthoktiḥ ityavagantavyam /


*8,401*

tadetaddūṣayituṃ patyurasāmañjasyāditi sūtratātparyamāha- tacceti //

... tacca bahuśrutivirodhataḥ /
nopādeyaṃ mataṃ hy ... // MAnuv_2,2.253a-c //


NYĀYASUDHĀ:
caśabdaḥ pūrvatanaiḥ(mataiḥ) saha samuccayārthaḥ /
hiśabdo hetau /
tat paśupateḥ sarvajagatkāṇatvādikaṃ mataṃ nopādeyam /
kutaḥ /
patyuḥ paśupateḥ /
asāmañjasyāt doṣitvāt /
tadanaṅgīkāre ca bahuśrutivirodha iti yojanā /

kāstāḥ śrutaya ityatastā udāharati- asyeti //

... asya devasya stuhi gartagam // MAnuv_2,2.253cd //
utpipeṣa śirastasya gṛṇīṣe satpatiṃ padam /
yad viṣṇorupamaṃ hantuṃ rudramākṛṣṭate mayā // MAnuv_2,2.254 //
dhanuryaṃ kāmaye taṃ tamugraṃ mā śiśnadevatāḥ /
ghnañchiśnadevāneko 'sāvāsīnnārāyaṇaḥ paraḥ // MAnuv_2,2.255 //
tasmād rudraḥ samprasādaścābhūtāṃ vaiṣṇavaṃ makham /
yajñena yajñamayajantābadhnan puruṣaṃ paśum // MAnuv_2,2.256 //
yo bhūtānāmadhipatī rudrastanticaro vṛṣā // MAnuv_2,2.257ab //


NYĀYASUDHĀ:
anena"asya devasya mīḷhuṣo vayā viṣṇoreṣasya prabhuthe havirbhiḥ /
vide hi rudro rudriyaṃ mahitvaṃ yāsiṣyaṃ vartiraścivāvirāvat'; iti /
(ṛ.7-40-5) śrutimupādatte /

*8,401f.*

"stuhi gartagam'; ityanena"stuhi śrutaṃ gartamadaṃ yuvānaṃ mṛgaṃ na bhīmamupahatnumugram /
mṛḷā jaritre rudra stavāno 'nyaṃ te asmānnivapantu senā'; iti (ṛ.2-33-11) /
"utpipeṣa'; ityanena"rudrasya tveva dhanurārtniḥ ri utpipeṣa'; iti /
"gṛṇīṣaḥ'; ityanena"kumāraścitpitaraṃ vandamānaṃ prati nānāma rudropayantam /
bhūrerdātāraṃ satpatiṃ gṛṇīṣe stutastvaṃ bheṣajā rāsyasma'; iti (ṛ.2-33-12) /
"padam'; ityanena"tava śriye maruto marjayanta rudra yatte janima cāru citram /
padaṃ yadviṣṇorupamaṃ nidhāyi tena pāsi guhyaṃ nāma gonām'; iti (ṛ.5-3-3) /
"yaṃ kāmaye'; ityanena"yaṃ kāmaye taṃ tamugraṃ kṛṇomi taṃ brahmāṇaṃ tamṛṣiṃ taṃ sumedhām'; iti (ṛ.10-125-5) /
"mā'; ityanena"mā śiśnadevā api gurṛtaṃ na'; iti /
"ghnan'; ityanena"ghnaṃcchiśnadevāṃ abhivarpasā bhūd'; iti /
"ekosau'; ityanena"eko nārāyaṇa āsīnna brahmā naca śaṅkaraḥ'; iti /
"tasmāt'; ityanena"sa ruṣyaḥ sa prasanno yadruṣyo yatprasannastasmādrudrasamprasādāvabhūtām'; iti /
"vaiṣṇavam'; ityanena"teṣāṃ makhaṃ vaiṣṇavaṃ yaśa ārchat'; iti /
yajñeneti, abadhnanniti, yo bhūtānāmiti prasiddham /


*8,402*

kathametābhiḥ śrutibhiḥ paśupatenirrdeṣatvaṃ viruddhamityatastāsāṃ tātparyamāha- ityādīti //

ityādiśrutisāmarthyāt pāratantryaṃ janirmṛtiḥ // MAnuv_2,2.257cd //
parādhīnaparaprāptirajñatvaṃ praḷaye 'bhavaḥ /
pratīyante ... // MAnuv_2,2.258a-c //


NYĀYASUDHĀ:
abhavaḥ abhāvaḥ /
pratīyante paśupateriti śeṣaḥ /


*8,403*

"asya devasya'; ityanena parādhīnapadaprāptiḥ pratīyate /
mīḷhuṣaḥ secakasya, eṣasya icchārūpasya, asya viṣṇordevasya, pramṛthe prabharaṇe pūjāyāmiti yāvat /
havirbhiḥ kṛte sati vayā bandhako rudro, rudriyaṃ mahitvaṃ raudraṃ padaṃ, vide vivide lebhe, hi yathā tathā he aśvinau yuvāmapi irāvat annavat, varti vartanaṃ, yāsiṣyaṃ ayāsiṣya prāptavantau stha iti /

"stuhi'; ityanena stāvakatayā pāratantryam /
he rudra tvaṃ śrutaṃ prasiddhaṃ, gartasadaṃ hṛdayaguhānivāsaṃ, yuvānaṃ, mṛgaṃ na bhīmaṃ siṃhamiva bhīṣaṇam, ugram ugrāṇāṃ daityānām, upahantunam upahantāraṃ, nṛhariṃ, stuhi stauṣi /
sa evaṃ stavāna stuvaṃstvaṃ, jaritre stotre, tvāṃ stuvantaṃ mām /
mṛḷa mṛḍaya sukhasya /
te senāścāsmadanyameva nivapantu ghnantviti /

"rudrasya'; ityanenājñatvaṃ pāratantryaṃ mṛtiśca /
āropitaṃ dhanurhanāvavaṣṭabhyāvasthitasya rudrasya śiro jyāyāṃ (vabhrirū)kāmarūpeṇendreṇa chinnāyāmutkṣiptā dhanurārtnirutpipeṣa cicchedeti /

"kumāraḥ'; ityanenāpi pāratantryaṃ janiśca /
he rudra kumāraḥ putro bhavān jagadvayāmohanāya kailāsamupayantaṃ, tvāṃ vandamānaṃ pitaraṃ kṛṣṇaṃ prati nanāma /
tena stutastvaṃ bhūreḥ puruṣārthasya dātāraṃ satpatiṃ gṛṇīṣe stauṣi stutavānasi /
evambhūtastvamasmābhiḥ stutaḥ asme 'smabhyaṃ bheṣajā bheṣajāni saṃsāravyādhinirasanāni jñānāni rāsi dadāsi dehīti /

"tava śriyaḥ'; ityanena parādhīnapadaprāptirjaniḥ pāratantryaṃ ca /
he rudra yat yebhyaste janima janmābhūtte maruto brahmaṇo 'tītavartamānāstava śriye sampade cāru sundaraṃ citramāścaryaṃ upamaṃ upa samīpe mā lakṣmīryasya saṃvahanakartrī tattathoktam /
yadviṣṇoḥ padaṃ marjayantaḥ śodhitavantaḥ kṣālitavantaḥ /
tattvayā hṛdi nidhāyi nyadhāyi /
tena kāraṇena tvaṃ gonāṃ gavāṃ (vācāṃ) madhye guhyaṃ nāma nārāyaṇādikaṃ pāsi japopadeśādinā pālayasīti /
"aham'; ityanena mṛtiḥ /
ahaṃ brahmadviṣe brahmadviṣāṃ daityānāṃ śarave hiṃsakaṃ rudrāya rudraṃ hantavai hantumeva pralaye dhanurātanomi vistārayāmīti /


*8,404*

"yam'; ityanena parādhīnapadaprāptiḥ /
ahaṃ yaṃ yaṃ rudraṃ kartuṃ kāmaye taṃ tamugraṃ rudraṃ kṛṇomi karomi evaṃ taṃ brahmāṇaṃ tamṛṣiṃ taṃ sumedhāṃ sumedhasaṃ karomīti /

"mā'; ityanenājñatvam /
atītānāgatavartamānā guhyābhimānino devā rudrā api no 'smākamupāsyamṛtaṃ jñānarūpaṃ brahma māgurna jñātavanta iti /

ghnannityanena mṛtiḥ /
guhyābhimānidevānghnannīśvaro varpasā balena sarvamabhyabhūdabhibhūtavāniti /

"ekaḥ'; ityanena pralaye 'bhāvo janiśca /

"tasmāt'; ityanena janiḥ /
parameśvararoṣajo rudra ityarthaḥ /
samprasādo brahmā /

"teṣām'; ityādivākyaiḥ pāratantryam /
teṣāṃ devānāṃ yaśo, vaiṣṇavaṃ makhaṃ viṣṇumakhe paśutvena niyuktaṃ rudramārchatprāptavaditi /
devā yajñena rudreṇa paśunā yajñaṃ viṣṇumayajanteti /
devāḥ puruṣaṃ rudraṃ paśumabadhnanniti /
yo bhūtānāmadhipatī rudraḥ sa viṣṇorājñārūpāyāṃ tantyāṃ carati vṛṣā prasiddhatantyāmiveti /


*8,408*

etāsāṃ śrutīnāmetadarthatvopapādanaṃ tvacāryeṇaivānyatrodāhṛtebhyo vākyebhyaṣṭīkātaścāvagantavyam /
ata eva sāmarthyādityuktam /


*8,409*

sūtrārthamupasaṃharati- sadoṣatvāditi //

... sadoṣatvānneśaḥ paśupatistataḥ // MAnuv_2,2.258cd //

NYĀYASUDHĀ:
tataḥ śrutibalena sadoṣatvātpaśupatiḥ īśo jagatkartā na bhavati /
doṣi(ṇo)yajñadattasyeva jagatkartṛtvānupapatteriti /


*8,410*

yuktyantareṇa śivasya jagatkartṛtvamapākartuṃ sūtram oṃ sambandhānupapatteśca oṃ //
iti /
tasyārthamāha- aśarīratvata iti //

saṃbandhānupapatteś ca | BBs_2,2.38 |

aśarīratvatastasya sambandho jagatā kvacit /
kartṛtvena na yujyeta ... // MAnuv_2,2.259a-c //


NYĀYASUDHĀ:
tasya śivasya /
aśarīrasyāpi gaganāderjagatā sambandhadarśanātkathametadityata sambandhameve vyākhyāti /
kvacit kārye /
kartṛtveneti /
kāyarkartṛtvalakṣaṇaḥ sambandho na yujyata ityarthaḥ /
kvacidityanena kutaḥ sarvakartṛtvamiti sūcayati /
ayamatra prayogaḥ /
śivo na kartāśarīratvāt suptapralīnavaditi /

nanu śivaḥ siddho na vā /
na dvitīyaḥ /
āśrayāsiddheḥ /
ādye tu kartṛtvenaiva siddha iti dharmigrāhakamānavirodhaḥ /
kiñca bhavanmate('pi) śivasya kartṛtvaṃ śarīritvaṃ cāṅgīkriyata eva /
tathā cāpasiddhāntānyatarāsiddhī syātāmiti /
ucyate /
idamatrākūtam /
paśupaterjagatkāraṇatvaṃ vadanpraṣṭavyaḥ /
kiṃ pāśupatādiśāstrāṇyanumānāni (cā)vā'śrityedamucyate, uta śrutyādikam /
ādye tvatiprasaṅgo 'yamucyate /
yadi pāśupatādyāśrityedamucyate tarhi tasyāśarīratvamapi tataḥ siddhamiti tadapyaṅgīkāryaṃ syāt /
tathāca kartṛtvānupapattiriti /
ata eva na yujyateti liṅprayogaḥ /
dvitīye tu vakṣyata iti /
evañca na kaściddoṣaḥ /
śivasvarūpasya asmākaṃ śrutyāditaḥ siddherāśrayāsiddhayabhāvāt /
parasiddhenāśarīratvena kartṛtvābhāvāpādanāddharmigrāhakavirodhādyabhāvāt /

etena pāśupatādivirodhāt śrutayo 'nyathā yojyā iti nirastam /


*8,412*

nanvaśarīrasyāpi kartṛtve bādhakābhāvādvayāptividhuro 'yaṃ prasaṅgaḥ /

kārakaprayoktṛtvaṃ hi kartṛtvaṃ na śarīritvamityata āha- dehina iti //

... dehino jñānadṛṣṭitaḥ // MAnuv_2,2.259d //

NYĀYASUDHĀ:
satyaṃ kārakaprayoktṛtvameva kartṛtvaṃ na śarīritvamiti /
tacca na prayatnena vinā sambhavati /
na cecchāmantareṇa prayatnaḥ /
naca jñānādvinecchā /
naca śarīrādṛte jñānam /
dehināmeva jāgratāṃ jñānadarśanāt /
adehināṃ suptapralīnānāṃ cādarśanāt /
tataḥ kartṛtvasya vyāpakaṃ śarīraṃ śivādvayāvartamānaṃ tadapi vyāvartayatīti /


*8,413*

nanu jñānajanmanyeva śarīrasyopayogaḥ /
jñānasyendriyajanyatvāt /
indriyāṇāṃ ca śarīrasaṃyoganiyamāt /
nityajñānaśca bhagavāñchiva iti kiṃ tasya śarīreṇeti /
evaṃ tarhi prayatnajanmanyevecchopayoginīti nityaprayatnasyecchāpi na syāt /
tathecchotpattāveva jñānamupayujyata iti nityecchasya jñānamapi na syāt /


*8,413f.*

atha na prayatnamātraṃ kartṛtvam, api tarhi jñānecche api /
paridṛṣṭasāmarthyakārakaprayoktṛtvaṃ kartṛtvamiti hi vṛddhā iti cet /
tathāpīcchātyāge bādhakābhāvāt /
kutaścaivaṃ kalpanīyam /
kulālādau tathā darśanāditi cet /
kiṃ tatra śarīraṃ na dṛṣṭam /
dṛṣṭamapyanupayuktamiti cet /
kinniyamābhāvādevamāśrīyate, anyatropakṣayādvā /
nādyaḥ /
vyabhicārābhāvāt /
śarīrapreraṇe 'paraṃ śarīraṃ nāstīti cenna /
tenaiva saśarīratvāt /
na dvitīyaḥ /
nirastatvāt /
anyathā jñānādīnāmapyanupayogaprasaṅgaḥ /
kutaścāsya nityajñānatvasiddhiḥ /
āgamāditi cenna /
parasparāśrayaprasaṅgāt /
siddhe hyāgamaprāmāṇye nityajñāneśvarasiddhistatsiddhau cāgamasya tatpraṇītatvena prāmāṇyasiddhiriti /


