Garuda-Purana
Part 1

Based on the edition Bombay : Venkatesvara Steam Press (or a reprint thereof)


Input by members of the SANSKNET-project
(www.sansknet.org)



This GRETIL version has been converted from a custom Devanagari encoding.
Consequently, many word boundaries are not marked by spaces.
The Nagari e-text follows the layout and graphic appearance of the printed
edition very closely. It even adds blanks when a line break cuts through
a word or compound.
These and other irregularities cannot be standardized at present.

After many corrections, the text is in need of further proof reading!





THIS GRETIL TEXT FILE IS FOR REFERENCE PURPOSES ONLY!
COPYRIGHT AND TERMS OF USAGE AS FOR SOURCE FILE.

Text converted to Unicode (UTF-8).
(This file is to be used with a UTF-8 font and your browser's VIEW configuration
set to UTF-8.)

description:multibyte sequence:
long a ā
long A Ā
long i ī
long I Ī
long u ū
long U Ū
vocalic r
vocalic R
long vocalic r
vocalic l
vocalic L
long vocalic l
velar n
velar N
palatal n ñ
palatal N Ñ
retroflex t
retroflex T
retroflex d
retroflex D
retroflex n
retroflex N
palatal s ś
palatal S Ś
retroflex s
retroflex S
anusvara
visarga
long e ē
long o ō
l underbar
r underbar
n underbar
k underbar
t underbar

Unless indicated otherwise, accents have been dropped in order
to facilitate word search.

For a comprehensive list of GRETIL encodings and formats see:
http://gretil.sub.uni-goettingen.de/gretil/gretdiac.pdf
and
http://gretil.sub.uni-goettingen.de/gretil/gretdias.pdf

For further information see:
http://gretil.sub.uni-goettingen.de/gretil.htm








śrīgaṇādhipataye namaḥ /
sarasvatyainamaḥ /
atha śrīgaruḍamahāpurāṇaṃ prārabhyate /
tatrādau karmakāṇḍākhyaḥ pūrvakhaṇḍaḥ prārabhyate /

oṃ nārāyaṇaṃ namaskṛtya naraṃ caiva narottamam /
devīṃ sarasvatīṃ caiva tato jayamudīrayet // GarP_Mang.1 //
oṃ ajamajaramanantaṃ jñānarūpaṃ mahāntaṃ śivamamalamanādiṃ bhūtadehādihīnam /
sakalakaraṇahīnaṃ sarvabhūtasthitaṃ taṃ harimamalamamāyaṃ sarvagaṃ vanda ekam // GarP_1,1.1 //
namasyāmi hariṃ rudraṃ brahmāṇaṃ ca gaṇādhipam /
devīṃ sarasvatīṃ caiva manovākkarmabhiḥ sadā // GarP_1,1.2 //
sūtaṃ paurāṇikaṃ śāntaṃ sarvaśāstraviśāradam /
viṣṇubhaktaṃ mahātmānaṃ naimiśāraṇyamāgatam // GarP_1,1.3 //
tīrthayātrāprasaṅgena upaviṣṭaṃ śubhāsane /
dhyāyantaṃ viṣṇumanaghaṃ tamabhyarcyāstuvankavim // GarP_1,1.4 //
śaunakādyā mahābhāgā naimiṣīyāstapodhanāḥ /
munayo ravisaṅkāśāḥ śāntā yajña parāyaṇāḥ // GarP_1,1.5 //
ṛṣaya ūcuḥ /
sūta ! jānāsi sarvaṃ tvaṃ pṛcchāmastvāmato vayam /
devatānāṃ hi ko deva īśvaraḥ pūjya eva kaḥ // GarP_1,1.6 //
ko dhyeyaḥ ko jagatsraṣṭā jagatpātti ca hanti kaḥ /
kasmātpravartate dharmo duṣṭahantā ca kaḥ smṛtaḥ // GarP_1,1.7 //
tasya devasya kiṃ rūpaṃ jagatsargaḥ kathaṃ mataḥ /
kairvrataiḥ sa tu tuṣṭaḥ syātkena yogena vāpyate // GarP_1,1.8 //
avatārāśca ke tasya kathaṃ vaṃśādisambhavaḥ /
varṇāśramādidharmāṇāṃ kaḥ pātā kaḥ pravartakaḥ // GarP_1,1.9 //
etatsarvaṃ tathānyacca brūhi sūta ! mahāmate ! /
nārāyaṇakathāḥ sarvāḥ kathayāsmākamuttamāḥ // GarP_1,1.10 //
sūta uvāca /
purāṇaṃ gāruḍaṃ vakṣye sāraṃ viṣṇukathā śrayam /
garuḍoktaṃ kaśyapāya purā vyāsācchrutaṃ mayā // GarP_1,1.11 //
eko nārāyaṇo devo devānāmīśvareśvaraḥ /
paramātmā paraṃ brahma janmādyasya yato bhavet // GarP_1,1.12 //
jagato rakṣaṇārthāya vāsudevo 'jaro 'maraḥ /
sa kumārādirūpeṇa avatārānkarotyajaḥ // GarP_1,1.13 //
hariḥ sa prathamaṃ devaḥ kaumāraṃ sargamāsthitaḥ /
cacāra duścaraṃ brahman brahmacaryamakhaṇḍitam // GarP_1,1.14 //
dvitīyaṃ tu bhavāyāsya rasātalagatāṃ mahīm /
uddhariṣyannupādatte yajñeśaḥ saukaraṃ vapuḥ // GarP_1,1.15 //
tṛtīyamṛṣisargaṃ tu devarṣitvamupetya saḥ /
tantraṃ sātvatamācaṣṭe naiṣkarmyaṃ karmaṇāṃ yataḥ // GarP_1,1.16 //
naranārāyaṇo bhūtvā turye tepe tapo hariḥ /
dharmasaṃ rakṣaṇārthāya pūjitaḥ sa surāsuraiḥ // GarP_1,1.17 //
pañcamaḥ kapilo nāma siddheśaḥ kālaviplutam /
provāca sūraye sāṅkhyaṃ tattvagrāmavi nirṇayam // GarP_1,1.18 //
ṣaṣṭhamatrerapatyatvaṃ dattaḥ prāpto 'nasūyayā /
ānvīkṣikīmalarkāya prahlādādibhya ūcivān // GarP_1,1.19 //
tataḥ sapta ākūtyāṃ ruceryajño 'bhyajāyata /
sutrāmādyaiḥ suragaṇairyaṣṭvā svāyambhuvāntare // GarP_1,1.20 //
aṣṭame merudevyāṃ tu nābherjāta urukramaḥ /
darśayanvartma nārīṇāṃ sarvāśramanamaskṛtam // GarP_1,1.21 //
ṛṣibhiryācito bheje navamaṃ pārthivaṃ vapuḥ /
dugdhairmahauṣadhairviprāstena saṃjīvitāḥ prajāḥ // GarP_1,1.22 //
rūpaṃ sa jagṛhe mātsyaṃ cākṣuṣāntarasaṃplave /
nāvyāropya mahīmayyāmapādvaivasvataṃ manum // GarP_1,1.23 //
surāsurāṇāmudadhiṃ mathnatāṃ mandarācalam /
dadhre kamaṭharūpeṇa pṛṣṭha ekādaśe vibhuḥ // GarP_1,1.24 //
dhānvantaraṃ dvādaśamaṃ trayodaśamameva ca /
āpyāyatsurānanyānmohinyā mohayaṃstriyā // GarP_1,1.25 //
caturdaśaṃ nārasiṃhaṃ caitya (vaira) daityendramūrjitam /
dadāra karajairugrairerakāṃ kaṭakudyathā // GarP_1,1.26 //
pañcadaśaṃ vāmanako bhūtvāgādadhvaraṃ baleḥ /
pāda trayaṃ yācamānaḥ pratyāditsustriviṣṭapam // GarP_1,1.27 //
avatāre ṣoḍaśame paśyanbrahmadruho nṛpān /
triḥ saptakṛtvaḥ kupito niḥ kṣattrāmakaronmahīm // GarP_1,1.28 //
tataḥ saptadaśe jātaḥ satyavatyāṃ parāśarāt /
cakre vedataroḥ śākhāṃ dṛṣṭvā puṃso 'lpamedhasaḥ // GarP_1,1.29 //
naradevatvamāpannaḥ surakāryacikīrṣayā /
samudranigrahādīni cakre kāryāṇyataḥ param // GarP_1,1.30 //
ekonaviṃśe viṃśatime vṛṣṇiṣu prāpya janmanī /
rāmakṛṣṇāviti bhuvo bhagavānaharadbharam // GarP_1,1.31 //
tataḥ kalestu sandhyānte saṃmohāya suradviṣām /