*8,416*

uktadoṣaparihāramāśaṅkaya tannirāsāya sūtram oṃ karaṇavaccenna bhogādibhyaḥ oṃ //
iti /
tannetyantaṃ tāvadvayācaṣṭe- naceti //

karaṇavac cen na bhogādibhyaḥ | BBs_2,2.40 |

na ca dehādivad viśvamasya syād ... // MAnuv_2,2.260ab //

NYĀYASUDHĀ:
yaduktamaśarīratvācchivasya kartṛtvānupapattiriti /
tadasat /
kulālādayo hi kartāro daṇḍādikaṃ sākṣātprayatnenādhiṣṭhātumanīśānāstadadhiṣṭhānāya sākṣātprayatnādhiṣṭheyaṃ syāt /
tataḥ kimapareṇa śarīreṇa /
ata eva bhagavānviśvamūrtiriti gīyate /
na cādisṛṣṭeḥ prāk kārakābhāvaḥ /
māyāderanādervidyamānatvāt /
anyathā sṛṣṭayanupapatteriti /
ādipadenendriyāṇāṃ vakṣyamāṇasyādhiṣṭhānasya ca saṅgrahaḥ /
tadidaṃ nopapadyata ityarthaḥ /

kuto netyataḥ sautrahetuṃ vyākhyāti- bhogeti //

... bhogasambhavāt // MAnuv_2,2.260b //


*8,417*

NYĀYASUDHĀ:
yadi śivasya kārakagrāmaḥ sākṣātprayatnādhiṣṭheyaḥ syāttadā sa tasya sukhaduḥkhānubhavalakṣaṇabhogahetuḥ syāt /
sākṣātprayatnādhiṣṭheye 'smadādiśarīre tathā darśanāt /
karmārjitasyaiva tathātvamiti cenna /
sākṣātprayatnādhiṣṭheyatvena tathābhāvasyāpyāpatterbhogādimataśca neśvaratvam /
ataḥ śivasya bhogādiprasaṅgānneyaṃ kalpanā yukteti /

JOSHI-6

hetvantareṇa śivasya viśvakartṛtvaṃ nirākurvat oṃ adhiṣṭhānānupapatteśca oṃ //
iti sūtraṃ vyācaṣṭe- adhiṣṭhāna iti //

adhiṣṭhānānupapatteś ca | BBs_2,2.39 |

adhiṣṭhāne sthitaḥ kartā kāryaṃ kurvan pratīyate // MAnuv_2,2.260cd //

NYĀYASUDHĀ:
yaḥ kartā kulālādiḥ sa pṛthivyādāvadhiṣṭhāne sthita eva ghaṭādikāryaṃ kurvanpratīyate /
natu niradhiṣṭhānaḥ kaścitkiñcitkurvāṇaḥ /
anena vyatirekāvinābhāvena niradhiṣṭhānatvasyākartṛtvena vyāptirupapāditā bhavati /
tataḥ kimityata āha- nāsyeti //


*8,418*

nāsyādhiṣṭhānayogo 'sti bhūtānāṃ praḷaye tadā // MAnuv_2,2.260ef //

NYĀYASUDHĀ:
asya śivasya /
tadā ādisṛṣṭisamaye /
kuto nāsti /
prāgutpannānāṃ pṛthivyādīnāṃ mahābhūtānāṃ pralaye sati /
tasmātkartṛtvamapi tasya nopapadyata iti śeṣaḥ /
nanu kārakāṇāmeva adhiṣṭhānatvaṃ bhaviṣyati /
maivam /
sādhiṣṭhānasya cetanasya bhogādiprasakteruktatvāt /
nanvayaṃ niradhiṣṭhānatvahetuḥ karturvipakṣātkulālādirvākartuḥ sapakṣādghaṭāderapi vyāvṛttatvādasādhāraṇaḥ /
maivam /
gaganādau sapakṣe vṛtteḥ /

nanvidaṃ sūtradvayaṃ vyutkrameṇa kuto vyākhyātam /
sambandhānupapattyadhiṣṭhānānānupapattyorubhayorapi parihāraḥ karaṇavaccedityanena nirasyata iti jñāpanārtham /
yadi khalu yathākramameva vyākhyāyeta /
tadā sannihitādhiṣṭhānānupapattiparihāranirāsakamevedaṃ jñāyeta /
vyutkrameṇa tu ubhayamadhye vyākhyāne satyubhayasambandhi vijñāyata iti /
ata eva bhāṣye 'dhiṣṭhānādirūpamityuktamatra tu dehādivaditi /


*8,419*

nanu yuktaṃ kulālasyādhiṣṭhānasāpekṣatvaṃ śarīritvam /
śarīraṃ hi gurutvātprasaktapatanaṃ tatpratibandhāya sparśavadadhiṣṭhānamapekṣate /
anavasthitaśarīrasya kartṛtvāyogāt /
īśvarasya tu śarīravidhurasya kimadhiṣṭhānameva /
ihedaṃ jātamityadivyavahārastu gaganādikamāśrityopapatsyata ityata āha- adehaścediti //

adehaścedasārvajñaḥ śilākāṣṭhādivat sadā // MAnuv_2,2.261ab //

NYĀYASUDHĀ:
sadetyanena vyāptimupapādayati /
ata eva śilākāṣṭhādivadityanekadṛṣṭāntopādānam /
tathāca kutaḥ sāvarjñam /
kutaśca sarvakartṛtvamiti bhāvaḥ /
syādetat /
na sarvathā sadāśivaḥ aśarīraḥ /
kintu līlayā śarīrāṇyapi gṛhṇāti /
tato nāyaṃ doṣaḥ /
naca bhogādiprāptiḥ /
līlayā gṛhītasya vigrahasya tadahetutvādityata āha- dehī cediti //

dehī cedantavāneva yajñadattanidarśanāt // MAnuv_2,2.261cd //


*8,420*

NYĀYASUDHĀ:
antavānmaraṇavānsyāt /
upalakṣaṇaṃ caitat /
duḥkhādimāṃśca syādityapi draṣṭavyam /
nanvasau vigraho na taddheturityuktam /
maivam /
śarīraṃ na bhogāyatanaṃ cetyasya vyāhatatvāt /
śarīratvenaiva tadanumānācca /
tadidamāha- eveti //
etena"antavattmasarvajñatā vā'; iti sūtraṃ vyākhyātaṃ bhavati /
pāṭhakramādarthakramo garīyānityato vyutkrameṇa vyākhyānam /


*8,421*

nanvevaṃ śivasya jagatkāraṇatvamapākurvatāṃ ko 'bhiprāyaḥ /
kimakartṛkamevedaṃ viśvamiti /
kiṃvā viṣṇukartṛkamiti /
nādyaḥ /
kāryasyākartṛkatve virodhāt /
apasiddhāntaprasakteśca /
na dvitīyaḥ /
viṣṇāvapi kartaryabhyupagamyamāne doṣāṇāmeṣāṃ samānatvena (sva)vyāhatatvāt /
tathāhi yaduktamasāmañjasyaṃ śivasya tattāvadviṣṇāvapi samam /
"janitota viṣṇoḥ'; ityādau janmādidoṣaśravaṇāt /
sambandhānupapattyādikaṃ tu sphuṭamevetyata āha- naceti //

nacaitadakhilaṃ viṣṇau ... // MAnuv_2,2.262a //

NYĀYASUDHĀ:
etadakhilaṃ doṣajātaṃ, viṣṇāvapi viśvasya kartaryabhyupagate samānamiti na vācyam /
kutaḥ /
śrutyaiva sakaladoṣaparihāreṇa viṣṇorviśvakāraṇatvasya pratipāditatvāt /

nanu paśupaterapyevamāgamairanumānaiśca jagatkāraṇatā pratipāditaiva /
tataḥ ko viśeṣa ityata āha- śrutīti //

... śrutiprāmāṇyagauravāt // MAnuv_2,2.262b //

NYĀYASUDHĀ:
pāśupatādito 'pi śrutīnāṃ prāmāṇyasya gurutvāt /
etaduktaṃ bhavati /
pāśupatādikaṃ hi śive jagatkartari sarvajñe siddhe tatpraṇītatvena pramāṇatvena niścīyeta /
niścite ca tatprāmāṇye śivasyaivaṃvidhasya siddhirityanyonyāśrayatā duravadhāraṇaprāmāṇyam /
anyataḥ śivasyaivaṃvidhatāsiddhāvalamanena /
na cānyattādṛśaṃ pramāṇamasti /
anumānānāṃ dūṣitatvāt /
nacaivaṃ śrutiprāmāṇyam /
apauruṣeyatvena karaṇadoṣāṇāṃ bādhakapratyayasya cābhāve sati tasya niṣkampameva svato niścitatvāt /
ato niścitapramāṇabhāvayā śrutyā vidhūtāvadyagandhaṃ viṣṇorjagatkāraṇatvaṃ siddhayatyeveti /


*8,423f.*

kāstāḥ śrutaya ityatastā udāharati- mana iti //

manobuddhayaṅgitāṃ viṣṇorlakṣayāmo ya eva saḥ // MAnuv_2,2.262cd //
sa eva deho vijñānamaiśvaryaṃ śaktirūrjitā /
deho viṣṇorna te viṣṇo vāsudevo 'grato 'bhavat // MAnuv_2,2.263 //
eko nārāyaṇastvāsīnna brahmā naca śaṅkaraḥ /
ajasya nābhāvadhyekamarpitaṃ mātrayā paraḥ // MAnuv_2,2.264 //
saddehaḥ sukhagandhaśca jñānabhāḥ satparākramaḥ /
jñānajñānaḥ sukhasukhaḥ sa viṣṇuḥ paramākṣaraḥ // MAnuv_2,2.265 //
ānanda eka evāgra āsīnnārāyaṇaḥ prabhuḥ /
priyaṃ tasya śire modapramodau ca bhujau hareḥ // MAnuv_2,2.266 //
ānando madhyato brahma pucchaṃ nānyadabhūt kvacit /
manaso 'syābhavad brahmā lalāṭādapi śaṅkaraḥ // MAnuv_2,2.267 //
pakṣayorgaruḍaḥ śeṣo mukhādāsa sarasvatī /
sahasraśīrṣā puruṣaḥ sahasrākṣaḥ sahasrapāt // MAnuv_2,2.268 //


*8,424*

NYĀYASUDHĀ:
anena"buddhimano 'ṅgapratyaṅgavattāṃ bhagavato lakṣayāmāha /
buddhimānmanovānaṅgavānpratyaṅgavān'; iti śrutimupādatte /
"ya eva'; ityanena"yadātmako bhagavāṃstadātmikā vyaktiḥ kimātmako bhagavānjñānātmaka aiśvaryātmakaḥ śaktyātmakaḥ'; iti /
ūrjitā balavatī /
sarvatrāpratibaddhā /
etadātamako bhagavāṃstatastasya deho 'pyetadātmaka iti śrutilabdho 'rthaḥ /
"na te viṣṇau'; ityanena"na te viṣṇo jāyamāno na jāto devamahimnaḥ paramantamāpa'; iti /
"vāsudevaḥ'; ityanena"vāsudevo vā idamagra āsīt'; iti /
"mātrayā'; ityanena"paro mātrayā tanvā vṛdhāna na te mahitvamanvaśnuvanti'; iti /

kathametābhiḥ śrutibhirabhipretārthasiddhirityatastāsāṃ tātparyamāha- ityādīti //

ityādiśrutisandarbhabalānnityaguṇātmanaḥ /
viṣṇordehājjagat sarvamāvirāsīditīyate // MAnuv_2,2.269 //


NYĀYASUDHĀ:
nityaścāsau guṇātmā ceti tathoktaḥ /
tasmāt /
tatra"buddhiḥ'; iti śrutyā viṣṇordehavattvamavagamyate /
aṅgaṃ dehaḥ, pratyaṅgāni hastādīni, lakṣayāmahe jñāpayāmaḥ /
kathaṃ buddhimānityādi /
"yadātmako bhagavān'; ityanayā bhagavato dehasya jñānādiguṇātmakatvāt /
vyaktiḥ dehaḥ /
"na te viṣṇau'; ityanā bhagavo dehasya jñānādiguṇātmakatvamanādinityatvam /
jātādibhiraprāpyamahitvasyānyathānupapatteḥ /
"vāsudevaḥ'; iti śrutidvayenānādinityadehatvam /
"ajasya'; ityanayā dehavattvaṃ tasyāpyajatvam /
"paro mātrayā'; ityanayā deśakālaguṇairaparicchinnatanutvam /
"saddehaḥ'; ityādiśrutidvayena janmādidoṣarahitaguṇātmadehavattvam /
saddeho janmādidoṣarahitadehaḥ /
sukhagandhaḥ sugandhaḥ /
jñānabhā na tu taijasabhāḥ /
jñānajñāna ityāderatiśayitajñāna ityādirityarthaḥ /
priyādiśabdāḥ sukhaviśeṣavācinaḥ /
anyat prākṛtādikam /
"manasaḥ'; ityādiśrutidvayena dehavattvaṃ tato jagato janma ca /
"brāhmaṇo 'sya'; ityādivākyaśeṣāt /
pakṣayoḥ pārśvayoḥ /


*8,424f.*

atra kāsucit śrutiṣu vivakṣitārtho na sphuṭaṃ pratīyate /
kintūpapattisādhya ityāśayavatoktam- balāditi //
āvirāsīdityanena satkāryavādaṃ sūcayati /
īyate jñāyate /
atra sakalajagatkāraṇatvasyaiva śrutisiddhatve sarvadoṣaparihāraḥ sidhyatyeva /
nahi doṣeṣu satsu tatsambhavati /
tathāpi dehābhāvaprayuktāni dūṣaṇāni prayuktāni /
tasya ca dehasya jñānānandādiguṇātmakatvena jananādidoṣaparihāro 'pi siddhaḥ /
janitotetyādivākyaṃ tu bahvībhirniravakāśādibhiḥ śrutibhiḥ viruddhamanyathāvyākhyeyam /
tadidamuktam- sandarbhabalāditi //


*8,428*

syādetat /
deho jñānānandādiguṇātmānādinityaścetyetacchaśo viṣāṇavānitivadviruddham /
yo dehaḥ sa bhautiko janmādimāniti niyamadarśanāt /
tato viṣṇordehamaṅgīkṛtya tasyābhautikatvādyaṅgīkāre śaśasyāpi viṣāṇitvamaṅgīkāryamityato dehasyābhautikatvādinā virodhaṃ tāvadapākaroti- mānasattvāditi //

mānavattvād virodhaḥ ko ... // MAnuv_2,2.270a //

NYĀYASUDHĀ:
ka ityākṣepe /
nāsti virodha ityarthaḥ /
idānīṃ śaśaviṣāṇapratibandīṃ mocayati- neti //

... nāmānaṃ kvacidiṣyate // MAnuv_2,2.270b //

NYĀYASUDHĀ:
aṅgīkurmaḥ śaśaviṣāṇamapi /
yadi parameśvaravigrahasyānandādyātmakatvamasti prāmāṇikaṃ syāt /
nacaivam /
nahyaprāmāṇikaṃ kenāpi kadāpi kvacidapyeṣyuṃ śakyata iti /
nanu prāmāṇikatve 'pi virodhābhāvaḥ kathamityata āha- avirodha iti //

avirodho virodhaśca mānenaiva hi gamyate // MAnuv_2,2.270cd //

NYĀYASUDHĀ:
yayoḥ kvacitsahadarśanaṃ tayoravirodhaḥ /
yayostu niyamena vyadhikaraṇatayaiva daśarnaṃ tayoḥ virodha ityevaṃ sahadarśanāsahadarśanalakṣaṇena mānena (hi) vastūnāmavirodhavirodhāvavagantavyau /
tanniyamākasyānyasyābhāvāt /
ataḥ pramāṇena sahadṛṣṭe 'rthe virodhaḥ kathaṃ syādvayāghātāditi /

upasaṃharati- ata iti //


*8,429*

ata uktaṃ samastaṃ ca vāsudevasya yujyate // MAnuv_2,2.271ab //

NYĀYASUDHĀ:
pramāṇaiḥ sahadṛṣṭe 'rthe virodhasyānāśaṅkanīyatvāt /
uktam udāhṛtābhiḥ śrutibhiḥ /
samastaṃ cidānandādyātmakaniravadyavigraheṇa jagatkāraṇatvam /
etaccārūpavadevetyādinā vakṣyamāṇaṃ śiṣyahitaiṣiṇā'cāryeṇātroktamiti jñātavyam /


nanvetadasmākamapi samānam /
tathāhi /
yadyapi pāśupatādikamaśakyāvadhāraṇapramāṇabhāvam /
tathāpi"jñātvā śivaṃ śāntimatyantameti /
'"eko rudro na dvitīyāya tasthe /
'"sa imān lokānīśata īśanībhiḥ'; ityādyāḥ śrutayastāvacchivasya jagajjanmādihetutāmācakṣate /
śivādināmopetatvāt /
naca tathāvidhasyāsamañjasatvaṃ sambhavatītyudāhṛtāḥ śrutayo 'nyathā yojyāḥ /
ataḥ sambandhānupapattyādikaṃ śrutirevābhāsayiṣyati /
tadghaṭakaṃ vā kimapi kalpayiṣyatītyata āha- śivādīti //

śivādināmayuktāśca śrutayo viṣṇuvācakāḥ // MAnuv_2,2.271cd //

NYĀYASUDHĀ:
bhavedevaṃ yadyetāḥ śrutayaḥ śivaparāḥ syuḥ /
nacaivam /
kintu śivādināmayuktā api viṣṇuviṣayā eva /

nanvetatkutaḥ /
evaṃ satyasmābhirapi vaktuṃ śakyata eva /
eko nārāyaṇa ityādyā api śrutayaḥ śivaparā iti /
maivam /
śivādināmnāṃ viṣṇau śaktimattvāt /
nārāyaṇādināmnāṃ śive śaktyabhavāt /
atrāpi kiṃ mānamityata āha- nāmānīti //


*8,430*

nāmāni sarvāṇi ca yameko yo devanāmadhāḥ /
viṣṇunāmāni nānyasya sarvanāmā hariḥ svayam // MAnuv_2,2.272 //
na nārāyaṇanāmāni tadanyeṣvapare harau /
ityādiśrutayastatra mānaṃ coktaḥ samanvayaḥ // MAnuv_2,2.273 //


NYĀYASUDHĀ:
anena"nāmāni viśvābhi na santi loke'; ityādikāṃ śrutimupādatte /
"ekaḥ'; ityanena /
"yo devānāṃ nāmadhā eka eveti /
nāmāni dhatta iti nāmadhāḥ /
nānyasya vācakāni /
na tadanyeṣu vartante /
apare śivādiśabdāḥ /
uktaḥ samanvayaśca tatra mānamiti sambandhaḥ /
samanvayagrahaṇenaitadapi parihṛtam /
etā api śrutīrahaṃ śivādivi(vavi)ṣayatayā vyākhyāsyāmīti /
upakramādibhirliṅgādibhiśca bhagavatparatayā niścitatvāditi /


*8,431*

mā bhūcchatibhiḥ śivasya jagatkāraṇatvāvadhāraṇaṃ śaivapurāṇaistu bhaviṣyati /
naca tānyapi viṣṇuparāṇi /
upakramādibalena śivaviṣayatayā niścitatvādityata āha- purāṇānīti /

purāṇāni purāṇādyairviruddhatvānna tat pramā // MAnuv_2,2.274ab //

NYĀYASUDHĀ:
purāṇādyaiḥ vaiṣṇavaiḥ /
viruddhatvāt prāk prābalyacintāyāḥ satpratipakṣatvāt /
taduttaraṃ bādhitatvācca /
tat tatra, śivasya jagatkāraṇatve /

na kevalaṃ vaiṣṇavādipurāṇādiviruddhatvādapramāṇaṃ śaivapurāṇam /
kintu śaivapramāṇa(purāṇa)viruddhatvādapītyāha- taditi /

tadviruddheṣu no mānaṃ pūrvāparavirodhataḥ // MAnuv_2,2.274cd //

NYĀYASUDHĀ:
tadviruddheṣu śaivapurāṇādiviruddheṣu śivajagatkāraṇādiṣu no mānam /
śaivapurāṇamiti śeṣaḥ /
kathaṃ śaivapurāṇasya śaivapurāṇavirodha ityata āha- pūrveti //
etaccānyatra darśitam /
kiñca śaivavaiṣṇavapakṣapātaśūnyabrāhmapurāṇaviruddhatvācca śaivapurāṇaṃ vimate 'rthe na mānamityāha- sameti //

samabrāhmavirodhācca ... // MAnuv_2,2.275b //

NYĀYASUDHĀ:
idamapyanyatra darśitam /
evaṃ tarhi vaiṣṇavānāmapi purāṇādīnāmaprāmāṇyaṃ syāt /
teṣāmapi śaivabrāhmapurāṇaviruddhatvātpūrvāparavirodhāccetyata āha- niyamāditi //


*8,432*

... niyamād vaiṣṇaveṣvapi // MAnuv_2,2.275b //

NYĀYASUDHĀ:
ekaprakāratvāt /
pūrvāparavirodhābhāvāt /
śaivādipurāṇānāmetatpratibandhakatvādyasāmarthyādityaperarthaḥ /
teṣāṃ nāprāmāṇyamiti śeṣaḥ /
nanu vaiṣṇaveṣvapi purāṇādiṣu śivādīnāṃ jagatkāraṇatvādikaṃ viṣṇunā tadīyastutyādikāraṇaṃ ca pratīyata eva /
tatkathaṃ niyama ucyata ityata āha- mohārthamiti //

mohārthamuktitaścaiva ... // MAnuv_2,2.275c //

NYĀYASUDHĀ:
śivādīnāṃ jagatkāraṇatvāderayogyajanavyāmohanārthamevoktiḥ, caśabdādviṣṇunā śivastutyādermohārthaṃ kṛtasyānuvādataśca niyamo na viruddha iti /
kathaṃ śaivapurāṇādīnāṃ pratirodhakatvādyasāmathyarmityata āha- mohārthamiti //
śaivapurāṇādīnāṃ mohārthameva uktitaḥ kṛtatvāt /
caśabdena vaiṣṇavānāṃ tattvajñānātharmeva kṛtatvāt /
atra cārthe 'nyatra pramāṇānyuktāni /


*8,433*

adhikaraṇārthamupasaṃharati- viṣṇuriti //

... viṣṇureko guṇārṇavaḥ // MAnuv_2,2.275d //

NYĀYASUDHĀ:
tasmāditi siddhamiti śeṣaḥ /
nanu skandādimatānyapyuktārthavirodhīni santi tāni kuto 'tra na nirākriyanta ityata āha- skandeti //

skandasūryagaṇeśādimatāni nyāyato 'mutaḥ /
nirākṛtāny ... // MAnuv_2,2.276a-c //


NYĀYASUDHĀ:
amuto nyāyataḥ pāśupatamatanirākaraṇanyāyataḥ /
ato na nirākriyanta iti śeṣaḥ /
kathamanena nyāyena tannirākaraṇamityata āha- aśeṣeṇeti //

... aśeṣeṇa siddhāntasyāviśeṣataḥ // MAnuv_2,2.276cd //

NYĀYASUDHĀ:
kātsnaryena tadīyasiddhāntānāṃ pāśupatasiddhāntasya cāviśeṣataḥ /
kevaladevatāntaraparigraheṇaiva siddhāntabhedaḥ /
prakriyā tu sarvatra samānaiva /
ataḥ pūrvanirākaraṇanyāyenaiva tannirākaraṇaṃ yuktameveti bhāvaḥ /

// iti śrīmannyāyasudhāyāṃ patyuradhikaraṇam //


___________________________________________________________________________


*8,434*


[======= JNys_2,2.XI: utpatty(aśakty)adhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ utpattya(śaktya)dhikaraṇam //

// oṃ utpattyasambhavāt oṃ //
śāktaṃ matamatrāpākriyate /
na nirākartavyamevaitat /
skāndādimatavadasyāpi pūrvanyāyenaiva nirastatvāt /
yathā hi /
patyurityasya sthāne skandasyetyādi paṭhitvāsāmañjasye tadanusāriṇyaḥ śrutaya udāhriyante /
sambandhānupapattyādikaṃ ca tadviṣayaṃ yojyate /
tathā śaktāvapi vaktuṃ śakyameva(te) /
anyathā skandādiśarnamapi pṛthagapākaraṇīyaṃ syāt /
athocyeta /
śāktamate pāśupatādācārabhedādervidyamānatvāttatsiddhāntāviśeṣo nāstīti /
tanna /
saurādimateṣvapi tasya vidyamānatvāt /
atha kiṃ tena /
devatāviśeṣaparigrahamantareṇoktārthaviruddho dūṣyo 'tharḥ sarvatra samāna eveti brūṣe /
tacchākte 'pi samānamityato naitadapi pṛthagapākaraṇīyamityata āha- nirākṛtāviti //

utpattyasaṃbhavāt | BBs_2,2.42 |

nirākṛtau viśeṣasya bhāvācchaktimataṃ pṛthak /
dūṣyate ... // MAnuv_2,2.277a-c //


NYĀYASUDHĀ:
satyam /
skandādivacchāktasyāpi matasya na pāśupatādviśeṣaḥ /
ata evoktadoṣagrāmaviṣayatvamapi /
tathāpi tatrāsādhāraṇasya dūṣaṇa(syāpi vi)sya vidyamānatvāttadvivakṣayā śaktimataṃ pṛthagbhaṅgayā dūṣyate sūtrakāreṇa /
utpattyasambhavo hi śāktasyaivāsādhāraṇadoṣo na tu puruṣadaivatānām /
etacca vakṣyāma iti /


*8,436*

evamadhikaraṇārambhamupapādyedānīṃ śāktamata(sthiti)mupanyasyati- mahatīti //

... mahatī devī hrīṅkarī sarvakāraṇam /
tripurābhairavītyādināmabhiḥ sābhidhīyate // MAnuv_2,2.277c-f //


NYĀYASUDHĀ:
śaktimatamiti vartate /
sarvasyāgāminā itiśabdena sambandhaḥ /
devī mahatī sarvotkṛṣṭeti śaktimatamiti /
kathaṃ mahatītyata uktam- sarvakāraṇamiti //
sakalajagatsṛṣṭayādikāraṇatvāt sārvajñādisarvaguṇavatī samastadoṣadūrā bha(ga)vatītyataḥ sarvotkṛṣṭeti /
nanvidaṃ śāstramanyonyavyāhataṃ kathaṃ pramāṇaṃ syāt /
bhuvaneśvarītantre hi saiva mahatī sarvakāraṇamiti cocyate /
tripurātantre tu tripuraiva /
tathā bhaivarītantre bhairavī /
evaṃ kubjikāditantreṣvanyā cānyā ca /
naca bahvīnāṃ sarvottamatvamupapadyata ityata uktam /
hrīṅkārī tripurā bhairavītyādināmabhiḥ sā bhagavatyekaivābhidhīyate /
ato na (nānyonya) vyāghāta iti /

śāktāśca trividhāḥ /
mahāvāmā madhyavāmā aṇuvāmāśceti /
eta eva kvacicchāktaśāmbhavā'ṇaśabdairucyante /
tatrādyānāṃ mataviśeṣaṃ darśayati- tasyā iti //

tasyāḥ sadāśivādyāśca jāyante devamānuṣāḥ /
bhūtabhautikamapyetaditi ... // MAnuv_2,2.278a-d //


NYĀYASUDHĀ:
tasyāḥ kevalāyā eva śakteḥ /
sadāśivagrahaṇena matāntarādbhedo darśitaḥ /
tatra sadāśivasya śaktito janmānabhyupagamāt /
evamupanyastaṃ mahāvāmamataṃ tāvadayuktamityāha- taditi //

... tannopapadyate // MAnuv_2,2.278d //


*8,437*

NYĀYASUDHĀ:
nirantaropanyastaṃ mahāvāmamataṃ taditi parāmṛśati /


kuta ityākāṅkṣāyāṃ sūtram utpattyasambhavāditi /
tadvayākhyātuṃ tāvadvayāptimupapādayati- dṛṣṭeti //

dṛṣṭā pumbhyaḥ sadā sṛṣṭiḥ strīpumbhyo vā viśeṣataḥ /
kevalābhyo nahi strībhyastata utpattyasambhavāt // MAnuv_2,2.279 //
nārcyaṃ mahāvāmamataṃ ... // MAnuv_2,2.280a //



*8,438*

NYĀYASUDHĀ:
atra sṛṣṭiśabdenāpattyotpattirvivakṣitā na sṛṣṭimātram /
tasya kevalābhyo 'pi strībhyo darśanāt /
sadeti vyabhicārābhāvaṃ sūcayati /
vāśabdastuśabdārthaḥ /
viśeṣataḥ prācuryeṇa /
keṣāñcideva hi droṇādīnāṃ sṛṣṭiḥ kevalebhyaḥ puruṣebhyo dṛṣṭā /

nanvacaturādisūtreṇa strīpuṃsebhya iti bhavitavyam /
strīpuṃbhya iti katham /
"samāsānto vidhiranityaḥ'; iti bhaviṣyati /
yadvā dvandvātparaḥ samāsānto 'sau nipātitaḥ /
atra tu strībhiḥ sahitāḥ pumāṃsaḥ (strīmumāṃsaste)tebhya iti na dvandva iti na bhaviṣyati /
kevalābhyaḥ puru(ṣānugrahahīnābhyaḥ)ṣānanugṛhītābhyaḥ /

tataḥ kimityataḥ sūtraṃ vyākhyāti- tata iti //
yata evaṃ vyāptiryataśca prakṛtā(tiḥ) kevalā /
śivādīnāṃ tato janmāṅgīkārāt /
tataḥ kāraṇāttataḥ śakterapatyotpattyasambhavāt ityarthaḥ /