buddho nāmrā jinasutaḥ kīkaṭeṣu bhaviṣyati // GarP_1,1.32 //
atha so 'ṣṭamasandhyāyāṃ naṣṭaprāyeṣu rāñjasu /
bhavitā viṣṇuyaśaso nāmnā kalkī jagatpatiḥ // GarP_1,1.33 //
avatārā hyasaṃkhyeyā hareḥ sattvanidherdvijāḥ /
manuvedavido hyādyāḥ sarve viṣṇukalāḥ smṛtāḥ // GarP_1,1.34 //
tasmātsargādayo jātāḥ saṃpūjyāśca vratādinā /
purāṇaṃ gāruḍaṃ vyāsaḥ purāsau me 'bravīdidam // GarP_1,1.35 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye karmakāṇḍe etatpurāṇapravṛttihetunirūpaṇaṃ nāma prathamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 2
ṛṣaya ūcuḥ /
kathaṃ vyāsena kathitaṃ purāṇaṃ gāruḍaṃ tava /
etatsarvaṃ samākhyāhi paraṃ viṣṇukathāśrayam // GarP_1,2.1 //
sūta uvāca /
ahaṃ hi munibhiḥ sārdhaṃ gato badarikāśramam /
tatra dṛṣṭo mayā vyāso dhyāyamānaḥ pareśvaram // GarP_1,2.2 //
taṃ praṇamyopaviṣṭo 'haṃ pṛṣṭavānhi munīśvaram /
sūta uvāca /
vyāsa brūhi hare rūpaṃ jagatsargādikaṃ tataḥ // GarP_1,2.3 //
manye dhyāyasi taṃ yasmāttasmājjānāsi taṃ vibhum /
evaṃ pṛṣṭo yathā prāha tathā viprā?nibodhata // GarP_1,2.4 //
vyāsa uvāca /
śṛṇu sūta ! pravakṣyāmi purāṇaṃ gāruḍaṃ tava /
saha nāradadakṣādyairbrahmā māmuktavānyathā // GarP_1,2.5 //
sūta uvāca /
dakṣanāradamukhyaistu yuktaṃ tvāṃ kathamuktavān /
brahmā śrīgāruḍaṃ puṇyaṃ purāṇaṃ sāravācakam // GarP_1,2.6 //
vyāsa uvāca /
ahaṃ hi nārado dakṣo bhṛgvādyāḥ praṇipatya tam /
sāraṃ brūhīti papracchurbrahmāṇaṃ brahmalokagam // GarP_1,2.7 //
brahmovāca /
purāṇaṃ gāruḍaṃ sāraṃ rudraṃ ca māṃ yathā /
suraiḥ sahābravīdviṣṇustathāhaṃ vyāsa vacmite // GarP_1,2.8 //
vyāsa uvāca /
kathaṃ rudraṃ suraiḥ sārdhamabravīdvai hariḥ purā /
purāṇaṃ gāruḍaṃ sāraṃ brūhi brahmanmahārthakam // GarP_1,2.9 //
brahmovāca /
ahaṃ gato 'driṃ kailāsamindrādyairdaivataiḥ saha /
tatra dṛṣṭo mayā rudro dhyāyamānaḥ paraṃ padam // GarP_1,2.10 //
pṛṣṭo namaskṛtaḥ kiṃ tvaṃ devaṃ dhyāyasi śaṅkara? /
tvatto nānyaṃ paraṃ devaṃ jānāmi brūhi māṃ tataḥ // GarP_1,2.11 //
sārātsārataraṃ tattvaṃ śrotukāmaḥ suraiḥ saha /
rudrauvāca /
ahaṃ dhyāyāmi taṃ viṣṇuṃ paramātmānamīśvaram // GarP_1,2.12 //
sarvadaṃ sarvagaṃ sarvaṃ sarvaprāṇihṛdisthitam /
bhasmoddhūlitadehastu jaṭāmaṇḍalamaṇḍitaḥ // GarP_1,2.13 //
viṣṇorārādhanārthaṃ me vratacaryā pitāmaha /
tameva gatvā pṛcchāmaḥ sāraṃ yaṃ cintayāmyaham // GarP_1,2.14 //
viṣṇuṃ jiṣṇuṃ padmanābhaṃ hariṃ dehavivarjitam /
śuciṃ śuciṣadaṃ haṃsaṃ tatpadaṃ parameśvaram // GarP_1,2.15 //
yuktā sarvātmanātmānaṃ taṃ devaṃ cintayāmyaham /
yasminviśvāni bhūtāni tiṣṭhanti ca viśanti ca // GarP_1,2.16 //
guṇabhūtāni bhūteśe sūtre maṇigaṇā iva /
sahasrākṣaṃ sahasrāṅghriṃ sahasroruṃ varānanam // GarP_1,2.17 //
aṇīyasāmaṇīyāṃsaṃ sthaviṣṭhaṃ ca sthavīyasām /
garīyasāṃ gariṣṭhaṃ ca śreṣṭhaṃ ca śreyasāmapi // GarP_1,2.18 //
yaṃ vākyeṣvanuvākyeṣu niṣatsūpaniṣatsu ca /
gṛṇanti satyakarmāṇaṃ satyaṃ satyeṣu sāmasu // GarP_1,2.19 //
purāṇa puruṣaḥ prokto brahmā prokto dvijātiṣu /
kṣaye saṅkarṣaṇaḥ proktastamupāsyamupāsmahe // GarP_1,2.20 //
yasmiṃllokāḥ sphurantīme jale śakunayo yathā /
ṛtamekākṣaraṃ brahma yattatsadasataḥ param // GarP_1,2.21 //
arcayanti ca yaṃ devā yakṣarākṣasapannagāḥ /
yasyāgnirāsyaṃ dyaurmūrdhā khaṃ nābhiścaraṇau kṣitiḥ // GarP_1,2.22 //
candrādityau ca nayane taṃ devaṃ cintayāmyaham /
yasya trilokī jaṭhare masya kāṣṭhāśca bāhavaḥ // GarP_1,2.23 //
yasyocchvāsaśca pavanaḥ taṃ devaṃ cintayāmyaham /
yasya keśeṣu jīmūtā nadyaḥ sarvāṅgasandhiṣu // GarP_1,2.24 //
kukṣau samudrāścatvārastaṃ devaṃ cintayāmyaham /
paraḥ kālātparo yajñātparaḥ sadasataścayaḥ // GarP_1,2.25 //
anādirādi rviśvasya taṃ devaṃ cintayāmyaham /
manasaścandramā yasya cakṣuṣośca divākaraḥ // GarP_1,2.26 //
mukhādagniśca saṃjajñe taṃ devaṃ cintayāmyaham /
padybhāṃ yasya kṣitirjātā śrotrābhyāṃ ca tathā diśaḥ // GarP_1,2.27 //
mūrdhabhāgāddivaṃ yasya taṃ devaṃ cintayāmyaham /
sargaśca pratisargaśca vaṃśo manvantarāṇi ca // GarP_1,2.28 //
vaṃśānucaritaṃ yasmāttaṃ devaṃ cintayāmyaham /
yaṃ dhyāyāmyahametasmādūjāmaḥ sāramīkṣitum // GarP_1,2.29 //
brahmovāca /
ityukto 'haṃ purā rudraḥ śvetadvīpanivāsinam /
stutvā praṇamya taṃ viṣṇuṃ śrotukāma sthitaḥ suraiḥ // GarP_1,2.30 //
asmākaṃ madhyato rudra uvāca parameśvaram /
sārāntsārataraṃ viṣṇuṃ pṛṣṭavāṃstaṃ praṇamya vai // GarP_1,2.31 //
brahmovāca /
yathā papraccha māṃ vyāsa stathāsau bhagavān bhavaḥ /
papraccha viṣṇuṃ devādyaiḥ śṛṇvatāmamaraiḥ saha // GarP_1,2.32 //
rudra uvāca /
hare kathaya deveśa ! devadevaḥ ka īśvaraḥ /
ko dhyeyaḥ kaśca vai pūjyaḥ kairvratai stuṣyate paraḥ // GarP_1,2.33 //
kairdharmaiḥ kaiśca niyamaiḥ kayā vā dharmapūjayā /
kenācāreṇa tuṣṭaḥ syātkiṃ tadrūpaṃ ca tasya vai // GarP_1,2.34 //
kasmāddevājjagajjātaṃ jagatpālayate cakaḥ /
kīdṛśairavatāraiśca kasminyāti layaṃ jagat // GarP_1,2.35 //
sargaśca pratisargaśca vaṃśo manvantarāṇi ca /
kasmāddevātpravartante kasmimannetatpratiṣṭhitam // GarP_1,2.36 //
etatsarvaṃ hare ! brūhi yaccānyadapi kiñcana /
parameśvaramāhātmyaṃ yuktayogādikaṃ tathā // GarP_1,2.37 //
tathāṣṭādaśa vidyāśca harī rudraṃ tato 'bravīt /
hariruvāca /
śṛṇu rudra ! pravakṣyāmi brahmaṇā ca suraiḥ saha // GarP_1,2.38 //
ahaṃ hi devo devānāṃ sarvalokeśvareśvaraḥ /
ahaṃ dhyeyaśca pūjyaśca stutyohaṃ statibhiḥ suraiḥ // GarP_1,2.39 //
ahaṃ hi pūjito rudra ! dadāmi paramāṃ gatim /
niyamaiśca vrataistuṣṭa ācāreṇa ca mānavaiḥ // GarP_1,2.40 //
jagatsthiterahaṃ bījaṃ jagatkartā tvahaṃ śiva ! /
duṣṭanigrahakartā hi dharmagoptā tvahaṃ hara ! // GarP_1,2.41 //
avatāraiśca matsyādyaiḥ pālayāmyakhilaṃ jagat /
ahaṃ mantrāśca mantrārthaḥ pūjādhyānaparo hyaham // GarP_1,2.42 //
svargādīnāṃ ca kartāhaṃ svargādīnyahameva ca /
yogī yogohamevādyaḥ purāṇānyahamevaca // GarP_1,2.43 //
jñātā śrotā tathā mantā vaktā vaktavyameva ca /
sarvaḥ sarvātmako devo bhuktimuktikaraḥ paraḥ // GarP_1,2.44 //
dhyānaṃ pūjopahāro 'haṃ maṇḍalānyahameva ca /
itihāsānyahaṃ rudra ! sarvavedā hyahaṃ śiva ! // GarP_1,2.45 //
sarvajñānānyahaṃ śambho ! brahmātmāhamahaṃ śiva ! /
ahaṃ brahmā sarvalokaḥ sarvadevātmako hyaham // GarP_1,2.46 //
ahaṃ sākṣātsadācāro dharmo 'haṃ vaiṣṇavo hyaham /
varṇāśramāstathā cāhaṃ taddharmo 'haṃ purātanaḥ // GarP_1,2.47 //
yamo 'haṃ niyamo rudra ! vratāni vividhāni ca /
ahaṃ sūryastathā candro maṅgalādīnyahaṃ tathā // GarP_1,2.48 //
purā māṃ garuḍaḥ pakṣī tapasārādhayadbhuvi /
tuṣṭa ūce varaṃ brūhi matto vavre varaṃ sa tu // GarP_1,2.49 //
garuḍa uvāca /
mama mātā ca vinatā nāgairdāsīkṛtā hare /
yathāhaṃ deva tāñjitvā cāmṛtaṃ hyānayāmi tat // GarP_1,2.50 //
dāsyādvimokṣayiṣyāmi yathāhaṃ vāhanastava /
mahābalo mahāvīryaḥ sarvajño nāgadāraṇaḥ // GarP_1,2.51 //
purāṇasaṃhitākartā yathāhaṃ syāṃ tathā kuruṃ /
viṣṇuruvāca /
yathā tvayoktaṃ garuḍa tathā sarvaṃ bhaviṣyati // GarP_1,2.52 //
nāgadāsyānmātaraṃ tvaṃ vinatāṃ mokṣayiṣyasi /
devādīnsakalāñjitvā cāmṛtaṃ hyānayiṣyasi // GarP_1,2.53 //
mahābalo vāhanastvaṃ bhaviṣyasi viṣārdanaḥ /
purāṇaṃ matprasādācca mama māhātmyavācakam // GarP_1,2.54 //
yaduktaṃ matsvarūpaṃ ca tava cāvirbhaviṣyati /
gāruḍaṃ tava nāmnā talloke khyātiṃ gamiṣyati // GarP_1,2.55 //
yathāhaṃ devadevānāṃ śrīḥ khyāto vinatāsuta /
tathā khyātiṃ purāṇeṣu gāruḍaṃ gāruḍaiṣyati // GarP_1,2.56 //
yathāhaṃ kīrtanīyo 'tha tathā tvaṃ garuḍātmanā /
māṃ dhyātvā pakṣimukhyedaṃ purāṇaṃ gada gāruḍam // GarP_1,2.57 //
ityukto garuḍo rudra ! kaśyapāyāha pṛcchate /
kaśyapo gāruḍaṃ śrutvā vṛkṣaṃ dagdhamajīvayat // GarP_1,2.58 //
svayaṃ cānyamanā bhūtvā vidyayānyānya jīvayat /
yakṣi oṃuṃsvāhājāpī vidyayaṃ gāruḍī parā /
garuḍoktaṃ gāruḍaṃ hi śṛṇu rudra ! madātmakam // GarP_1,2.59 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śrīgaruḍamahāpurāṇotpattinirūpaṇaṃ nāma dvitīyo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 3
sūta uvāca /
iti rudrābjajo viṣṇoḥ śuśrāva brahmaṇo muniḥ /
vyāso vyāsādahaṃ vakṣyehaṃ te śaunaka naimiṣe // GarP_1,3.1 //
munīnāṃ śṛṇvatāṃ madhye sargādyaṃ devapūjanam /
tīrthaṃ bhuvanakośaṃ ca manvantaramihocyate // GarP_1,3.2 //
varṇāśramādidharmāśca dānarājādidharmakāḥ /
vyavahāro vrataṃ vaṃśā vaidyakaṃ sanidānakam // GarP_1,3.3 //
aṅgāni pralayo dharmakāmārthajñānamuttamam /
saprapañcaṃ niṣprapañcaṃ kṛtaṃ viṣṇornigadyate // GarP_1,3.4 //
purāṇe gāruḍe sarvaṃ garuḍo bhagavānatha /
vāsudevaprasādena sāmarthyātiśayairyutaḥ // GarP_1,3.5 //
bhutvā harervāhanaṃ ca sargādīnāṃ ca kāraṇam /
devānvijitya garuḍo hyamṛtāharaṇaṃ tathā // GarP_1,3.6 //
cakre kṣudhā hṛtaṃ yasya brahmāṇḍamudare hareḥ /
yaṃ dṛṣṭvā smṛtamātreṇa nāgāndīnāṃ ca saṃkṣayaḥ // GarP_1,3.7 //
kaśyapo gāruḍādvṛkṣaṃ dagdhaṃ cājīvayadyataḥ /
garuḍaḥ sa haristena proktaṃ śrīkaśyapāya ca // GarP_1,3.8 //
tacchrīmadrāruḍaṃ puṇyaṃ sarvadaṃ paṭhatastava /
vakṣye vyāsaṃ namaskṛtya śṛṇu śaunaka tadyathā // GarP_1,3.9 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣayanirūpaṇaṃ nāma tṛtīyo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 4
rudra uvāca /
sargaśca pratisargaśca vaṃśo manvantarāṇi ca /
vaṃśānucaritaṃ caiva etad brūhi janārdana // GarP_1,4.1 //
hariruvāca /
śṛṇu rudra pravakṣyāmi sargādīnpāpanāśanām /
sargasthitilayāntāṃ tāṃ viṣṇoḥ krīḍāṃ purātanīm // GarP_1,4.2 //
naranārāyaṇo devo vāsudevo nirañjanaḥ /
paramātmā paraṃ brahma jagajjanilayādikṛt // GarP_1,4.3 //
tadetatsarvamevaitavdyaktāvyaktasvarūpavat /
tathā puruṣarūpeṇa kālarūpeṇa ca sthitam // GarP_1,4.4 //
vyaktaṃ viṣṇustathāvyaktaṃ puruṣaḥ kāla eva ca /
krīḍato bālakasyeva ceṣṭāstasya niśāmaya // GarP_1,4.5 //
anādinidhano dhātā tvanantaḥ puruṣottamaḥ /
tasmādbhavati cāvyaktaṃ tasmādātmāpi jāyate // GarP_1,4.6 //
tasmāhuddhirmanastasmāttataḥ khaṃ pavana stataḥ /
tasmāttejastatastvāpastato bhūmistato 'bhavat // GarP_1,4.7 //
aṇḍo hiraṇmayo rudra tasyāntaḥ svayameva hi /
śarīragrahaṇaṃ pūrvaṃ sṛṣṭyarthaṃ kurute prabhuḥ // GarP_1,4.8 //
brahmā caturmukho bhūtvā rajomātrādhikaḥ sadā /
śarīragrahaṇaṃ kṛtvāsṛjadetaccarācaram // GarP_1,4.9 //
aṇḍasyāntarjagatsarvaṃ sadevāsuramānuṣam /
sraṣṭā sṛjati cātmānaṃ viṣṇuḥ pālyaṃ ca pāti ca // GarP_1,4.10 //
apasaṃhriyate cānte saṃhartā ca svayaṃ hara /
brahmā bhūtvāsṛjadviṣṇurjagatpāti hariḥ svayam // GarP_1,4.11 //
rudrarūpī ca kalpānte jagatsaṃharate 'khilam /
brahmā tu sṛṣṭikāle 'smiñjamadhyagatāṃ mahīm // GarP_1,4.12 //
daṃṣṭūyoddharati jñātvā vārahīmāsthitastanūm /
devādisargānvakṣye 'haṃ saṃkṣepācchṛṇu śaṅkara ! // GarP_1,4.13 //
(1)prathamo mahataḥ sargo virūpo brahmaṇastu saḥ /
(2) nanmātrāṇāṃ dvitīyastu bhūtasargo hi sa smṛtaḥ // GarP_1,4.14 //
(3)vaikārikastṛtīyastu sargastvaindriyakaḥ smṛtaḥ /
ityeṣa prākṛtaḥ sargaḥ sambhūto buddhipūrvakaḥ // GarP_1,4.15 //
(4)mukhyasargaścaturthastu mukhyā vai sthāvarāḥ smṛtāḥ /
(5)tiryaksrotāstu yaḥ proktastiryagyonyaḥ sa ucyate // GarP_1,4.16 //
(6) tadūrdhvastotasāṃ ṣaṣṭho devasargastu sa smṛtaḥ /
(7) tator'vāksrotasāṃ sargaḥ saptamaḥ sa tu mā nuṣaḥ // GarP_1,4.17 //
(8)aṣṭamo 'nugrahaḥ sargaḥ sāttvikastāmasastu saḥ /
pañcaite vaikṛtāḥ sargāḥ prākṛtāstu trayaḥ smṛtāḥ // GarP_1,4.18 //
prākṛto vaikṛtaścāpi (9) kaumāro navamaḥ smṛtaḥ /