*8,439*

ayamatra prayogaḥ /
ādikālīnāpattyotpattirna kevalastrīkṛtā(kartṛkā) apatyotpattitvāt /
yāpattyotpattiḥ sā na kevalastrīkartṛkā /
yathā sampratipannā /
sā hi kadācit puruṣamātrātkvacitpuruṣānugṛhītābhyaḥ strībhyo dṛṣṭā /
na punaḥ kvāpi kevalābhyaḥ strībhyo dṛṣṭā /
yenoktavyāptervyabhicāraḥ syāditi /
yadvā śaktirnāpattyaprasavitrī kevalastrītvātsampratipannakevalastrīvat /
atra kevalābhyo na hi strībhya ityanvayakathanaṃ dṛṣṭetyādi tadvayabhicāraparihārārthamiti jñātavyam /
yadi vā kevalastrītvānnāpatyaprasavitrī cecchaktiḥ syāttadā kevalapu(lātpu)ruṣatvāt puruṣottamo 'pi tathā na syādityākṣepamapākartuṃ prāgeva dṛṣṭetyādyuktam /
asiddhaṃ ca kevalatvaṃ tasya lakṣmīpaterityāśayena strīpuṃbhya ityuktam /
kevalābhya iti tu vyāptyupapādakam /
athavā yat"nirākṛtau viśeṣasya bhāvāt'; ityanenāsya doṣasyāsādhāraṇatvamuktam tadupapādanāya dṛṣṭetyādyupanyāsaḥ /


*8,441*

idānīmadhikāśaṅkayā matāntaramutthāpayati- vāmairiti //

... vāmairanyadudīryate // MAnuv_2,2.280b //

NYĀYASUDHĀ:
madhyavāmairityarthaḥ /
anyat mahāvāmasiddhāntāt /
kiṃ tadityata āha- śiveti //

śivopasarjanā śaktiḥ sasarjedaṃ samantataḥ // MAnuv_2,2.280 //
iti ... // MAnuv_2,2.281a //


NYĀYASUDHĀ:
śiva upasarjanaṃ yasyāḥ sā śivopasarjanā /
idamityasyaiva vyākhyānaṃ samantato deśe kāle ca vartamānaṃ kāryamiti /
etaduktaṃ bhavati /
notpattyasambhavo 'smanmate 'sti /
asmābhiḥ śivasahitāyāḥ śakterviśvaprasa(bha)vasyāṅgīkṛtatvāt /
nacaivaṃ (ta)dvayoḥ sarvotkṛṣṭatvaṃ viruddhamāpadyate /
śivasya śaktiṃ patyupasarjanatvāṅgīkārāditi /
etatpratiṣedhati- tacceti //

... taccopapannaṃ na ... // MAnuv_2,2.281ab //

NYĀYASUDHĀ:
atrāpyutpattyasambhavasyāparihārāditi bhāvaḥ /

na ca kartuḥ karaṇam | BBs_2,2.43 |

... śivasyākaraṇatvataḥ /
adehatvād ... // MAnuv_2,2.281bc //



*8,441f.*

NYĀYASUDHĀ:
akaraṇatvata ityasyaiva svapadasya varṇanamadehatvāditi /
yadvākaraṇatvato jñānādikāraṇābhāvādityarthaḥ /
tadeva kathamityato 'karaṇatvato nirindriyatvādityuktam /
tadapi kuta ityata uktamadehatvāditi /
etaduktaṃ bhavati /
dehavatā hi śivenāpatyotpattau śakteḥ sācivyamācaraṇīyam /
na videhena /
tasya pra(vi)līnavadindriyādivijñānādivikalasya tadanupapatteḥ /
naca śivadehotpattau kevalāyāḥ śakteḥ śaktirasti /
prāguktadoṣāt /
anyathātrāpi tathopapattau śivāṅgīkāravaiyarthyāpatteśca /
naca śivasahitāyāḥ /
videhasya sāhāyyakaraṇānupapatteḥ /
ataḥ aṅgīkṛtasyāpi śivasyājāgalastanāyitatvenātrāpyutpattyasambhava eveti /

matāntaramutthāpayati- api hīti //

... api hyanye brūyuḥ sarvajñamīśvaram // MAnuv_2,2.281cd //
aṇuvāmā ... // MAnuv_2,2.282a //



*8,443*

NYĀYASUDHĀ:
anye 'pītyanvayaḥ /
tāneva viśeṣanāmnā'ha- aṇuvāmā iti //
asya matasya loke pracuratāṃ sūcayituṃ hiśabdaḥ /
sarvajñamityupalakṣaṇam /
jagatsṛṣṭayādyupayuktasakalakāraṇopetam /
idamuktaṃ bhavati /
śivasahitā śaktirjagajjananītyabhyupacchato mama noktadoṣaḥ /
śivasya svābhāvikasārvajñādimattvena dehendriyānapekṣaṇāt /
līlāvigrahagrahaṇena śaktisāhāyyakaraṇasyā(sambhogasyā)pyupapatteriti /
tadidaṃ dūṣayati- na taditi //

... na tadyuktam ... // MAnuv_2,2.282a //


NYĀYASUDHĀ:
kuta ityatra sūtram oṃ vijñānādibhāve vā tadapratiṣedhaḥ oṃ //
iti /
tasyārthaḥ /
śivasya vijñānādibhāve aṅgīkṛte tasya matasya pratiṣedho na kriyata iti /
nanvidaṃ matamanumānaṃ na vā /
nādyaḥ /
uktārthaviruddhatvāt /
na tadyuktamityasya cāyogāt /
dvitīye kathaṃ tadapratiṣedha ityuktam /
kathaṃ ca na tadyuktamityatrāsya hetutvamityatastadapratiṣedha iti niveśayitumutsūtraṃ tāvaddhetumāha- īśeti //

vijñānādibhāve vā tadapratiṣedhaḥ | BBs_2,2.44 |

... īśavādapraveśanāt // MAnuv_2,2.282b //

NYĀYASUDHĀ:
śaivamatapraveśāpatterityarthaḥ /


*8,444*

nanu śaivāḥ sārvajñādiguṇopetaṃ śivamekamevābhyupayanti /
śāktāstu śivaṃ śaktiṃ cetyasti mahānsiddhāntabhedaḥ /
tatkathaṃ śāktānāṃ śaivamatānupraveśa ityata āpāditadoṣo 'yamityāśayavānāha- sārvajñādīti //

sārvajñyādiguṇairyuktaṃ gurukalpanayā dvayam // MAnuv_2,2.282cd //
na yujyate ... // MAnuv_2,2.283a //


NYĀYASUDHĀ:
satyaṃ śāktaiḥ sārvajñādiguṇairyuktaṃ śivaśaktyākhyaṃ dvayamabhyupagatamiti /
tattu na yujyate /
kalpanāgauravāt /
tathāhi /
na tāvatsārvajñādyupetaṃ pratyakṣeṇa siddham /
paracittavṛttīnāṃ paraṃ pratyatīndriyatvāt /
nāpyāgamena /
śaktāgamasya prāmāṇyasandehāt /
apauruṣeyāgamasya pareṇa prāmāṇyānādaraṇāt /
ādaraṇe vā tata eva svamatahāneḥ /
tataḥ prapañcaracanānupapattyaiva tathāvidhaṃ vastu kalpanīyam /
ekenaiva sārvajñādimatā sarvaṃ nirvahatyeva /
tathāca vṛthā tathābhūta(vastu)dvayakalpane kalpanāgauravameva /
ata ekameva tādṛśaṃ vastvaṅgīkāryamiti /

tataḥ kimityata āha- tata iti /

... tatastvīśa eka eva prayojakaḥ // MAnuv_2,2.283b //

NYĀYASUDHĀ:
uktahetorekasyaiva sārvajñādimato 'ṅgīkāryatve kevalaśakteraṅgīkṛtāvutpattyasambhavaprasaṅgādīśa eva sārvajñādyupetaḥ prapañcaracanāyāḥ prayojakaḥ śāktairaṅgīkartavyaḥ syāt /
evañca kathaṃ na śaivamatapraveśaḥ śāktamatasyeti /


*8,445*

kimato yadyevam /
śāktasyāpasiddhāntena parājayaḥ syāditi cetsatyam /
tāvatāpi bhagavatsiddhāntānavakḷptireva /
śaivamatasyāpi bhavatsiddhāntavirodhitvena nirākatarvyatvādityatastadapratiṣedha iti sūtrāṃśaṃ sopapattikaṃ niveśayati- ukteti //

uktadoṣaśca tatpakṣa iti naivātra dūṣyate // MAnuv_2,2.283 //

NYĀYASUDHĀ:
yataḥ śaivapakṣo nirantarātītādhikaraṇa evoktadoṣo 'to 'tra na punardūṣyate punaruktidoṣabhayāditi /


evaṃ pratyekamapākṛtāni trīṇyapi matāni sādhāraṇadūṣaṇena nirākartuṃ sūtram /
oṃ vipratiṣedhācca oṃ iti //
tadvyācaṣṭe- śrutīti //

vipratiṣedhāc ca | BBs_2,2.45 |

śrutismṛtītihāsānāṃ sāmastyena virodhataḥ /
satāṃ jugupsitatvācca nāṅgīkāryaṃ hi tanmatam // MAnuv_2,2.284 //


NYĀYASUDHĀ:
satāṃ madhye jugupsitatvāt goptumiṣṭatvāt /
yadvā kartṛkarmaṇoḥ kṛtīti kartari ṣaṣṭhī /
sadbhirninditatvādityarthaḥ /
hiśabdena śrutyādīnāṃ prasiddhatāṃ dyotayati /

*8,447*

kecidimāṃ catuḥsūtrīṃ bhāgavatamatanirākaraṇaparatayā vyācakṣate /
tathāhi /
pāñcarātrikā vāsudevātsaṅkarṣaṇo nāma jīvo jāyate saṅkarṣaṇātpradyumnasaṃjñakaṃ mano jāyate /
pradyumnādaniruddhasaṃjñako 'haṅkāro jāyata iti prakriyāmāhuḥ /
tatra sūtram- utpattyasambhavāditi //
vāsudevātsaṅkarṣaṇo nāma jīvo jāyata iti tāvadayuktam /
jīvabhyotpattyasambhavāt /
utpattimato hi jīvasyānityatvādayo doṣāḥ prasajyeran /
tataśca naivāsya bhagavatprāptirmokṣaḥ syāt /
na jāyate(na)mriyata ityādiśrutismṛtivirodhācca /

naca kartuḥ karaṇam /
saṅkarṣaṇasaṃjñakājjīvātpradyumnasaṃjñakasya manaso janmāpi pañcarotroktaṃ nopapadyate /
nahi loke karturdevadattādeḥ (karaṇaṃ) paraśvadhādyutpadyamānaṃ karaṇaṃ dṛśyate /
yadā cotpadyate tadā karmaiva na karaṇam /
jīvasya kartā manaśca karaṇam /
tatastanna tato janimadbhavitumarhati /
etasmājjāyate prāṇo manaḥsarvendriyāṇi cetāṃśvarādeva manojananaśravaṇācca /
etena pradyumnādaniruddhasaṃjñako 'haṅkāro jāyata ityapi pratyuktam /

athāpi syāt /
naivaite saṅkaṣarṇādayo jīvādibhāvenābhipreyante /
kiṃ tarhīśvarā evaite sarve jñānaiśvaryaśaktibalavīryatejobhiraiśvarairdharmairanvitā abhyupagamyante /
tasmānnāyaṃ doṣa iti /
atra parihāraṃ paṭhati vijñānādibhāve vā tadapratiṣedhaḥ /
paramātmano vāsudevasyeva saṅkarṣaṇādīnāmapi vijñānādiṣāḍguṇyasadbhāve tata eva ceśvaratve 'bhyupagamyamāne 'pi tasyotpattyasambhavadoṣasyāpratiṣedhaḥ /
prakārāntareṇa prāpnotyevāyamutpattyasambhavadoṣaḥ /
tathāhi /
na tāvadete catvāraḥ parasparaṃ bhinnāḥ /
anekeśvarakalpanāyāṃ gauravādidoṣāpatteḥ /
abhede tu kathaṃ svata eva svasyotpattiḥ sambhavet /
niratiśayatvāt /
nacaite bhagavadvyūhāścatuḥsaṅkhayāyāmevāvatiṣṭheran /
tadvyūhānāmanantatvābhyupagamāt /

vipratiṣedhācca /
parasparavirodhaśca pañcarātre bhavati /
jñānaiśvaryabalavīryaśaktitejsāṃ bhagavato guṇā iti kvaciducyate /
ātmāna evaite bhaga(vato)vanto vāsude(vā i)vasyeti kvacidbhagavatsvarūpatvamityadi /
vedapratiṣedhaścātra bhavati /
bhagavāñchāṇḍilyaḥ ṣaḍaṅgaṃ vedamadhītya tasminmahatyāmnāye niṣṭhāmanadhigacchanyaḥ sarvaparo dharmo yasmānna bhūyo 'sti kathaṃ taṃ vidyāmityevaṃ balavadvivekamātiṣṭhamāno babhūva /
tatra bhagavate śāṇḍilyāya bhagavatā saṅkarṣaṇena vyaktena śabdavacchāstraṃ proktamiti vedanindādarśanāt /
tathā cānyatra /
"adhītā bhagavanvedāḥ sāṅgopāṅgāḥ savistarāḥ /
śrutāni ca mayāṅgāni vāko vākyayutāni ca /
"na caiteṣu samasteṣu saṃśayena vinā kvacit /
śreyomārgaṃ prapaśyāmi yena siddhirbhaviṣyati'; iti /
tasmādayuktaṃ pañcarātraśāstramiti /


*8,448*

tāmimāmapavyākhyāṃ pratyākhyāti- pañcarātreti //

pañcarātraniṣedhārthametānyācakṣate yadi /
sūtrāṇyativiruddhaṃ tad ... // MAnuv_2,2.285a-c //


NYĀYASUDHĀ:
ācakṣate vyācakṣate /
yadityasyārthe yadiśabdaḥ /
tadvayākhyānamati(ati)śayena viruddhaṃ svavyāhataṃ pramāṇāntarapratihataṃ cetyarthaḥ /
tatkathamityataḥ svavyāhatiṃ tāvadupapādayati- yata iti //

... yata āha sa bhārate // MAnuv_2,2.285d //

NYĀYASUDHĀ:
yasmātsūtrakāra eva bhārate pañcarātrasya prāmāṇyamāha /
tasmādatra tannirākaraṇe sūtrakārasya svavacanavyāhatiḥ syādityarthaḥ /