sthāvarāntāḥ surādyāstu prajā rudra ! caturvidhāḥ // GarP_1,4.19 //
brahmaṇaḥ kurvataḥ sṛṣṭiṃ jajñire mānasāḥ sutāḥ /
tato devāsurapitṝnmānuṣāṃśca catuṣṭayam // GarP_1,4.20 //
sisṛkṣurambhāṃsyetāni svamātmānamayūyujat /
vyaktātmanastamomātrādudriktāstatprajāpateḥ // GarP_1,4.21 //
sisṛkṣerjaghanātpūrvamasurā jajñire tataḥ /
utsasarja tatastāṃ tu tamomātrātmikāṃ tanūm // GarP_1,4.22 //
tamomātrā tanustyaktā śaṅkarābhūdvibhāvarī /
yakṣopakṣāṃsi taddehe prītimāpustataḥ surāḥ // GarP_1,4.23 //
sattvodriktāstu mukhataḥ saṃbhūtā brahmaṇo hara ! /
sattvaprāyā tanustena santyaktā sāpyabhūddinam // GarP_1,4.24 //
tato hi balino rātrāvasurā devatā divā /
sattvamātrāṃ tanuṃ gṛhya pitaraśca tato 'bhavan // GarP_1,4.25 //
sā cotsṛṣṭābhavatsandhyā dinanaktāntarasthitiḥ /
rajomātrāṃ tanuṃ gṛhya manuṣyāstvabhavaṃstataḥ // GarP_1,4.26 //
sā tyaktā cābhavajjyotsnā prāksandhyā yābhidhīyate /
jyotsnā rātryahanī sandhyā śarīrāṇi tu tasya vai // GarP_1,4.27 //
rajomātrāṃ tanu gṛhya kṣudabhūtkopa eva ca /
kṣuttṛṭkṣāmā amṛgbhakṣā rākṣasā rakṣaṇācca ye // GarP_1,4.28 //
yakṣākhyā jakṣaṇājjñeyāḥ sarpā vai keśasarpaṇāt /
jātāḥ kopena bhūtāste gandharvā jajñire tataḥ // GarP_1,4.29 //
gāyanto jajñire vācaṃ gandharvāpsarasaśca ye /
svargaṃ dyaurvakṣasaścakre sukhato 'jāḥ sa muṣṭavān // GarP_1,4.30 //
sṛṣṭavānudarādrāśca pārśvābhyāṃ ca prajāpatiḥ /
padybhāṃ caivāntyamātaṅgānmahiṣoṣṭrāvikāṃstathā // GarP_1,4.31 //
opadhyaḥ phalamūlinyo romabhyastasya jajñire /
gaurajaḥ puruṣo medhyo hyaśvāśvataragardabhāḥ // GarP_1,4.32 //
etān grāmyānpaśūnprāhurāraṇyāṃśca nibodha me /
śvāpadaṃ dvikhuraṃ hastivānarāḥ pakṣipañcamāḥ // GarP_1,4.33 //
audakāḥ paśavaḥ ṣaṣṭhāḥ saptamāśca sarīsṛpāḥ /
pūrvādibhyo mukhebhyastu ṛgvedādyāḥ prajajñire // GarP_1,4.34 //
āsyādvai brāhmaṇā jātā bāhubhyāṃ kṣattriyāḥ smṛtāḥ /
ūrubhyāṃ tu viśaḥ sṛṣṭāḥ śūdraḥ padybhāma jāyata // GarP_1,4.35 //
brahmaloko brāhmaṇānāṃ śākraḥ kṣattriyajanmanām /
mārutaṃ ca viśāṃ sthānaṃ gāndharvaṃ śūdrajanmanām // GarP_1,4.36 //
brahmacārivratasthānāṃ brahmalokaḥ prajāyate /
prājāpatyaṃ gṛhasthānāṃ yathāvihitakāriṇām // GarP_1,4.37 //
sthānaṃ saptaṛṣīṇāṃ ca tathaiva vanavāsinām /
yatīnāmakṣayaṃ sthānaṃ yadṛcchāgāmināṃ sadā // GarP_1,4.38 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sṛṣṭivarṇanaṃ nāma caturtho 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 5
iriruvāca /
kṛtvehāmutrasaṃsthānaṃ prajāsargaṃ tu mānasam /
athāmṛjatprajākartṝnbhānasāṃstanayānprabhuḥ // GarP_1,5.1 //
dharmaṃ rudraṃ manuṃ caiva sanakaṃ ca sanātanam /
bhṛguṃ sanatkumāraṃ ca ruciṃ śraddhāṃ tathaiva ca // GarP_1,5.2 //
marīcimatryaṅgirasau pulastyaṃ pulahaṃ kratum /
vasiṣṭhaṃ nāradaṃ caiva pitṝnbarhiṣadastathā // GarP_1,5.3 //
agniṣvāttāṃśca kavyādānājyapāṃśca sukālinaḥ /
upahūtāṃstathā dīpyāṃ (prā) strīṃśca mūrtivivarjitān // GarP_1,5.4 //
caturo mūrtiyuktāṃśca aṅguṣṭhāddakṣamīśvaram /
vāmāṃ guṣṭhāttasya bhāryāmasṛjatpadmasambhavaḥ // GarP_1,5.5 //
tasyāṃ tu janayāmāsa dakṣo duhitaraḥ śubhāḥ /
dadau tā brahmaputrebhyaḥ satīṃ rudrāya dattavān // GarP_1,5.6 //
rudra putrā babhūvurhi asaṃkhyātā mahābalāḥ /
bhṛgave ca dadau khyātiṃ rūpeṇāpratimāṃ śubhām // GarP_1,5.7 //
bhṛgordhātāvidhātārau janayāmāsa sā śubhā /
śriyaṃ ca janayāmāsa patnī nārāyaṇasya yā // GarP_1,5.8 //
tasyāṃ vai janayāmāsa balonmādau hariḥ svayam /
āyatirniyatiścaiva manoḥ kanye mahātmanaḥ // GarP_1,5.9 //
dhātāvidhātroste bhārye tayorjātau sutāvubhau /
prāṇaścaiva mṛkaṇḍuśca mārkaṇḍeyo mṛkaṇḍutaḥ // GarP_1,5.10 //
patni marīceḥ sambhūtiḥ paurṇamāsamasūyata /
virajāḥ sarvagaścaiva tasya putrau mahātmanaḥ // GarP_1,5.11 //
smṛteścāṃṅgirasaḥ putrāḥ prasūtāḥ kanyakāstathā /
sinīvālī kuhūścaiva rākā cānumatistathā // GarP_1,5.12 //
anasūyā tathaivātrerjajñe putrānakalmaṣān /
somaṃ durvāsasaṃ caiva dattātreyaṃ ca yoginam // GarP_1,5.13 //
prītyāṃ pulastyabhāryāyāṃ dattolistatsuto 'bhavat /
karṃmaśaścārthavīraśca sahiṣṇuśca sutatrayam // GarP_1,5.14 //
kṣamā tu suṣuve bhāryā pulahasya prijāpateḥ /
kratośca sumatirbhāryā bālakhilyānasūyata // GarP_1,5.15 //
ṣaṣṭiryāni sahasrāṇi ṛṣīṇāmūrdharetasām /
aṅguṣṭhaparvamātrāṇāṃ jvaladbhāskaravarcasām // GarP_1,5.16 //
ūrjāyāṃ tu vasiṣṭasya saptājāyanta vai sutāḥ /
rajogātrordhabāhuśca śaraṇaścānaghastathā // GarP_1,5.17 //
sutapāḥ śukra ityete sarve saptarṣayo 'malāḥ /
svāhāṃ prādātsa dakṣo 'pi śaśarīrāya vahnaye // GarP_1,5.18 //
tasmātsvāhā sutāṃllebhe trīnudāraujaso hara ! /
phāvakaṃ pavamānaṃ ca śuciṃ cāpi jalāśinaḥ // GarP_1,5.19 //
pitṛbhyaśca svadhā jajñe menāṃ vaitaraṇīṃ tathā /
te ubhe brahmavādinyau menāyāṃ tu himācalaḥ // GarP_1,5.20 //
mainākaṃ janayāmāsa gaurīṃ pūrvaṃ tu yā satī /
tato brahmātmasambhūtaṃ pūrvaṃ svāyaṃbhuvaṃ prabhuḥ // GarP_1,5.21 //
ātmānameva kṛtavānprajāpālyaṃ manuṃ hara ! /
śatarūpāṃ ca tāṃ nārīṃ taponihatakalmaṣām // GarP_1,5.22 //
svāyambhuvo manurdevaḥ patnitve jagṛhe vibhuḥ /
tasmācca puruṣāddevī śatarūpā vyajāyata // GarP_1,5.23 //
priyavratottānapādau prasūtyākūtisaṃjñete /
devahūtiṃ manustāsu ākūtiṃ rucaye dadau // GarP_1,5.24 //
prasūtiṃ caiva dakṣāya davahūtiṃ ca kardame /
ruceryajño dakṣiṇābhūddakṣiṇāyāṃ ca yajñataḥ // GarP_1,5.25 //
abhavandvādaśa sutā yāmā nāma mahābalāḥ /
caturvośatikanyāśca sṛṣṭavāndakṣa uttamāḥ // GarP_1,5.26 //
śraddhā calā dhṛtistuṣṭiḥ puṣṭirmedhā kriyā tathā /
buddhirlajjā vapuḥ śāntirṛddhiḥ kīrtistnayodaśī // GarP_1,5.27 //
patnyarthaṃ pratijagrāha dharmo dākṣāyaṇīprabhuḥ /
khyatiḥ satyatha sambhūtiḥ smṛtiḥ prītiḥ kṣamā tathā // GarP_1,5.28 //
sannatiścānasūyā ca ūrjā svāhā svadhā tathā /
bhṛghurbhavo marīciśca tathā caivāṅgirā muniḥ // GarP_1,5.29 //
pulastyaḥ pulahaścaiva kratuścarṣivarastathā /
ātrirvasiṣṭho vahniśca pitaraśca yathākramam // GarP_1,5.30 //
khyātyādyā jagṛhuḥ kanyā munayo munisattamāḥ /
śraddhā kāmaṃ calā darpaṃ niyamaṃ dhṛtirātmajam // GarP_1,5.31 //
santoṣaṃ ca tathā tuṣṭirlobhaṃ puṣṭirasūyata /
medhā śrutaṃ kriyā daṇḍaṃ layaṃ vinayameva ca // GarP_1,5.32 //
bodhaṃ buddhistathā lajjā vinayaṃ vapurātmajam /
vyavasāyaṃ prajajñe vai kṣemaṃ śāntirasūyata // GarP_1,5.33 //
sukhamṛddhiryaśaḥ kīrtirityete dharmasūnavaḥ /
kāmasya ca ratirbhāryā tatputro harṣa ucyate // GarP_1,5.34 //
īje kadācidyajñena hayamedhena dakṣakaḥ /
tasya jāmātaraḥ sarve yajñaṃ jagmurnimantritāḥ // GarP_1,5.35 //
bhāryabhiḥ sahitāḥ sarve rudraṃ devīṃ satīṃ vinā /
anāhūtā satī prāptā dakṣeṇaivāvamānitā // GarP_1,5.36 //
tyaktā dehaṃ punarjātā menāyāṃ tu himālayāt /
śambhorbhāryābhavadraurī tasyāṃ jajñe vināyakaḥ // GarP_1,5.37 //
kumāraścaiva bhṛṅgīśaḥ kruddho rudraḥ pratāpavān /
vidhvaṃsya yajñaṃ dakṣaṃ tu taṃ śaśāpa pinākadhṛk /
dhruvasyānvayasambhūto manuṣyastvaṃ bhaviṣyasi // GarP_1,5.38 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe prajākartrādisṛṣṭirnāma pañcamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 6
hariruvāca /
uttānapādādabhavatsurucyāmuttamaḥ sutaḥ /
sunītyāṃ tu dhruvaḥ putraḥ sa lebhe sthānamuttamam // GarP_1,6.1 //
muniprasādādārādhya devadevaṃ janārdanam /
dhruvasya tanayaḥ śliṣṭirmahābalaparākramaḥ // GarP_1,6.2 //
tasya prācīnavarhistu putrastasyāpyudāradhīḥ /
divañjayastasya sutastasya putro ripuḥ smṛtaḥ // GarP_1,6.3 //
ripoḥ putrastathā śrīmāṃścākṣuṣaḥ kīrtito manuḥ /
rurustasya sutaḥ śrīmānaṅgastasyāpi cātmajaḥ // GarP_1,6.4 //
aṅgasya veṇaḥ putrastu nāstiko dharmavarjitaḥ /
adharṃmakārī veṇa(na) śca munibhiśca kuśairhataḥ // GarP_1,6.5 //
ūruṃ mamanthuḥ putrārthe tato 'sya tanayo 'bhavat /
hrasvo 'timātraḥ kṛṣṇāṅgo niṣīdeti tato 'bruvan // GarP_1,6.6 //
niṣādastena vai jāto bindhyaśailanivāsakaḥ /
tato 'sya dakṣiṇaṃ pāṇiṃ mamanthuḥ sahasā dvijāḥ // GarP_1,6.7 //
tasmāttasya suto jāto viṣṇormānasarūpadhṛk /
puthurityevanāmā sa veṇaputro divaṃ yayau // GarP_1,6.8 //
dudoha pṛthivīṃ rājā prajānāṃ jīvanāya hi /
antardhānaḥ pṛthoḥ putro tahavirdhānastadātmajaḥ // GarP_1,6.9 //
prācīnavaharstetputraḥ pṛthivyāmekarāḍ babhau /
upayeme samudrasya lavaṇasya sa vai sutām // GarP_1,6.10 //
tasmātsuṣāva sāmudrī daśa prācīnabarhiṣaḥ /
sarve prācetasā nāma dhanurvedasya pāragāḥ // GarP_1,6.11 //
apṛthagadharṃmacaraṇāste 'tapyanta mahattapaḥ /
daśavarṣasahasrāṇi samudrasalileśayāḥ // GarP_1,6.12 //
prajāpatitvaṃ saṃprāpya bhāryā teṣāṃ ca māriṣa /
abhavaddhavaśāpena tasyāṃ dakṣo 'bhavattataḥ // GarP_1,6.13 //
asṛjanmanasā dakṣaḥ prajāḥ pūrvaṃ caturvodhāḥ /
nāvardhanta ca tāstasya apadhyātā hareṇa tu // GarP_1,6.14 //
maithunena tataḥ sṛṣṭiṃ kartumaicchatprajāpatiḥ /
asikrīmāvahadbhāryāṃ vīraṇasya prajāpateḥ // GarP_1,6.15 //
tasya putrasahasraṃ tu vairaṇyāṃ samapadyata /
nāradoktā bhuvaścāntaṃ gatā jñātuṃ ca nāgatāḥ // GarP_1,6.16 //
dakṣaputrasahasraṃ ca teṣu naṣṭeṣu sṛṣṭavān /
śavalāśvāste 'pi gatā bhrātṝṇāṃ padavīṃ hara ! // GarP_1,6.17 //
dakṣaḥ kruddhaḥ śaśāpātha nāradaṃ janma cāpsyasi /
nārado hyabhavatputraḥ kaśyapasya muneḥ punaḥ // GarP_1,6.18 //
yajñe dhvaste 'tha dakṣo 'pi śaśāprograṃ maheśvaram /
stutvātvāmupacāraiśca pūjayiṣyanti śaṅkara // GarP_1,6.19 //
janmāntare 'pi vaireṇa te vinaśyanti śaṅkara ! /
tasmādvairaṃ na kartavyaṃ kadācidapi kenacit /
asiknyāṃ (mahiṣyāṃ) janayāmāsa dakṣo duhitaro hyatha // GarP_1,6.20 //
ṣaṣṭiṃ kanyā rūpayutā dve caivāṅgirase dadau /
dve prādātsa kṛśāśvāya daśa dharṃmāya cāpyatha // GarP_1,6.21 //
caturdaśa kaśyapāya aṣṭāviṃśātimindave /
pradadau bahuputrāya suprabhāṃ bhāminīṃ tathā // GarP_1,6.22 //
manoramāṃ bhānumatīṃ viśālāṃ bahudāmatha /
dakṣaḥ prādānmahādeva ! catasro 'riṣṭanemaye (ne) // GarP_1,6.23 //
sa kṛśāśvāya ca prādātsuprajāṃ ca tathā jayām /
arundhatī vasuryār(jā) mī lambā bhānurmarudvatī // GarP_1,6.24 //
saṅkalpā ca muhūrtā ca sādhyā viśvā ca tā daśa /
dharṃmapatnyaḥ samākhyātāḥ kaśyapasya vadāmyaham // GarP_1,6.25 //
aditirditirdanuḥ kālā hyanāyuḥ siṃhikā muniḥ /
kadrūḥ sādhyā harā krodhā vinatā surabhiḥ khagā // GarP_1,6.26 //
viśvedevāstu viśvāyāḥ sādhyā sādhyānvyajāyata /
marutvatyāṃ marutvanto vasostu vasavastathā // GarP_1,6.27 //
bhānostu bhānavo rudra ! muhūrtācca muhūrtajāḥ /
lambāyāścaiva ghoṣo 'tha nāgavīthistu yā (jā) mitaḥ // GarP_1,6.28 //
pṛthivīviṣayaṃ sarvamarutvatyāṃ vyajāyata /
saṅkalpāyāstu sarvātmā jajñe saṃkalpa eva hi // GarP_1,6.29 //
āpo dhruvaśca somaśca dharaścaivānilo 'nalaḥ /
pratyūṣaśca prabhāsaśca vasavo nāmabhiḥ smṛtāḥ // GarP_1,6.30 //
āpasya putro vetuṇḍiḥ (ṇḍaḥ) śramaḥ śrānto dhvanistathā /
dhruvasya putro bhagavānkālo lokaprakālanaḥ // GarP_1,6.31 //
somasya bhagavānvarcā varcasvī yena jāyate /
dharasya putro druhiṇo hutahavyavahastathā // GarP_1,6.32 //
manoharāyāṃ śiśiraḥ prāṇo 'tha ramaṇastathā /
anilasya śivā bhāryā tasyāḥ putraḥ pulomajaḥ // GarP_1,6.33 //
avijñātagatiścaiva dvau putrāvanilasya tu /
agniputraḥ kumārastu śarastambe vyajāyat // GarP_1,6.34 //
tasya śākho viśākhaśca naigameyaśca pṛṣṭajaḥ /
apatyaṃ kṛttikānāṃ tu kārtikeya iti smṛtaḥ // GarP_1,6.35 //
pratyuṣasya viduḥ putramṛṣiṃ nāmnā tu devalam /
viśvakarṃmā prabhāsasya vikhyāto devavardhakiḥ // GarP_1,6.36 //