*8,449f.*

tadbhāratavacanamudāharati- pañcarātrasyeti //

pañcarātrasya kṛtsnasya vaktā nārāyaṇaḥ svayam /
jñāneṣveteṣu rājendra sarveṣvetad viśiṣṭate // MAnuv_2,2.286 //
pañcarātravido ye tu yathākramaparā nṛpa /
ekāntabhāvopagatā vāsudevaṃ viśanti te // MAnuv_2,2.287 //
iti ... // MAnuv_2,2.288a //



*8,450*

NYĀYASUDHĀ:
"sāṅkhayaṃ yogaḥ pāśupataṃ vedāraṇyakameva ca /
jñānānyetāni bhinnānyutāho neti cocyatām'; iti /
jñānakāraṇatvajjñānaśabdavācyāni sāṅkhayādīni śāstrāṇyanyonyaviruddhānyutāviruddhānīti praśnasya"sāṅkhayaṃ yogaḥ pāśupataṃ vedāraṇyakameva ca /
jñānānyetāni bhinnāni nātra kāryā vicāraṇā'; iti parihāro 'bhihitaḥ /
tataḥ punarvastuvikalpānupapatteḥ parasparaviruddhānāṃ sarveṣāṃ prāmāṇyayogādeteṣu kiṃ pramāṇamiti jijñāsāyāṃ,"sāṅkhayasya vaktā kapilaḥ'; ityādinā sāṅkhayādīnāmanāptakartṛtvamabhidhāya prāgvedāraṇyakapadopalakṣitasya pañcarātrasya paramāptatvena nārāyaṇena praṇītattvātprāmāṇyamityanena vākyenocyate /
vedānāṃ tvapauruṣeyatayā svata eva prāmāṇyaṃ siddhameveti noktam /
phalavatpravṛttijanakatvādapi pañcarātrasya prāmāṇyamiti /
pañcarātravida ityanena vākyenocyate /
yathākramaparā devatātāratamyaparāḥ /
ekāntabhāvopagatāḥ avyabhicāriṇīṃ bhaktiṃ prāptāḥ /

prakārāntareṇa svavyāhatimāha- gītā ceti //

... gītā ca tacchāstrasaṅkṣepa iti hīritam // MAnuv_2,2.288ab //

NYĀYASUDHĀ:
tacchāstrasaṅkṣepaḥ pañcarātrasaṅkṣepa iti hīritam /
"brahmarudrendrasūryāṇāṃ yaddattaṃ viṣṇunā purā /
pañcarātrātmakaṃ jñānaṃ vyāso 'dātpāṇḍaveṣu tat /
teṣāmevāvatāreṣu senāmadhye 'rjunāya ca /
prādādgīteti

vinirdiṣyaṃ(vijñātaṃ)(vikhyātaṃ) saṅkṣepeṇāyuyutsave'; (te) ityādinā purāṇavākyeneti śeṣaḥ /
tataḥ pramāṇatayā pañcarātrasaṅkṣeparūpāṃ gītāṃ praṇītavato bādarāyaṇasya pañcarātraprāmāṇyamanumatameveti punaratra tannirākaraṇe kathaṃ svavyāhatirna bhavediti /

svavyāhatiṃ prakārāntareṇa darśayati- vedeneti //

vedena pañcarātreṇa bhaktayā yajñena caiva hi // MAnuv_2,2.288cd //
dṛśyo 'haṃ nānyathā dṛśyo varṣakoṭiśatairapi /
iti vārāhavacanaṃ ... // MAnuv_2,2.289a-c //



*8,451*

NYĀYASUDHĀ:
evaṃ varāhapurāṇe bhagavaddarśanasādhanatvena vedavatpañcarātrasya prāmāṇyamabhyupagamyeha punastannirākaraṇe vyāghāta eveti /


*8,452*

evaṃ svavyāhatimupapādya pramāṇāntaravirodhaṃ darśayati- ślokā iti //

... ślokā iti vacaḥ śrutau // MAnuv_2,2.289d //


*8,452f.*

NYĀYASUDHĀ:
vacaḥ astīti śeṣaḥ /
"ṛgvedo yajurvedaḥ sāmavedo 'tharvāṅgirasa itihāsapu(saḥpu)rāṇaṃ vidyā upaniṣadaḥ ślokāḥ sūtrāṇyanuvyākhyānāni vyākhyānāni'; ityasyāṃ śrutau ṛgvedādipramāṇoddeśaprasaṅge ślokā iti pañcarātramupāttam /
"pañcarātravido mukhyāḥ'; iti prakṛtapañcarātraviṣayatvena"ṛṣīnuvāca tānsarvānadṛśyaḥ puruṣottamaḥ /
kṛtaṃ śatasahasraṃ hi ślokānāṃ hitamuttamam'; iti ślokaśabdasya bhārate prayogāt /
chandogaśrutau ṛgvedo yajurveda ityārabhyaikāyanamiti pañcarātramucyate /
tatsamākhyayā ślokaśabdaḥ pañcarātraviṣayo 'śeṣo('vagamyate)jñāyate /
ataḥ śrutyā pañcarātraprāmāṇyaṃ siddhamiti tadaprāmāṇyavādaḥ śrutiviruddhaḥ /
spaṣṭaśrutivirodhaṃ ca darśayati- vedaiśceti //


*8,453*

vedaiśca pañcarātraiśca dhyeyo nārāyaṇaḥ paraḥ // MAnuv_2,2.290ab //

NYĀYASUDHĀ:
vedapañcarātroktaprakāreṇaṇetyarthaḥ /
saṃhitābhedātpañcarātrairiti bahuvacanam /
parasparaviruddhaśāstradvayānusāreṇa kathaṃ dhyānamityata uktam- pañcarātraṃ ceti //
ityādivedavacanaiśca pañcarātrāprāmāṇyakathanaṃ viruddhamiti śeṣaḥ /
tataḥ kimityata āha- pañcarātramiti //

pañcarātraṃ ca vedāśca vidyaikaiva dvidheyate // MAnuv_2,2.290cd //
ityādivedavacanaiḥ pañcarātramapodyate /
kathameva ... // MAnuv_2,2.291a-c //


NYĀYASUDHĀ:
yata evaṃ pañcarātranirākaraṇaṃ svavyāhataṃ pramāṇāntaravyāhataṃ ca /
ato 'tra sūtrakāreṇa pañcarātraṃ apodyate dūṣyata iti kathame(vaṃ)va vaktuṃ śakyate /
nahi vyāhatabhāṣī bhagavāniti /


*8,454*

syānmatam /
nāstyayaṃ vyāghātaḥ /
"yo 'sau nārāyaṇaḥ paro 'vaktāt prasiddhaḥ paramātmā sa ātmanā'tmānamanekadhā vyūhya vyavasthitaḥ /
tamitthambhūtaṃ ṣāḍguṇyavigrahaṃ bhagavantamabhigamanopādānejyāsvādhyāyayogaiḥ pañcakālābhi(dhaira)dhānairanekakālamiṣṭvā kṣīṇakleśo bhagavantameva pratipādyate'; ityādeḥ pañcarātrāditasyārthasya svīkṛtatvāt /
tatparataiva bhāratādivākyānāmupapatteriti /
maivam /
evaṃ sati sāṅkhayādiśāstreṣvapyupādeyāṃśasya vidyamānatvena viśeṣataḥ pañcarātraprāmāṇyābhidhānānupapatteḥ /
kṛtsnasyeti viśeṣaṇānupapatteśca /
"ṛgādyā bhārataṃ caiva pañcarātramathākhilam /
vedārthapūrakaṃ jñeyaṃ pañcarātraṃ yato 'khilam'; ityakhilaśabdavirodhācceti /


*8,455*

itaśca na pañcarātradūṣaṇaṃ yuktamityāha- atreti //

... atra doṣaḥ kaḥ ... // MAnuv_2,2.291c //

NYĀYASUDHĀ:
atra pañcarātre ko doṣo yena tannirākriyeta na ko 'pītyarthaḥ /
nanu kathaṃ doṣo nāsti jīvotpatterasambhāvitāyāstatroktatvādityato 'ṅgīkāravādenāha- utpattiriti //

... utpattirjño 'ta ityapi // MAnuv_2,2.291d //
ihaivoktā ... // MAnuv_2,2.292a //


NYĀYASUDHĀ:
kiṃ jīvotpatyabhidhānamātraṃ pañcarātrāprāmāṇyahetutayopādīyate /
utābhūtabhavanarūpajīvotpattyabhidhānam /
ādye tūtpattimātraṃ ihaiva, pramāṇatayābhyupagate mīmāṃsāśāstre,"jño 'ta eva'; iti sūtreṇoktam /
apipadena"sarva eva (vai) ta ātmāno vyuccaranti'; iti śrutāvukteti samuccinoti /
tato vedatanmīmāṃsayorapyaprāmāṇyaṃ syāt /
anyathā hetoranaikāntyāpatteriti bhāvaḥ /
"jño 'ta eva'; iti sūtrārthe vipratipannaṃ prati śrutirevodāhatarvyā /
syādetat /
dvitīya eva heturupādīyate /
nacāsau śrutisūtrayorvartate /
tatra hi prāgvidyamānasyaiva jīvasya dehādyupādhyapekṣayaivotpattirucyate /
natvabhūtabhāvalakṣaṇetyata āha- naceti //

... nacābhūtabhāvastatrāpi kathyate // MAnuv_2,2.292ab //


*8,456*

NYĀYASUDHĀ:
tatrāpi pañcarātre 'pi /
yathā hi śrutisūtrayoḥ pratītamapi jīvajananamabhūtabhavanaṃ vihāya upādhiviṣayaṃ vyākhyāyate /
tathā pañcarātroktamapi tattathā vyākhyāyatām /
tataśca svarūpāsiddho heturiti bhāvaḥ /
JOSHI-7


*8,457*

nu viṣamo 'yamupanyāsaḥ /
śrutisūtrayoḥ khalu"anādimāyayā suptaḥ'; /
"nānāditvāt'; ityādinānādikarma(karmādi)sambandho 'bhidhīyate /
na hyabhūtvā (bhavato)bhāvavato jīvasyāsāvupapadyate /
atastadanurodhāttatra pratītamapi jīvajananamanyathā netavyameva /
naca tathāvidhaṃ bādhakamihāsti /
yena mukhyārthaṃ parityājyāmukhyārthaṃ pratipadyemahi /
tato mukhyārthe grāhye na hetorasiddhirityata āha- anādīti //

anādikarmaṇā baddho jīvaḥ saṃsāramaṇḍale // MAnuv_2,2.292cd //
vāsudevecchayā nityaṃ bhramatīti hi tadvacaḥ // MAnuv_2,2.293ab //


NYĀYASUDHĀ:
tadvacaḥ pañcarātravākyam /
śrutisūtravatpañcarātre 'pi jīvasyānādikarmasambandhābhidhānāttadanurodhena tatroktaṃ jīvajananamapyanyathāvyākhyātavyameva /
pakṣapāte kāraṇābhāvāt /
tathāca hetorasiddhistadavasthetyarthaḥ /

athāpi syāt /
na kutrāpi vedādau saṃsārasāditvādikaṃ jīvānāmabhūtvābhavanajñāpakaṃ spaṣṭamuktam /
ataḥ sāvakāśamidamanyathā yojyameveti cet /
etadapi samānamatreti bhāvenāha- nahīti //


*8,458*

na hi saṃsārasāditvaṃ pañcarātroditaṃ kvacit // MAnuv_2,2.293cd //

NYĀYASUDHĀ:
anenaiva nyāyena"naca kartuḥ karaṇam'; ityetadapyapākaraṇīyam iti /
tathāhi /
kiṃ karaṇaṃ karturna jāyata iti vyāptiḥ kiṃ vā yasyāṃ kriyāyāṃ yatkaraṇaṃ tattatkriyākarturna jāyata iti /
nādyaḥ /
vyabhicārāt /
anyathā karaṇānāmanutpattiprasaṅgāt /
na dvitīyaḥ /
prakṛte 'pi tathābhāvāsiddheḥ /
etasmājjāyata iti śrutivirodho 'pi kiṃ jīvānmanaso jananamātrābhyupagame syāt /
uta jananaviśeṣābhyupagame /
nādyaḥ /
"annamaśitaṃ tredhā vidhīyate'; ityādiśruteḥ pratyahaṃ manaso jīvādutpatteḥ /
na dvitīyaḥ /
tathātvasya prakṛte 'pyasammateḥ /
evaṃ manaso 'pyahaṅkārajanmani doṣaḥ pariharaṇīyaḥ /


*8,460*

evaṃ jīvādipadānāṃ yathāśrutārthābhyupagamena sūtradvayāropitadoṣaparihāro '(vi)bhihitaḥ /
idānīṃ vāsudevātsaṅkaṣarṇo nāma jīvo jāyata ityādivākyasya parakalpitādarthādarthāntaramāha- jīveti //

jīvābhimāniśeṣasya nāmnā saṅkarṣaṇasya tu /
vāsudevājjaniḥ proktā pradyumnasya tatastathā // MAnuv_2,2.294 //
mano 'bhimāninaḥ kāmasyaivaṃ ... // MAnuv_2,2.295ab //


NYĀYASUDHĀ:
jīvaśabdasya pravṛttinimittamupapādayituṃ jīvābhimānītyuktam /
saṅkarṣaṇasya bhagavato janerabhāvāttadvyudāsāya nāmnā saṅkarṣaṇasya śeṣasyetyuktam /
proktā vāsudevādityādinā vākyena /
tataḥ saṅkarṣaṇāt /
tathāśabdaḥ samuccaye /
janiḥ proktetyarthaḥ /
manobhimāninaḥ kāmasyetyasya pūrvavadeva prayojanam /
evaṃśabdena pradyumnādaniruddhasaṃjñako 'haṅkāro jāyata ityatrāpyuktavyākhyānanyāyamatidiśati /
pradyumnādahaṅkārābhimāninaḥ kāmaputrasyāniruddhasya janiḥ prokteti /


*8,461*

nanvevamapyutpattyasambhavadoṣastadavasthaḥ śeṣādīnāmapi jīvatvāditi /
maivam /
na hyatra saṅkarṣaṇādīnāmutpattirucyate /
kintu jāyata itrata janirucyate /
janiśca prādurbhāvaḥ /
janī prādurbhāva iti paṭhanti /
prādurbhāvaśca śarīrotpattau jīvasya suprasiddhaḥ /
tadidamuktaṃ janiḥ prokteti /
ata eva pūrvo 'bhyupagamavādaḥ /
arthāntaramapyāha- sākṣāditi //

... sākṣāddhareḥ kvacit /
saṅkarṣaṇādināmnaiva nityācintyoruśaktitaḥ /
vyūha ukto ... // MAnuv_2,2.295b-e //


NYĀYASUDHĀ:
śeṣādayo 'pi (hi) bhagavadaṃśatvāddharitvenocyate /
tadvyudāsāya sākṣādityuktam /
sākṣāddharereva saṅkarṣaṇādināmnā vyūha ukta ityanvayaḥ /
nanvatroktaṃ tadapratiṣedho harerutpattyabhāvādityata uktaṃ vyūho vibhāga evokto na tūtpattiriti /
yadapyuktaṃ kimete 'nyonyaṃ bhinnā uta neti /
tasyottaraṃ hareḥ ekasyaiveti /
nanvevaṃ tarhi niratiśayatvātkathaṃ svasmādeva svasya vibhāga ityata uktam- nityeti //
kinnāma durvibhāvyaṃ bhagavati yatpramitamityarthaḥ /

yadapyuktaṃ naivete bhagavadvyūhāścatuḥsaṅkhayāmeva pariniṣṭhitāḥ anantatvāditi /
tatrottaraṃ kvaciditi /
kālaviśeṣe prayojanaviśeṣe cetyarthaḥ /
anabhijño bha(ga)vānbhāgavatasampradāyasya /
ādikāle hi bhagavānnārāyaṇo nijamuktipadapradānādyarthaṃ vāsudevādicaturvyūho babhūva /
tataḥ kālāntare prayojanāntarārthaṃ daśadvādaśādivyūho jātaḥ /
seyaṃ śuddhasṛṣṭiriti pāñcarātrikairabhidhīyate /
tadapekṣayā caturvyūhavarṇanaṃ kathaṃ nāmānupapannamiti /
evamadhikāriviśeṣārādhanārthamiyamuktiryuktaiva /
yathoktam "ekamūrtiścaturmūtirathavā pañcamūrtikaḥ /
dvādaśādiprabhedo vā pūjyate sajjanairhariḥ'; iti /


*8,463*

arthāntarakathanasya prayojanamāha- anyatheti //

... 'nyathānūdya kathaṃ duṣṭatvamucyate // MAnuv_2,2.295ef //

NYĀYASUDHĀ:
evamarthāntaravivakṣayā prayuktasya vākyasyānyathānuvādaṃ vidhāya dūṣaṇābhidhānaṃ kathaṃ kriyate /
chalaprasaṅgāditi /
naca jīvādiśabdānāmanupapattiḥ /
bhagavata eva mukhyataḥ prāṇadhāraṇādimatastadathartvāt yacca vipratiṣedhācceti sūtrārthatayā kalpitaṃ parasparavyāghāto 'sti pañcarātra iti /
tadapi nityācintyoruśaktita ityanenaiva parihṛtam /
bhagavacchaktyaiva guṇaguṇyādivyavahāropapattiriti /
samarthitaśca bhedapade 'bhiṣiktaḥ pramitasarvanirvāhaheturviśeṣaḥ /

yadapyuktaṃ śāṇḍilyavṛttāntakathane pañcarātrasya vedavidveṣaḥ pratīyata iti /
tat nirākaroti- yadīti //

yadi vidyāccaturvedānitivad vedapūraṇam /
pañcarātrāditi kuto dveṣaḥ śāṇḍilyavartane // MAnuv_2,2.296 //



*8,463f.*

NYĀYASUDHĀ:
"yadi vidyāccaturvedānsāṅgopaniṣadāndvijaḥ /
nacetpurāṇaṃ saṃvidyānnaiva sa syādvicakṣaṇaḥ'; ityatra vākye yathetihāsapurāṇādito vedapūraṇamabhipreyate /
tathātrāpi pañcarātrādvedapūraṇamevābhipretaṃ iti vyākhyāne sati, śāṇḍilyavartane 'bhidhīyamāne pañcarātrasya vedavidveṣaḥ pratīyata iti kutaḥ /
na pratīyata ityarthaḥ /
yadvaivaṃ vākyadvaye samāne sati śāṇḍilyavartanābhidhāyinyeva vākye bhavato dveṣaḥ kuto yena yadi vidyādityetaditihāsapurāṇayorvedapūrakatvābhiprāyamādāya"bhagavān śāṇḍilyaḥ'; ityādikaṃ pañcarātrasya vedavirodhitvābhiprāyamiti vyākhyāyata iti /


*8,464*

ayamatrottarakramaḥ /
yadyetadvākyabalātpañcarātrasya cedavirodhitvaṃ kalpyate /
tadā yadi vidyāditi vākyabalāditihāsapurāṇayorapi tatkalpyatāṃ viśeṣābhāvāt(maviśeṣāt) /
atha tatra itihāsādervedapūrakatvamabhiprāyaḥ /
atrāpi sa eva kalpyatām /
viśeṣābhāvāt /
"itihāsapurāṇābhyāṃ vedaṃ samupabṛṃhayet'; ityuttaravā(kyaviro)kyānurodhāttathā kalpanaṃ yuktamiti cet /
atrāpi"vedārthapūrakaṃ jñeya pañcarātram'; ityādivākyānurodhāttathā kalpanamiti na kaścidviśeṣaḥ /
anyatra vidveṣāditi paramasaṃhitāvākyamapyevameva vyākhyātavyam /


apavyākhyānanirākaraṇamupasaṃharati- ataḥ parameti //

ataḥ paramaśāstrorudveṣāduditamāsuraiḥ /
dūṣaṇaṃ pañcarātrasya vīkṣāyāmapi na kṣamam // MAnuv_2,2.297 //



*8,465*

NYĀYASUDHĀ:
vīkṣāyāmapi na kṣamaṃ vyadhikaraṇamityarthaḥ /
tarhi kasmāduditamityata uktam- parameti //
paramaśāstraṃ pañcarātram /
dveṣa eva kiṃ nibandhana ityata uktam- āsurairiti //
bhāgavataśāstre hi svābhāvika eva hi vidveṣo 'surāṇām /
natu doṣadarśananimittaḥ /
ete cāsurasambandhinastatsvabhāvāśca vṛttikārāḥ /
āsurairevoktaṃ natu sūtrakāreṇetyanena tasmānnāyaṃ sūtrārthaḥ, kintu śāktamatanirāsa evetyuktaṃ bhavati /


etenaitadapi pratyuktam /
yatkecididamadhikaraṇaṃ sāṅkhayādivatpañcarātrasyāpyaprāmāṇyamāśaṅkaya tannirāsārthamiti varṇayanti /
tathāhi /
uktarītyā"utpattyasambhavāt'"naca kartuḥ karaṇam'; iti sūtradvayena pañcarātrāprāmāṇyaṃ pūrvapakṣayitvā vijñānādibhāve vā tadapratiṣedha iti siddhāntitam /
vāśabdātpakṣo viparivartate /
vijñānaṃ cādi ceti paraṃbrahma vijñānādi, saṅkarṣaṇapradyumnāniruddhānāmapi parabrahmabhāve sati tatpratipāda(kasya)nasya śāstrasya prāmāṇyaṃ na pratiṣiddhayate /
vipratiṣedhācca pratiṣiddhā hi jīvotpattirasminnapi tantre /
yathoktaṃ paramasaṃhitāyāṃ /
"acetanā parārthā ca nityā satatavikriyā /
triguṇā karmaṇāṃ kṣetraṃ prakṛte rūpamucyate /
prāptirūpeṇa sambandhastasyāśca puruṣasya ca /
sa hyanādiranantaśca paramārthena niścitaḥ'; iti /


*8,465f.*

pañcarātrāprāmāṇyaśaṅkāyāṃ prāptāyāmeva hi tannirāsāya prayāsaḥ sātharkaḥ syāt /
naca vyadhikaraṇāni dūṣaṇāni tacchaṅkāṃ prāpayitumīśate /
nahi chalottarāṇyetāvadadhikaraṇaṃ prayojayanti /
atiprasaṅgāt /
prakaraṇānanuguraṃ caitat /
paramatanirāso hyatra prakṛto na tu svamatasamarthanam /
kṛtaṃ ca tat"na vilakṣaṇatvāt'; ityādinā /
sūtrākṣarānanurūpaṃ caitadvayākhyānam /
nahyatra vijñānādipadaṃ brahmaṇi kvacitprayuktam /
tadapratiṣedha iti ca vyartham /
na prājñatvādityeva vaktavyam /
laghu caivaṃ sūtraṃ vyaktaṃ ca syāt /
tasmādukta eva sūtrārtha iti sthitam /


*8,467*

pādārthamupasaṃharati- ato 'śeṣeti //

ato 'śeṣajagaddhātā nirdoṣoruguṇārṇavaḥ /
nārāyaṇaḥ śrutigaṇatātparyādavasīyate // MAnuv_2,2.298 //


NYĀYASUDHĀ:
sāṅkhayādivirodhisamayānāṃ nirastatvātprathamādhyāye yatsakalaśrutisamanvayena bhagavato lakṣaṇadvayaṃ sādhitaṃ tannirṇītamevetyarthaḥ /


*8,467f.*

syādetat /
"na nigṛhya kathāṃ kuryāt'; ityādismṛtiniṣiddhaṃ paranirākaraṇamidaṃ na kāryameva /
tatkutaḥ sāṅkhayādinirākaraṇaṃ kṛtamiti cenna /
asya niṣedhasya sadviṣayatvāt /
kutaḥ saṅkoca iti cet /
śrutismṛtyoḥ śruterbalavattvāt /
śrutau ca paranirākaraṇasya kartavyatayā avagatatvādityāśayavān"andhantamaḥ praviśanti ye 'vidyāmupāsate /
tato bhūya iva te tamo ya u vidyāyāṃ ratāḥ /
vidyāṃ cāvidyāṃ ca yastadvedobhayaṃ saha /
avidyayā mṛtyuṃ tīrtvā vidyayāmṛtamaśnute'; iti mantradvayamarthato 'nuvadati- andhamiti //

*8,468*

andhaṃ tamaḥ praviśanti ye tvavidyāmupāsate /
tato bhūya ivāpsyanti ye tasyā naiva nindakāḥ // MAnuv_2,2.299 //
tato vidyāmavidyāṃ ca yo jānātyubhayaṃ saha /
doṣajñānādatītyaitān vidyayāmṛtamaśnute // MAnuv_2,2.300 //


NYĀYASUDHĀ:
avidyām avidyakalpitamavidyamānārtham /
āyānti tamaḥ /
ivaśabdaḥ kiñcidarthaḥ /
uśabdo 'vadhāraṇārthaḥ /
ye kevalaṃ vidyāyāmeva ratā ityuktyā labdhasyārthasya kathanam ,tasyā naiva nindakā iti /
anyathā vidyayāmṛtamaśnuta ityanena virodhaḥ syāt /
tataḥ avidyānirākaraṇābhāve doṣasadbhāvāt /
saheti samuccayaniyamaṃ dyotayati /
doṣajñānādatītyaitām ityanena avidyayā duṣṭatvena jñātayā mṛtyuṃ tāmevāvidyāṃ tatkāryaṃ duḥkhādikaṃ cātītya tīrtvā
ityartho jñāyate /

yadyapi tattvajñānaṃ na svapakṣapramāṇamātreṇa bhavati, yāvatparapakṣapramāṇaṃ na nirākriyate /
satpratipakṣasya pramāṇasya nirṇayānaṅgatvāt /
atastattvajñānaṃ kāmayamānenāvaśyaṃ svapakṣasādhanamiva parapakṣaniraso 'pi vidheya evetyupapattisiddho 'yamarthaḥ /
tathāpyāgamāvaṣṭambhena pratyavatiṣṭhamānastathaiva bodhanīya ityāśayavatā mantrāvudāhṛtāviti sarvamanavadyam /

// iti śrīmatpūrṇapramatibhagavatpādasukṛteranuvyākhyānasya praguṇajayatīrthākhyayatinā /
kṛtāyāṃ ṭīkāyāṃ viṣamapadavākyātharvivṛtau dvitīye 'dhyāye 'yaṃ samayacaraṇaḥ paryavasitaḥ //




*************************************************************************************************



Adhyaya 2, Pada 3




*8,471*


[======= JNys_2,3....: ...ādhikaraṇa =======]

// atha dvitīyādhyāyasya tṛtīyaḥ pādaḥ //

// atha śrīmannyāyasudhāyāṃ viyadadhikaraṇam //


"na viyadaśruteḥ'; ityādi pādapratipādyaṃ sasaṅgatikaṃ darśayati- atheti //

athāśeṣasamāmnāyavirodhāpākṛtiṃ prabhuḥ /
kariṣyannadhidaivādhibhūtajīvaparātmanām // MAnuv_2,3.1 //


NYĀYASUDHĀ:
prabhuḥ sūtrakāraḥ, anena vyācikhyāsitatayā buddhisannihitena tṛtīyena pādena vaidikānāṃ vacanānāṃ parasparaṃ avirodhaṃ virodhābhāvaṃ, darśayatīti pratipādyakathanam /
asyāntarbhāvalakṣaṇāṃ saṅgatiṃ darśayitumuktam- aśeṣeti //
aśeṣāśca te samāmnāyavirodhāśceti vigrahaḥ /
kariṣyan ityadhyāyopakramasamayāpekṣayā /
sūtrakṛtā khalu sarvānapi vedavirodhānparihartuṃ dvitīyo 'yamadhyāya ārabdhaḥ /
vaidikānāṃ vacanānāṃ parasparavirodho 'pi tadantarbhūta evetyatastadapākaraṇamiha saṅgatameveti /
ānantaryalakṣaṇāṃ saṅgatiṃ darśayitumathetyuktam /
avasaraprāptau prādhānyādyuktivirodhaparihārasya prāthamye tatprapañcātmakatvena samayavirodhaparihārasya tadānantarye sati śrutīnāṃ parasparavirodhaparihārasya bhavatyayamavasara iti /

nanvevaṃ tarhyasya pādasya caturthapādādbhedo na syāt /
tatrāpi vedavacasāṃ parasparavirodhasya apākriyamāṇatvādityata uktam- adhidaiveti //
adhidaivāni avyaktādyabhimānidevatāḥ /
adhibhūtāni kāryakāraṇopetāni viyadādibhūtāni /


*8,474*

idamuktaṃ bhavati /
yadyapi pādadvaye vedavākyānāṃ parasparavirodha eva nirasyate /
tathāpi viṣayabhedādbhedo bhaviṣyati /
ihādhidaivādiviṣayavākyānāṃ caturthe tvadhyātmaviṣayāṇāmiti /
nacaivamasya pādasyānekaviṣayatvenānekatvāpattiḥ /
adhyātmetaraviṣayatvenaikatvopapatteḥ iti /
atrāpi kramaniyame hetumācārya eva vakṣyati /