ajaikapādahirbudhnyastvaṣṭā rudraśca vīryavān /
tvaṣṭuścāpyātmajaḥ putro viśvarūpo mahātapāḥ // GarP_1,6.37 //
haraśca bahurūpaśca tryambakaścāparājitaḥ /
vṛṣākapiśca śambhuśca kaparde raivatastathā // GarP_1,6.38 //
mṛgavyādhaśca śarvaśca kapālī ca mahāmune ! /
ekādaśaite kathitā rudrāstribhuvaneśvarāḥ // GarP_1,6.39 //
adityāṃ kaśyapāccaiva sūryā dvādaśa jajñire /
viṣṇuḥ śakror'yyamā dhātā tvaṣṭā pūṣā tathaiva ca // GarP_1,6.40 //
vivasvānsavitā caiva mitro varuṇa eva ca /
aśumāṃśca bhagaścaiva ādityā dvādaśa smṛtāḥ // GarP_1,6.41 //
saptaviṃśatiḥ somasya patnyo nakṣatrasaṃjñitāḥ /
hiraṇyakaśipurdityāṃ hiraṇyākṣo 'bhavattadā // GarP_1,6.42 //
siṃhikā cābhavatkanyā vipracittiparigrahā /
hiraṇyakaśipoḥ putrāścatvāraḥ pṛthulaujasaḥ // GarP_1,6.43 //
anuhrādaśca hrādaśca prahrādaścaiva vīryavān /
saṃhrādaścāvamasteṣāṃ prahrādo viṣṇutatparaḥ // GarP_1,6.44 //
saṃhrādaputra āyuṣmāñchibirvāṣkala eva ca /
virocanaśca prāhrādirbalirjajñe virocanāt // GarP_1,6.45 //
baleḥ putraśataṃ tvāsīdvāṇajyeṣṭhaṃ vṛṣadhvaja ! /
hiraṇyākṣasutāścāsansarva eva mahābalāḥ // GarP_1,6.46 //
utkuraḥ śakuniścaiva bhūtasantāpanastathā /
mahānāgo mahābāhuḥ kālanābhastathāparaḥ // GarP_1,6.47 //
abhavandanuputrāśca dvimūrdhā śaṅkarastathā /
ayomukhaḥ śaṅkuśirāḥ kapilaḥ śambarastathā // GarP_1,6.48 //
ekacakro mahābāhustārakaśca mahābalaḥ /
svarbhānurvṛṣaparvā ca pulomā ca mahāsuraḥ // GarP_1,6.49 //
ete danoḥ sutāḥ khyātā vipracittiśca vīryavān /
svarbhānoḥ suprabhā kanyā śarmiṣṭhā vārṣaparvaṇī // GarP_1,6.50 //
upadānavī hayaśirāḥ prakhyātā varakanyakāḥ /
vaiśvānarasute cobhe pulomā kālakā tathā // GarP_1,6.51 //
ubhe te tu mahābhāge mārīcestu parigrahaḥ /
tābhyāṃ putrasahasrāṇi ṣaṣṭirdānavasattamāḥ // GarP_1,6.52 //
paulomāḥ kālakañjāśca mārīcatanayāḥ smṛtāḥ /
siṃhikāyāṃ samutpannā vipracittisutāstathā // GarP_1,6.53 //
vyaṃśaḥ śalyaśca balavānnabhaścaiva mahābalaḥ /
vātāpirnamuciścaiva ilvalaḥ khasṛmāṃstathā // GarP_1,6.54 //
añja (nta) ko narakaścaiva kāla nābhastathaiva ca /
nivātakavacā daityāḥ prahrādasya kule 'bhavan // GarP_1,6.55 //
ṣaṭ sutāśca mahāsattvāstāmrāyāḥ parikīrtitāḥ /
śukī śyenī ca bhāsī ca sugrīvī śucigṛdhrike // GarP_1,6.56 //
śukī śukānajanayadulūkī pratyalūkakān /
śyenī śyenāṃstathā bhāsī bhāsān gṛdhrāṃśca gṛdhryapi // GarP_1,6.57 //
śukyaudakānpakṣigaṇānsugrīvī tu vyajāyata /
(aśvānuṣṭān gardabhāṃśca tāmrāvaṃśaḥ prakīrtitaḥ // GarP_1,6. 58 //)
vinatāyāstu putrau dvau vikhyātau garuḍāruṇau /
surasāyāḥ sahasraṃ tu sarpāṇāmamitaujasām // GarP_1,6.59 //
kādraveyāśca phaṇinaḥ sahasramamitaujasaḥ /
teṣā prādhānā bhūteśa ! śeṣavāsukitakṣakāḥ // GarP_1,6.60 //
śaṅkhaḥ śveto mahāpadmaḥ (śaṅkhaḥ) kambalāśvatarau tathā /
elāpatrastathā nāgaḥ karkoṭakadhanañjayau // GarP_1,6.61 //
gaṇaṃ krodhavaśaṃ viddhi te ca sarve ca daṃṣṭriṇaḥ /
krodhā tu janayāmāsa piśācāṃśca mahābalān // GarP_1,6.62 //
gāstu vai janayāmāsa surabhirmahiṣāṃstathā /
irā vṛkṣalatāballīstṛṇajātīśca sarvaśaḥ // GarP_1,6.63 //
khagā ca yakṣarakṣāṃsi munirapsarasastathā /
ariṣṭā tu mahāsattvān gandharvānsamajījanat // GarP_1,6.64 //
devā ekonapañcāśanmaruto hyabhavanniti /
ekajyo tiśca dvirjyoticaturjyotistathaiva ca // GarP_1,6.65 //
ekaśukro dviśukraśca triśukraśca mahābalaḥ /
īdṛk sadṛk tathānyādṛk tataḥ pratisadṛk tathā // GarP_1,6.66 //
mitaśca samitaścaiva sumitaśca mahābalaḥ /
ṛtajitsatyajiccaiva suṣeṇaḥ senajittathā // GarP_1,6.67 //
atimitro 'pyamitraśca dūramitro 'jitastathā /
ṛtaśca ṛtadharṃmā ca vihartā varuṇo (camaso) dhruvaḥ // GarP_1,6.68 //
vidhāraṇaśca durmedhā ayamekagaṇaḥ smṛtaḥ /
īdṛśaśca sadṛkṣaśca etādṛkṣo mitāśanaḥ // GarP_1,6.69 //
etenaḥ prasadṛkṣaśca surataśca mahātapāḥ /
hetumānprasavastadvatsurabhaśca mahāyaśāḥ // GarP_1,6.70 //
nādirugro dhvanirbhāso bimukto vikṣipaḥ sahaḥ /
dyutirvasuranādhṛṣyo lābha kāmo jayī virāṭ // GarP_1,6.71 //
udveṣaṇo gaṇo nāma vāyuskandhe tu saptame /
etatsarvaṃ hare rūpaṃ rājāno dānavāḥ surāḥ // GarP_1,6.72 //
sūryādi parivāreṇa manvādyā ījire harim // GarP_1,6.73 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe uttānapādavaṃśādivarṇanaṃ nāma ṣaṣṭho 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 7
rudra uvāca /
sūryādipūjanaṃ brūhi kṛtaṃ svāyambhuvādibhiḥ /
bhuktimuktipradaṃ sāraṃ vyāsa ! saṃkṣepataḥ param // GarP_1,7.1 //
hariruvāca /
sūryādipūjāṃ vakṣyāmi dharṃmakāmādikārikām // GarP_1,7.2 //
oṃ sūryāsanāya namaḥ /
oṃ namaḥ sūryamūrtaye /
oṃ hrāṃ hrīṃ saḥ sūryāya namaḥ /
oṃ somāya namaḥ /
oṃ maṅgalāya namaḥ /
oṃ budhāya namaḥ
oṃ bṛhaspataye namaḥ /
oṃ śukrāya namaḥ /
oṃ śanaiścarāya namaḥ /
oṃ rāhave namaḥ /
oṃ ketave namaḥ /
oṃ tejaścaṇḍāya namaḥ // GarP_1,7.3 //
āsanāvāhanaṃ pādyamarghyamācamanaṃ tathā /
snānaṃ vastropavītañca gandhapuṣpaṃ ca dhūpakam // GarP_1,7.4 //
dīpakaṃ ca naskāraṃ pradakṣiṇavisarjane /
sūryādīnāṃ sadā kuryāditi mantrairvṛṣadhvaja ! // GarP_1,7.5 //
oṃ hrāṃśivāya namaḥ /
oṃ hrāṃ śivamūrtaye śivāya namaḥ /
oṃ hrāṃ hṛdayāya namaḥ /
oṃ hrīṃ śirase svāhā /
oṃ hrūṃ śikhāyai vaṣaṭ /
oṃ hrai kavacāya huṃ /
oṃ hrauṃ netratrayāya vauṣaṭ /
oṃ hraḥ astrāya namaḥ /
oṃ hrāṃ sadyojātaya namaḥ /
oṃ hrīṃ vāmadevāya namaḥ /
oṃ hrūṃ aghorāya namaḥ /
oṃ hraiṃ tatpuruṣāya namaḥ /
oṃ hrauṃ īśānāya namaḥ /
oṃ hrīṃ gauryai namaḥ /
oṃ hrauṃ gurubhyo namaḥ /
oṃ hrauṃ indrāya namaḥ /
oṃ hrauṃ caṇḍāya namaḥ /
oṃ hrāṃ aghorāya namaḥ /
oṃ vāsudevāsanāya namaḥ /
oṃ vāsudavamūrtaye namaḥ /
oṃ aṃ oṃ namo bhagavate vāsudevāya namaḥ /