*8,475*

nanu ca vedavākyānāṃ parasparavirodhaparihāraḥ kimarthaḥ /
mitho viruddhānāṃ prāmāṇyāniścayāttatprāmāṇyaniścayārtha iti cenna /
evaṃ satyasya tarkaśāstratvaprasaṅgena mīmāṃsātvavyāghātāditi /
ucyate /
brahmaṇo 'śeṣajagatkāraṇatvaniścayo hyaśeṣajagatsvarūpanirṇaye tasya kāryatvādinirṇaye ca sati syānnānyathā /
naca tadviṣayāṇāṃ vākyānāṃ mitho vyāghāte tatsvarūpanirṇayo bhavati /
ato 'dhidaivādivastutattvāvadhāraṇārtha evāyaṃ mitho virodhaparihāraḥ /
tadidamapyuktam- svarūpanirṇayāyaiveti //

svarūpanirṇayāyaiva vacanānāṃ parasparam /
pādenānenāvirodhaṃ darśayatyamitadyutiḥ // MAnuv_2,3.2 //


NYĀYASUDHĀ:
nanu kiṃ katipayavacanānāmanyonyavirodhaḥ parihriyate uta sarveṣām /
nādyaḥ /
vaiyarthyāt /
tatraiva vacanāntaravirodhasadbhāvenānirṇayatādavasthyāt /
na dvitīyaḥ /
vedavākyānāmanantatvena jñātumaśakyatvādityata uktam- amitadyutiriti //
sarvajña ityarthaḥ /


*8,476*

etatpādādhikaraṇapūrvapakṣasiddhāntayuktīḥ saṅgṛhyāha- anubhūtīti //

anubhūtiyuktibahuvāgvailomyaṃ ca tato 'dhikam /
etat sarvaṃ sataḥ sāmyaṃ dvāravaiyarthyameva ca // MAnuv_2,3.3 //
dṛṣṭayuktayanusāritvamuktānyārthāvirodhataḥ /
prasiddhanāmasvīkāre bahuvākyānuvatirtā // MAnuv_2,3.4 //
lokadṛṣṭānusāritvaṃ jīvasāmyamanāditā /
tatra tatra parijñānaṃ guṇasāmyaśrutī tathā // MAnuv_2,3.5 //
utpattimattvaṃ svaguṇānanubhūtyalpakalpane /
nānāśrutiśca vaicitṛyaṃ yuktayaḥ pūrvapakṣagāḥ // MAnuv_2,3.6 //
vyavasthānupapattiśca svātantryamanusāritā /
mukhyatā śaktimattvaṃ ca vairūpyaṃ sarvasaṅgrahaḥ // MAnuv_2,3.7 //
gatyādirīśaśaktiśca sarvamānavirodhitā /
abhīṣyāsiddhisuvyaktī śāstrasiddhivirparyayaḥ /
viśeṣakāraṇaṃ ceti siddhāntasyaiva sādhakāḥ // MAnuv_2,3.8 //



*8,477*

NYĀYASUDHĀ:
// oṃ na viyadaśruteḥ oṃ //
atrādhikaraṇe 'nādirvāyamākāśa ityādiśrutīnāṃ gauṇatvamātmana ākāśaḥ sambhūta ityādiśrutīnāṃ mukhyatvamupādāya viyata utpattiḥ samarthitā /
tatra viyatpadaṃ nākāśamātraparaṃ kinnāma /
atha ha vāva nityāni puruṣaḥ prakṛtirātmā kāla ityādiśrutivigānaviṣayāṇāṃ paramātmātiriktānāṃ prakṛtyādīnāmupalakṣaṇārthaṃ jñātavyamityāśayavānāha- prakṛtiriti //

na viyadaśruteḥ | BBs_2,3.1 |

prakṛtiḥ puruṣaḥ kālo devāstadabhimāninaḥ /
mahadādyāśca jāyante ... // MAnuv_2,3.9a-c //


NYĀYASUDHĀ:
prakṛtiḥ acetanā puruṣo jīvaḥ tadabhimāninaḥ prakṛtyādyabhimāninaḥ /
mahadādyā iti mahadahaṅkāramanobuddhīndriyabhūtasūkṣmatanmātrāṇyucyante /
prakṛtasyotpattyasambhavasya neti pratiṣedhe labdhamarthamāha- jāyanta iti //
ayamabhisandhiḥ /
na tāvatprakṛtyādayo janmarahitā evābhyupaga(myata)tā iti yuktam /
"pratijñāhāniravyatirekācchabdebhyaḥ'"yāvadvikārastu vibhāgo lokavat'; ityuktānāṃ pratijñāhānyādīnāmatrāpi sāmyāt /
anyathā teṣāmanaikāntikatvāpātāt /
nāpyavigītajanmānaḥ /
śrutivigānasya darśitatvāt /
nacādhikaraṇāntaraṃ tatparamasti /
tasmādatraiva viyatpadena teṣāmupalakṣaṇaṃ yuktam /
mātariśvaprabhṛtiṣu punaradhikāśaṅkānirāsāyāyadhikaraṇāntarārambha iti /


*8,479*
ihākāśasyoktaṃ janma ghaṭāderivābhūtvābhavanalakṣaṇamiti kecidāsthitāḥ /
tat nirākariṣyansvamataṃ tāvadāha- parādhīneti //

... parādhīnaviśeṣitā /
idaṃ sarvaṃ sasarjeti janimattvamihoditam // MAnuv_2,3.9d-f //


NYĀYASUDHĀ:
"ātmana ākāśaḥ sambhūtaḥ'"sa idaṃ sarvamasṛjata'; ityādiśrutiṃ, vibhaktatvādiyuktiṃ cāśritya yadihādhikaraṇe viyato janimattvamuditaṃ tatparādhīnātiśayalābhalakṣaṇaṃ pratipattavyam /
apūrvaviśeṣopajanane hi viśiṣyākāropajano 'vaśyambhāvī viśiṣyākāraśca vastusvarūpābhinna iti tasyaivāsāvupajano bhavati /
devadattaḥ śarīrī jāto vidvān jāta iti, ghaṭaḥ saṃyukto jāto vibhakto jāta iti cāvasthitasvarūpa eva vastuni viśeṣāvāptimātreṇa jananavyavahāro dṛśyata eva /

nanu pariṇāmavāde ghaṭāderapyeṣaivotpattiryadavasthitasvarūpasyaiva mṛdāderapyākārānta(rāvāptiḥ)ratāpattiḥ /
parairapi pariṇāmavāda evāṅgīkṛto nārambhavādaḥ /
ato vivādābhāvādvayartho 'yamārambhaḥ /
yathā na vyarthastathā'cārya eva vivādaviṣayaṃ spaṣṭayiṣyati /

atra"idaṃ sarvaṃ sasarja'; iti śru(tyādyudā)tyudāharaṇaṃ śrutyādāvapyevameva janma vyākhyeyamiti jñāpanārtham /
yacca viyatpadaṃ prakṛtyādyupalakṣaṇaparamityābhipretaṃ tatroktarītyopapattisūcanārthaṃ ceti /


*8,481*

paroktarītyā ghaṭādivadabhūtvābhavanalakṣaṇaivotpattirviyataḥ śrutisūtravivakṣitā kinna syāditi cedatra pṛcchāmaḥ /
ākāśaśabdena kiṃ vivakṣitaṃ pareṣāṃ (kiṃ) vaiśeṣikādivadavakāśamātramuta bāhyānāmiva mūrtābhāvaḥ /

ādyaṃ dūṣayati- avakāśamātramiti //

avakāśamātramākāśaḥ kathamutpadyate 'nyathā // MAnuv_2,3.10ab //

NYĀYASUDHĀ:
anyathā parādhīnaviśeṣāptirjanmetyanaṅgīkṛtyābhūtvābhavanaṃ janmetyaṅgīkāre 'vakāśamātramākāśa iti cāṅgīkāre kathamasāvutpadyate /
tasyotpattirnopapadyata iti yāvat /
sopādānā hi sar(vār)vasṛṣṭirdṛṣṭā na cākāśotpattāvupādānamasti /
naca brahmaṇa upādānatvamupapadyata iti prakṛtyadhikaraṇe (niṣṭhaṅkitam) nirdiṣyam /
yasya cotpattistasya prāgabhāvena bhāvyam /
na cākāśasya prāgabhāvaḥ sambhavati /
anupapannapratītikatvāt /
abhāvo hi pratīyamāno 'syātreti pratīyate na tu nirāśrayaḥ /
nacākāśābhāvasyāśrayapratītirupapadyate /
yadeveheti nirdiśyate tasyaivākāśatvāt /
upādānāśritābhāvavāde 'pi tadabhāvānnābhāvapratītyupapattiḥ /
tathāca śrutiḥ /
"abhāvo hi pradeśasya na hyatrābhāva ityapi'; iti /
anavakāśarūpaṃ brahmaivākāśasya pūrvāvasthā prāgabhāvaścocyata ityapi brahmaṇo 'nupādānatvena pratyuktam /
pratiyogyāśraya evābhāvāśrayaḥ /
nacākāśasyāśrayo 'stīti tadabhāvo 'pi nirāśrayo 'stviti cenna /
nirāśrayatve kāryatvānupapatteḥ /
kiñca pratītāvākāśaḥ svāśraya ityatastadabhāvo 'pyākāśāśrayaḥ pratīyeteti viruddhamāpadyate /
prakṛtirākāśasya kāraṇamiti kaścit /
tanmate prakṛterajanmaprasaṅgaḥ /
atha tatra parādhīnaviśeṣāvāptirjanmāṅgīkriyate /
tadāsambhāvitotpattike viyadādāvapyevamevāṅgīkaraṇīyamiti /


*8,483*

dvitīye 'pi kiṃ pradeśarūpamākāśamaṅgīkṛtyedamucyate utānaṅgīkṛtya /
prathame yasya kasyacinmūrtadravyābhāvasyotpattirvā sarvasya vā vivakṣitā /
nādyaḥ /
tasyāḥ pratyakṣādisiddhatvenādhikaraṇānārambhakatvāt /
dvitīyaṃ dūṣayati- yadīti //

yadyanākāśatā pūrvaṃ kiṃ mūrtanibiḍaṃ jagat // MAnuv_2,3.10cd //


*8,484*

NYĀYASUDHĀ:
sarvasyāpi mūrtābhāvasya sṛṣṭāvutpattyaṅgīkāre pralaye 'vaśyaṃ tadabhāvo 'bhyupagamaḥ syāt /
atyantāsato janmāsambhavāt /
yadi ca sṛṣṭeḥ pūrvaṃ pralaye 'nākāśatā sarvasya mūrtadravyābhāvasyābhāvaḥ aṅgīkriyate /
tarhi kiṃ tadā mūrtanibiḍaṃ jagadaṅgīkriyate /
etadeva spaṣṭayati- mūrteti //

mūtarsampūrṇatā caiva yadyanākāśatā bhavet // MAnuv_2,3.11ab //

NYĀYASUDHĀ:
yadyuktalakṣaṇākāśābhāvaḥ pralaye bhavettadā mūrtasampūrṇatā bhavedeva /
abhāvābhāvasya bhāvānatirekāt /
tadvayāptatvādvā /
caśabdo 'nuktasamuccayārthaḥ /
sṛṣṭayuttarakālaṃ mūrtamātraṃ ca na syāt /
evaṃ ca sargapralayaviparivartaḥ syāt /
adhikā ca pralaye mūrtasampūrterāpattiḥ /
mūrtadravyābhāva evākāśo na tato 'tirikto 'stīti dvitīyaṃ nirākaroti- mūrtadravyāṇīti //

mūrtadravyāṇi cākāśe sthitānyeva hi sarvadā // MAnuv_2,3.11cd //

NYĀYASUDHĀ:
tadabhāvaśceti cārthaḥ /
yo mūrtadravyāṇi tadabhāvāṃścāṅgīkaroti tenāvaśyaṃ tadatiriktākāśo 'ṅgīkartavya eva /
yasmāttāni sarvadā'kāśe sthitāni teneti yojanā /


*8,485f.*

idamuktaṃ bhavati /
ekasmin patatriṇi patati dvitīyena patatriṇā kutra patitavyamiti vācyam /
yatrāsau nāsti tatreti cettarhi yenādhikaraṇenaikya patatriṇo 'bhāvaḥ parasya ca bhāvo viśiṣyate tadarthāntaramaṅgīkaraṇīyam /
sa eva pradeśarūpa ākāśa iti kathaṃ tadanabhyupagamaḥ /
kiñceha pakṣī neha pakṣīti mūrtatadabhāvāśrayatayā pradeśaḥ sākṣisiddhaḥ kathamapahnotuṃ śakyate /
api ca kiṃ mūrtadravyasya prāgabhāva ākāśaḥ kiṃvā pradhvaṃso yadvātyantābhāvaḥ athavānyonyābhāvaḥ /
na prathamadvitīyau /
sṛṣṭayuttarakāle nirākāśatvaprasaṅgāt /
prāgabhāvapradhvaṃsābhāvayorupādānaniṣṭhatvena tatrākāśabuddheranyatra tadabhāvasya cāpatteḥ /
na tṛtīyaḥ /
kvacitkadācinmūrtasadbhāve tadatyantābhāvānupapatteḥ /
nacaturthaḥ /
ghaṭānyonyābhāvo hi paṭastanniṣṭho veti tatrākāśabuddhiprasaṅgāt /
mūrtadravyasaṃsargābhāvamātramākāśa iti cettarhi utpatataḥ patatriṇaḥ kena saṃsargo yena tadabhāvasyākāśatvaṃ syādityavaśyāśrayaṇīyaḥ pradeśa iti /
tadevamākāśasyābhūtvābhavanarūpotpattiruyakteti siddham /


*8,487*

astvevaṃ parakṛtamapavyākhyānam /
kastarhyākāśaśabdārthaḥ kā ca tasya parādhīnaviśeṣāptirityata āha- ata iti //

ata ākāśaśabdoktastaddevo 'tra vināyakaḥ /
dehotpattyā samutpanna iti śrutyābhidhīyate // MAnuv_2,3.12 //


NYĀYASUDHĀ:
parakīyavyākhyānasyāyuktatvādityarthaḥ /
taddevo bhūtākāśābhimānīti vināyakasyākāśaśabdavācyatvopapādanam /
atrātmana ākāśa ityādiśrutau /
dehotpattyeti parādhīnaviśeṣā(vā)ptervivaraṇam /
vākyadvayametadityato 'treti śrutyeti ca yujyate /
śruterviṣayāntaraṃ cāha- bhūtamapīti //


*8,487f.*

bhūtamapyasitaṃ divyadṛṣṭigocarameva tu /
utpadyate ... // MAnuv_2,3.13a-c //


NYĀYASUDHĀ:
bhūtamapyākāśaśabdoktaṃ tacca ghaṭādivadutpadyata iti śrutyābhidhīyata iti sambandhaḥ /
kuto bhūtākāśasyotpattimattvamityata uktam- asitamiti //
rūpitvādityarthaḥ /
tathāca śrutiḥ /
"ākāśo nīlimodeti'; iti /
tathā sati cākṣuṣatvaprasaṅga ityata

uktam- divyeti //
tuśabdenānudbhūtatvaviśeṣaṃ sūcayati /
idamuktaṃ bhavati /
kiṃ cākṣuṣatvamātramāpādyamutāsmadādīnprati /
ādye tviṣyāpādanam /
divyadṛṣṭigocaratvābhyupagamāt /
dvitīye tu bhūtādiśarīreṣu vyāptibhaṅgaḥ /
tatrānudbhūtādikalpane 'trāpi tatsamānaṃ śrutiprāmāṇyāditi /


*8,489*

nanvākāśasyābhūtvābhavanalakṣaṇāmutpattimadhunaiva nirākṛtyātra punastadaṅgīkāre kathaṃ pūrvottaravyāghāto na bhavedityata āha- avyākṛtamiti //

... avyākṛtaṃ hi gaganaṃ sākṣigocaram // MAnuv_2,3.13cd //

NYĀYASUDHĀ:
yato 'vyākṛtameva gaganaṃ notpadyata ityuktaṃ na tu bhūtamato na virodhaḥ /
tasyānutpattau hetvantaramapyāha- nityaṃ hi taditi //
nacaitadasiddham /
vināśakāraṇābhāvāt /
nahi kāraṇāntaramanapekṣyeścarecchā vināśaheturdṛṣṭā /
utpattiśrutestadapi kalpanīyamiti cenna /
tasyā bhūtatadabhimāniviṣayatvena sāvakāśatvāt /
avaśyaṃ caitadevam /
ātmana ākāśaḥ sambhūta ityāderbhūtaprakaraṇatvāt /
nanvavyākṛtākāśe pramāṇameva nāsti /
kasyānutpattirucyata ityata uktam- sākṣīti //
tatkathamityata āha- pradeśa iti //

pradeśa iti vijñeyaṃ nityaṃ notpadyate hi tat // MAnuv_2,3.13ef //

NYĀYASUDHĀ:
nanvetadeva bhūtākāśamiti cenna /
rūpitvārūpitvavyākṛtatvāvyākṛtatvaparicchinnatvāparicchinnatvaśrutīnāṃ sattvāt /
kiñcotpattyanutpattiśrutyorvirodho 'pyākāśadvaitamavagamayati /
vyavasthayāvirodhopapattāvanutpattiśruteraupacārikatvakalpanāyogāt /
naca pradeśasyotpattirupapadyata ityuktaṃ prāk /

nanu sūtrakṛtaiva gauṇyasambhavādityuktam /
vyākhyātaṃ tadbhāṣyakṛtā /
vivṛtaṃ cāsmābhiḥ /


*8,491*

nanvavyākṛtākāśasyotpattyabhāve mā bhūdākāśaḥ sambhūta iti virodhaḥ /
idaṃ sarvamasṛjatetyādiśrutivirodhastu bhaviṣyatīti cenna /
tasyābhūtvābhavanalakṣaṇotpattyasambhave 'pi parādhīnaviśeṣāptirūpotpattisadbhāvādityāha- tathāpīti //

tathāpi pūrvasambandhaparatantraviśeṣayuk /
khamevotpattimannāma śrutiśabdavivakṣitam // MAnuv_2,3.14 //


NYĀYASUDHĀ:
mūrtasambandhaścāsau paratantraviśeṣaśceti vigrahaḥ /
yadanāditvenoktaṃ tadeva svamityarthaḥ /
idaṃ sarvamasṛjateti śrutivākyaṃ śrutiśabdaḥ /


*8,492*

evaṃ śrautā(sautrā)kāśotpattiṃ vyākhyāyopalakṣitaprakṛtyādyutpattiṃ vyākhyāti- prakṛtiriti //

prakṛtiḥ puruṣaḥ kāla ityete ca samastaśaḥ /
īśādhīnaviśeṣeṇa janyā ityeva kīrtitāḥ // MAnuv_2,3.15 //


NYĀYASUDHĀ:
ityete ca etadādayaśca /
īśvarādhīnaviśeṣeṇaiva nābhūtvābhāvitvenetyarthaḥ /
kālasya tvabhūtvābhavanamapyastītyāśayenāha- kāleti //

kālapravāha evaiko nityo natu viśeṣavān // MAnuv_2,3.16ab //

NYĀYASUDHĀ:
viśeṣavān kṣaṇalavādirūpaḥ /
upapāditaṃ caitatprāgeva /


*8,493*

prāk parigaṇitānāṃ prakṛtyādīnāmīśvarādhīnaviśeṣāvāptireva janmetyuktam /
tatra kasya kīdṛśī viśeṣāvāptirityataḥ prakṛtyāditrayābhimānidevatāyāḥ parādhīnaviśeṣāvāptiṃ viśadayati- puruṣeti //

puruṣāvyaktakālānāṃ ramaivaikābhimāninī // MAnuv_2,3.16cd //
sisṛkṣutvaviśeṣaṃ tat sākṣād bhagavadicchayā /
prāptaiva sṛṣṭetyuditā ... // MAnuv_2,3.17a-c //


NYĀYASUDHĀ:
yasmātpuruṣādīnāṃ ramābhimāninī /
sā caikaiva dehadehyādibhedarahitā /
tattasmātsākṣādbhagavadicchayā sisṛkṣutvaviśeṣaṃ prāptaiva sṛṣṭetyuditā /
natu vināyakādyabhimānivaddehotpattimatītyarthaḥ /
yadyapi bhagavatyā icchāni nityā tathāpi (tadīya)vyaktirūpasyeśvarā(parā)dhīnatvābhiprāyeṇedamuktamiti jñātavyam /


prakṛteḥ parādhīnaviśeṣāvāptiṃ vivṛṇoti- pradhānamiti //

... pradhānaṃ vikṛterapi // MAnuv_2,3.17d //

NYĀYASUDHĀ:
pradhānamapi vikṛterīśvarādhīnāyāḥ kāraṇādidaṃ sarvamasṛjatetyādau sṛṣṭamityuditamityarthaḥ /
yathoktam /

"vikāro 'vyaktajanma hi'; iti /


*8,494*

puruṣāṇāṃ parādhīnaviśeṣāvāptiṃ spaṣṭayati- pumāṃsa iti //

pumāṃso dehasambandhāt sṛṣṭimanta itīritāḥ // MAnuv_2,3.18ab //

NYĀYASUDHĀ:
kālapravāhasya pravāhijanma mahadādīnāṃ copacayāvāptirviśeṣalābha iti spaṣṭatvā(nnātro)nnoktam /
etena"jño 'ta eva'"tathā prāṇāḥ'; ityadikamapi vyākhyātaṃ veditavyam /
// iti śrīmannyāyasudhāyāṃ viyadadhikaraṇam //


___________________________________________________________________________


*8,494*

[======= JNys_2,3.II: mātariśvādhikaraṇa =======]


// atha śrīmannyāyasudhāyāṃ mātariśvādhikaraṇam //

// oṃ etena mātariśvā vyākhyātaḥ oṃ //
atītādhikaraṇe viyadādiviṣayāṇāṃ utpattyanutpattiśrutīnāṃ vyavasthayā virodhaḥ parihṛtaḥ /
idānīṃ"tejobannānyākāśa iti tānyanityāni vāyurvāva nityaḥ'; iti śrutau vyavasthitanityatvānityatvavantamapyākāśamanityapakṣe nikṣipya vāyonirtyatvābhidhānādākāśadevatāyā vināyakasyeva vāyudevatāyāḥ svarūpeṇa nityatvaṃ dehotpattyādinā janmādimattvamiti vyavasthānupapattermukhyaivānutpattirityadhikāśaṅkayā pūrvapakṣite vyavasthātideśenaiva siddhāntitam /
tatra kīdṛśī vāyau śrutīnāṃ vyavasthā /
yayādhikāśaṅkāparihāraḥ syādityatastāṃ daśaryati-

evamiti //

*8,495*

etena mātariśvā vyākhyātaḥ | BBs_2,3.8 |

evaṃ praḷayakāle 'pi pratibhātaparāvaraḥ // MAnuv_2,3.18cd //
mukhyāvāyurnityasamaḥ śarīrotpattikāraṇāt /
parādhīnaviśeṣeṇa janimāneva śabditaḥ // MAnuv_2,3.19 //


NYĀYASUDHĀ:
yathā viyadanādi janmavaccoktamevamityatharḥ /
pratibhātaparāvaraḥ śarīrābhāve 'pi pratibhenaiva jñānena viṣayīkṛtātītānāgato yatastasmānnityasama iti śabditaḥ /
śarīrotpattikāraṇātparādhīnaviśeṣeṇetyetayorhetuhetumadbhāvaḥ /
evaśabdasya parādhīnaviśeṣeṇaivetyanvayaḥ /
mukhyavāyurityanena bhūtaprakaraṇe 'pi na bhūtavāyuviṣayamidaṃ sūtram /
tatrādhikāśaṅkābhāvāt /
ata eva nāvāntarābhimāniviṣayam /
kinnāma tatparamābhimāniviṣayameveti sūcayati /
svarūpātiriktasya pratibhajñānasyāpyanupaplavādākāśadevatāto viśeṣo yujyata iti bhāvaḥ /


*8,496*

yaduktamatra prakaraṇe parādhīnaviśeṣāvāptireva janirnābhūtvābhavanamiti tadupapattyantareṇopapādayannadhikaraṇārthamupasaṃharati- naiveti //

naiva kiñcit tato janmavarjitaṃ paramādṛte /
parādhīnaviśeṣatve janmanaḥ sthūlatābhavaḥ // MAnuv_2,3.20 //
pūrvaśabdavilopaśca yadi janmeti kīrtyate /
ramāyā naiva janmāsti caitanyasyāpi kevalam // MAnuv_2,3.21 //
pradhanasya ca vedasya ... // MAnuv_2,3.22a //



*8,496f.*

NYĀYASUDHĀ:
iti siddhamiti śeṣaḥ /
etacca janmanaḥ parādhīnaviśeṣalābha(svarūpa)tva evāṅgīkṛte siddhayati na tvabhūtvābhavanarūpatva ityarthaḥ /
nanvavyākṛtākāśasyābhūtvābhavanānupapatterastu tatra parādhīnaviśeṣāvāptijarnmaśabdārthaḥ /
anyatra tvabhūtvābhavanamevāṅgīkriyate cetko doṣaḥ /
bādhakabhāvābhāvābhyāmanekārthatvakalpanāvirodhādityata āha- sthūlateti //

upādānadharmiṇo dharmyantarātmanā parivartaḥ sthūlatābhāvaḥ /
ata eva pūrvaśabdavilopaśca pūrvaśabdanivṛttau śabdāntarapravṛttiścetyarthaḥ /
udāhṛtaṃ caitatprakṛtyadhikaraṇe /
abhūtvābhavanaṃ yadi janmeti kīrtyata ityukte 'sadanuvādaḥ syāt /
pariṇāmavādibhiḥ kvāpyabhūtvābhavanānabhyupagamāt /
ato vimatipadaṃ darśayituṃ sthūlatetyādyuktam /
tarhi ramāyā jīvacaitanyasyāpi pradhānasya vedasya caivaṃvidhaṃ janma naivāstītyataḥ parameśvarādṛte sarvaṃ janimaditi na siddhayet /
tathāca"idaṃ sarvamasṛjata'; ityādipratijñāhāniḥ"ātmā vā'; ityādiśabdavirodho vibhaktatvahetoranaikāntyaṃ ca syāt iti vākyaśeṣaḥ /
"eṣa cetanayā yukto jīva ityabhidhīyate'; ityādivacanājjīvaśabdo bhūtādisaṅghāte vartate /
tasya coktavidhotpattirastyevetyataḥ kevalaṃ caitanyasyetyuktam /
nahi kṣīraṃ dadhijātamitivadidaṃ dravyaṃ ramāditvena pari(ṇatami)vṛttamityatra pramāṇamasti /
kintu"dvāvetau nityamuktau nityau sarvagatau',"ajo nityaḥ',"ajāmekām',"yāvadbrahma viṣṭhitaṃ tāvatī vāk'; ityādiśrutibhyo 'nāditvamevāvagatam /


*8,498*

nanu vedasya kīdṛśī parādhīnaviśeṣāptiryena bhavatpakṣe pratijñāhānyādikaṃ na syādityata āha- vedasyāpīti //

... vedasyāpīśvarecchayā /
vyaktirnāma viśeṣo 'sti ... // MAnuv_2,3.22bc //


NYĀYASUDHĀ:
niyataviśiṣyānupūrvīkatvenārthabodhakatvaśaktyāvirbhāvo vyaktiḥ /
kālapravāhasya nāstitve doṣo vakṣyate /
mahadādisūkṣmarūpanityatā ca śrutyā(dipra)pi prasiddhā /
ato 'pi pratijñāhānyādyanistāra ityāśayavānupasaṃharati- tasmāditi //

... tasmāt tadvaśataiva hi // MAnuv_2,3.22d //
utpattiratra kathitā ... // MAnuv_2,3.23a //


NYĀYASUDHĀ:
tadvaśatā parameśvaravaśatvaviśeṣalābhaḥ /
atra śrutisūtrayoḥ /
// iti śrīmannyāyasudhāyāṃ mātariśvādhikaraṇam //
JOSHI-8


___________________________________________________________________________


*8,501*


[======= JNys_2,3.III: asambhāvādhikaraṇa =======]



/ atha śrīmannyāyasudhāyāṃ asambhavādhikaraṇam //

// oṃ asambhavastu sato 'nupapatteḥ oṃ //
asambhāvyamānajanmanorgaganapavanayorutpattāvuktāyāmidamāśaṅkayate /
sadajāyatetyādiśruterbrahmaṇo 'pi janmāsti /
naca śrutyādivirodhaḥ /
svarūpotpattyabhāve 'pi parāyattaviśeṣāvāptirūpotpattisambhavādgaganapavanavaditi /
tannivṛttyarthamidamadhikaraṇamārabdham /
etaccāyuktamivābhāti /
asambhava ityanutpattimātrapratijñānāt /
tasya ca pareṇāpyaṅgīkṛtatvāt /
nanvavadhāraṇārthasya tuśabdasya prayogānnāyaṃ doṣaḥ /
satyam /
tathāpi tatra hetoranabhidhānādayuktameva /
nanvanupapatterityuktam /
satyam /
kiṃ tasyārtho na hyasataḥ sadutpatteradṛṣṭatvādanupapatteriti /
nacaitatsarvathāpyutpattyabhāvamupapādayitumalam /
kāraṇaviśeṣapratiṣedhāt /
maivam /
prasaktakāraṇanirāsādanyasyāprasaṅgātkāraṇābhāvasyaiva siddheriti sthite vibhavādanupapatterita hetuṃ prakārāntareṇa vyācakṣāṇāḥ sūtrārthamāha- svatantratvāditi //

asaṃbhavas tu sato 'nupapatteḥ | BBs_2,3.9 |

... svatantratvāt parātmanaḥ /
nai