oṃ āṃ oṃ namo bhagavate saṅkarṣaṇāya namaḥ /
oṃ aṃ oṃ namo bhagavate pradyumnāya namaḥ /
oṃ aḥ oṃ namo bhagavate aniruddhāya namaḥ /
oṃ nārāyaṇāya namaḥ /
oṃ tatsabdrahyaṇe namaḥ /
oṃ hrāṃ viṣṇave namaḥ /
oṃ kṣauṃ namo bhagavate narasiṃhāya namaḥ /
oṃ bhūḥ oṃ namo bhagavate varāhāya namaḥ /
oṃ kaṃ ṭaṃ paṃ śaṃ vainateyāya namaḥ /
oṃ jaṃ khaṃ raṃ sudarśa nāya namaḥ /
oṃ khaṃ ṭhaṃ phaṃ ṣaṃ gadaiyau namaḥ /
oṃ vaṃ laṃ maṃ kṣaṃ pāñcajanyāya namaḥ /
oṃ ghaṃ ḍhaṃ bhaṃ haṃ śriyai namaḥ /
oṃ gaṃ ḍaṃ vaṃ saṃ puṣṭyai namaḥ /
oṃ dhaṃ ṣaṃ vaṃ saṃ vanamālāyai namaḥ /
oṃ saṃ daṃ laṃ śrīvatsāya namaḥ /
oṃ ṭhaṃ caṃ bhaṃ yaṃ kaustubhāya namaḥ /
oṃ gurubhyo namaḥ /
oṃ indrādidikpālebhyo namaḥ /
oṃ viṣvaksenāya namaḥ // GarP_1,7.6 //
āsanādīnhareratairmantrairmantrairdadyādvṛṣadhvaja ! /
viṣṇuśaktyāḥ sarasvatyāḥ pūjāṃ śṛṇu śubhapradām // GarP_1,7.7 //
oṃ hrīṃ sarasvatyai namaḥ /
oṃ hrāṃ hṛdayāya namaḥ /
oṃ hrīṃ śirase namaḥ /
oṃ hrūṃ śikhāyai namaḥ /
oṃ hraiṃ kavacāya namaḥ /
oṃ hrauṃ netratrayāya namaḥ /
oṃ hraḥ astrāya namaḥ // GarP_1,7.8 //
śraddhā ṛddhiḥ kalā medhā tuṣṭiḥ puṣṭiḥ prabhā matiḥ /
oṃ hrīṅkārādyā namo 'ntāśca sarasvatyāśca śaktayaḥ // GarP_1,7.9 //
kṣetrapālāya namaḥ /
oṃ gurubhyo namaḥ /
oṃ paramagurubhyo namaḥ // GarP_1,7.10 //
padmasthāyāḥ sarasvatyā āsanādyaṃ prakalpayet /
sūryādīnāṃ svakairprantraiḥ pavitrārohaṇaṃ tathā // GarP_1,7.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sūryādīnāṃ sarasvatyāśca pūjanaṃ nāma saptamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 8
hariruvāca /
bhūmiṣṭhe maṇḍape snātvā maṇḍale viṣṇumarcayet /
pañcaraṅgikacūrṇena vajranābhaṃ tu maṇḍalam // GarP_1,8.1 //
ṣoḍaśaiḥ koṣṭhakaistatra saṃmitaṃ rudra? kārayet /
caturthapañcakoṇeṣu sūtrapātaṃ tu kārayet // GarP_1,8.2 //
koṇasūtrādubhayataḥ koṇā ye tatra saṃsthitāḥ /
teṣu caiva prakurvīta sūtrapātaṃ vicakṣaṇaḥ // GarP_1,8.3 //
tadanantarakoṇeṣu evameva hi kārayet /
prathamā nābhiruddiṣṭā madhye rekhāprasaṃgame // GarP_1,8.4 //
antareṣu ca sarveṣu aṣṭau caiva tunābhayaḥ /
pūrvamadhyamanābhi bhyāmathaṃ sūtraṃ tu bhrāmayet // GarP_1,8.5 //
antarā sa dvijaśreṣṭhaḥ pādonaṃ bhrāmayeddhara ! /
anena nābhisūtrasya karṇikāṃ bhrāmayecchiva ! // GarP_1,8.6 //
karṇikāyā dvibhāgena kesarāṇi vicakṣaṇaḥ /
tadagreṇa sadā vidvāndalānyeva samālikhet // GarP_1,8.7 //
sarveṣu nābhikṣetraṣu mānenānena suvrata ! /
padmāni tāni kurvīta deśikaḥ para mārthavit // GarP_1,8.8 //
ādisūtravibhāgena dvārāṇi parikalpayet /
dvāraśobhāṃ tathā tatra tadardhena tu kalpayet // GarP_1,8.9 //
karṇikāṃ pītavarṇena sitaraktādikesaraiḥ /
antaraṃ nīlavarṇena dalāni asitena ca // GarP_1,8.10 //
kṛṣṇavarṇena rajasā caturaśraṃ prapūrayet /
dvārāṇi śuklavarṇena rekhāḥ pañca ca maṇḍale // GarP_1,8.11 //
sitā raktā tathā pītā kṛṣṇā caiva yathākramam /
kṛtvaiva maṇḍalañcādau nyāsaṃ kṛtvārcayeddharim // GarP_1,8.12 //
hṛnmadhye tu nyasedviṣṇuṃ kaṇṭhe saṅkarṣaṇaṃ tathā /
pradyumnaṃ śirasi nyasya śikhāyāmaniruddhakam // GarP_1,8.13 //
brahmāṇaṃ sarvagātreṣu karayoḥ śrīdharaṃ tathā /
ahaṃ viṣṇuriti dhyātvā karṇikāyāṃ nyaseddharim // GarP_1,8.14 //
nyasetsaṅkarṣaṇaṃ pūrve pradyumnaṃ caiva dakṣiṇe /
aniruddhaṃ paścime ca brihmāṇaṃ cottare nyaset // GarP_1,8.15 //
śrīdharaṃ rudrakoṇeṣu indrādīndikṣu vinyaset /
tato 'bhyarcya ca gandhādyaiḥ prāpnuyātparamaṃ padam // GarP_1,8.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇupūjopayogivajranābhamaṇḍalanirūpaṇaṃ nāmāṣṭamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 9
hariruvāca /
samaye (yā) dīkṣitaḥ śiṣyo baddhanetrastu vāsasā /
aṣṭāhutiśataṃ tasya mūlamantreṇa homayet // GarP_1,9.1 //
dviguṇaṃ putrake homaṃ triguṇaṃ sādhake matam /
nirvāṇadeśike rudra ! caturguṇamudāhṛtam // GarP_1,9.2 //
guruviṣṇudvijastrīṇāṃ hantā badhyastva(śca)dīkṣitaiḥ /
atha dīkṣāṃ pravakṣyāmi dharmādharmakṣayaṅkarīm // GarP_1,9.3 //
upaveśya bahiḥ śiṣyāndhāraṇaṃ teṣu kārayet /
vāyavyā kalayā rudra śoṣyamāṇānvicintayet // GarP_1,9.4 //
āgreyyā dahyamānāṃśca plāvitānambhasā punaḥ /
tejastejāsi taṃ jīvamekīkṛtya samākṣipet // GarP_1,9.5 //
prāṇavaṃ cintayevdyomni śarīre 'nyattu kāraṇam /
ekaikaṃ yo jayettatra kṣetrajñaṃ dehakāraṇāt // GarP_1,9.6 //
utpādya yojayetpaścādekaikaṃ vṛṣabhadhvaja /
maṇḍalādiṣvaśaktastu kalpayitvār'cayeddharim // GarP_1,9.7 //
caturdvāraṃ bhavettacca brahmatīrthādanukramāt /
hastaṃ padmaṃ samākhyātaṃ patrāṇyaṅgulayaḥ smṛtāḥ // GarP_1,9.8 //
karṇikā talahastantu nakhānyasya tu kesarāḥ /
tatrārcayeddhariṃ dhyātvā sūryandvagnayantareva ca // GarP_1,9.9 //
taṃ hastaṃ pātayenmūrdhni śiṣyasya tu samāhitaḥ /
haste viṣṇuḥ sthito yasmādviṣṇuhastastatastvayam /
naśyanti sparśanāttasya pātakānyakhilāni ca // GarP_1,9.10 //
guruḥ śiṣyaṃ samabhyarcya netre baddhe tu vāsasā /
devasya pramukhaṃ kṛtvā puṣpamevārpayettataḥ /
puṣpaṃ nipatitaṃ yatra mūrdhno devasya śārṅgiṇaḥ // GarP_1,9.11 //
tannāma kārayettasya strīṇāṃ nāmāṅkitaṃ svayam /
śūdrāṇāṃ dāsasaṃyuktaṃ kārayettu vicakṣaṇaḥ // GarP_1,9.12 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇudīkṣānidṛ nāma navamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 10
hariruvāca /
r śyādipūjāṃ pravarśyāmi sthaṇḍilādiṣu siddhaye /
śrīṃ hrīṃ mahālakṣmyai namaḥ /
śrāṃ śrīṃ śrūṃ śraiṃ śrauṃ śraḥ kramāddhṛdayaṃ ca śiraḥ śikhām /
kavacaṃ netramastraṃ ca āsanaṃ mūrtimarcayet // GarP_1,10.1 //
maṇḍale padmagarbhe ca caturdvāri rajo 'nvite /
catuḥ ṣaṣṭyantamaṣṭādi khākṣe khākṣyādi maṇḍalam // GarP_1,10.2 //
khākṣīndusūryagaṃ sarvaṃ khādivedenduvartanāt /
lakṣmīmaṅgāni caikasminkoṇe durgāṃ gaṇaṃ gurum // GarP_1,10.3 //
kṣetrapālamathāgnyādau homāñjuhāva kāmabhāk /
oṃ ghaṃ ṭaṃ ḍaṃ haṃ śrīmahālakṣmyai namaḥ // GarP_1,10.4 //
anena pūjayellakṣmīṃ pūrvoktaparivārakaiḥ /
oṃ saiṃ sarasvatyai namaḥ /
oṃ hrīṃ saiṃ sarasvatyai namaḥ // GarP_1,10.5 //
oṃ hrīṃ vadavadavāgvādinisvāhā oṃ hrīṃ sarasvatyai namaḥ // GarP_1,10.6 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe lakṣmyarcananirūpaṇaṃ nāma daśamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 11
hariruvācaṃ /
navavyūhārcanaṃ vakṣye yaduktaṃ kaśyapāya hi /
jīvamutkṣipya mūrdhanyaṃ nābhyāṃ vyomniniveśayet // GarP_1,11.1 //
tatoramiti bījena dahedbhūtātmakaṃ vapuḥ /
yamityanena bījena tacca sarva vināśayet // GarP_1,11.2 //
lamityanena bījena plāvayetsacarācaram /
vamityanena bījena cintayedamṛtaṃ tataḥ // GarP_1,11.3 //
tato budvudamadhye tu pītavāsāścaturbhujaḥ /
ahaṃ matastathātmānaṃ dhyānena paricintayet // GarP_1,11.4 //
mantranyāsaṃ tataḥ kuryāttrividhaṃ karadehayoḥ /
dvādaśākṣarabījena uktabījairanantaram // GarP_1,11.5 //
ṣaḍaṅgena tataḥ kuryātsākṣādyena harirbhavet /
dakṣiṇāṅguṣṭhamārabhya madhyāṅguṣṭhandale nyaset // GarP_1,11.6 //
madhye bījadvayaṃ nyasya nyasedaṅge tataḥ punaḥ /
hṛcchirasi śikhāvarṃmavakkrākṣyudahapṛṣṭhataḥ // GarP_1,11.7 //
bāhvośca karayorjānvoḥ pādayoścāpi vinyaset /
padmākārau karau kṛtvā madhye 'ṅguṣṭhaṃ niveśayet // GarP_1,11.8 //
cintayettatra sarveśaṃ paraṃ tattvamanāmayam /
kramāccaitāni bījāni tarjanyādiṣu vinya set // GarP_1,11.9 //
tato mūrdhākṣivakkreṣu kaṇṭhe ca hṛdaye tathā /
nābhau guhye tathā jānvoḥ pādayorvinyasetkramāt // GarP_1,11.10 //
pāṇyoḥ ṣaḍaṅgabījāni nyasya kāye tato nyaset /
aṅguṣṭhādikaniṣṭhāntaṃ vinyasedvījapañcakam // GarP_1,11.11 //
karamadhye netrabījamaṅganyāsa'pyayaṃ kramaḥ /
hṛdaye hṛdayaṃ nyasya śiraḥ śirasi vinyaset // GarP_1,11.12 //
śikhāyāṃ tu śikhāṃ nyasya kavacaṃ sarvatastanau /
netraṃ netre vidhātavyamastrañca karayordvayoḥ // GarP_1,11.13 //
tenaiva ca diśo baddhā pūjā vidhimathācaret /
hṛdaye cintayetpūrvaṃ yogapīṭhaṃ samāhitaḥ // GarP_1,11.14 //
dharma jñanaṃ ca vairāgyamaiśvaryaṃ ca yathākramam /
āgneyādau ca pūrvādāvadharmādīṃśca vinyaset // GarP_1,11.15 //
ebhiḥ paricchannatanuṃ pīṭhabhūtaṃ tadātmakam /
anantaṃ vinsetpaścātpūrvakāyonnataṃ sthitam // GarP_1,11.16 //
tato vidyātsarojātaṃ dalāṣṭasamadigdalam /
sitābjaṃ śatapatrāḍhyaṃ viprakīrṇordhakarṇikam // GarP_1,11.17 //
dhyātvā vedādinā paścātsūryasomānalātmanām /
maṇḍalāni kramādevamuparyupari cintayet // GarP_1,11.18 //
tataḥ pūrvādidiksaṃsthāḥ śaktīḥ keśavagocarāḥ /
vimalādyā nyasedaṣṭau navamīṃ karṇikāgatām // GarP_1,11.19 //
evaṃ dhyātvā samabhyarcya yogapīṭhamanantaram /
manasāvāhya tatreśaṃ hariṃ śārṅgaṃ nyasetpunaḥ // GarP_1,11.20 //
hṛdayādīni pūrvādicaturdigdalayogataḥ /
madhye netraṃ tu koṇeṣu astramantraṃ nyasettataḥ // GarP_1,11.21 //
saṅkarṣaṇādibījāni pūrvādikramayogataḥ /
dvāri pūrve pare caiva vainateyaṃ tu vinyaset // GarP_1,11.22 //
sudarśanaṃ sahasrāraṃ dakṣiṇe dvāri vinyaset /
śriyaṃ dakṣiṇato nyasya lakṣmīmuttaratastathā // GarP_1,11.23 //
dvāryattare gadāṃ nyasya śaṅkhaṃ koṇeṣu vinyaset /
devadakṣiṇataḥ śārṅgaṃ vāme caiva sudhīrnyaset // GarP_1,11.24 //
tadvatkhaṅgaṃ tathā cakraṃ nyasetpārśvadvayordvayam /
tato 'ntarlokapālāṃśca svadigbhedena vinyaset // GarP_1,11.25 //
vajrādīnyāyudhānyeva tathaiva viniveśayet /
ūrghvaṃ brihma tathānantamadhaśca paricintayet // GarP_1,11.26 //
sarvaṃ dhyātveti saṃpūjya mudrāḥ sandarśayettataḥ /
añjaliḥ prathamā mudrā kṣipraṃ devaprasādhanī // GarP_1,11.27 //
vandanī hṛdayāsaktātsārdhaṃ dakṣiṇatonnatā /
ūrdhāṅguṇṭho vāmamuṣṭirdakṣiṇāṅguṣṭhabandhanaḥ // GarP_1,11.28 //
savyasya tasya cāṅguṣṭho yaḥ sa uddhaḥ prakīrtitaḥ /
tisraḥ sādhāraṇā hyetā mūrtibhedena kalpitāḥ // GarP_1,11.29 //
kaniṣṭhādipramokeṇa aṣṭau mudrā yathākramam /
aṣṭānāṃ pūrvabījānāṃ kramaśastvavadhārayet // GarP_1,11.30 //
aṅguṣṭhena kaniṣṭhāntaṃ nāmayitvāṅgulitrayam /
mudreyaṃ narasiṃhasya nyubjaṃ kṛtvā karadvayam // GarP_1,11.31 //
savyahastaṃ tathottānaṃ kṛtvordhaṃ bhrāmayecchanaiḥ /
navamīyaṃ smṛtā mudrā varāhābhimatā sadā // GarP_1,11.32 //
muṣṭidvayamathottānamṛjvaikaikena mocayet /
utkuñcayetsarvamuktā aṅgamudreyamucyate // GarP_1,11.33 //
muṣṭidvayamatho baddhā evamevānupūrvaśaḥ /
daśānāṃ lokapālānāṃ mudrāśca kramayogataḥ // GarP_1,11.34 //
suramādyaṃ dvitīyaṃ ca upāntyañcāntyameva ca /
vāsudevo balaḥ kāmo hyaniruddho yathākramam // GarP_1,11.35 //
praṇavastatsadityetad huṃ kṣaiṃ bhūriti mantrakāḥ /
nārāyaṇastathā brahmā viṣṇuḥ siṃho varāharāṭ // GarP_1,11.36 //
sitāruṇaharidrābhā nīlaśyāmallohitāḥ /
meghāgnimadupiṅgābhā varṇato navanāmakāḥ // GarP_1,11.37 //
kaṃ ṭaṃ paṃ śaṃ garutmānsyājjaṃ khaṃ vaṃ ca sudarśanam /
ṣaṃ caṃ phaṃ ṣaṃ gadādevī vaṃ laṃ maṃ kṣaṃ ca śaṅkhakam // GarP_1,11.38 //
ghaṃ ḍhaṃ bhaṃ haṃ bhavecchrīśca gaṃ jaṃ vaṃ śaṃ ca puṣṭikā /
ghaṃ vaṃ ca vanamālā syācchrī vatsaṃ daṃ saṃ bhavet // GarP_1,11.39 //
chaṃ ḍaṃ paṃ yaṃ kaustubhaḥ proktaścānanto hyahameva ca /
ityaṅgāniyathāyogaṃ devadevasya vai daśā // GarP_1,11.40 //
garuḍo 'mbujasaṃkāśo gadā caivāsitākṛtiḥ /
puṣṭiḥ śirīṣapuṣpābhā lakṣmīḥ kāñcanasannibhā // GarP_1,11.41 //
pūrṇacandranibhaḥ śaṅkhaḥ kaustubhastvaruṇadyutiḥ /
cakraṃ sūryasahasrābhaṃ śrīvatsaḥ kundasannibhaḥ // GarP_1,11.42 //
pañcavarṇanibhā mālā hyananto meghasannibhaḥ /
vidyudrūpāṇi cāstrāṇi yāni noktāni varṇataḥ // GarP_1,11.43 //
arghyapādyādi vai dadyātpuṇḍarīkākṣavidyayā // GarP_1,11.44 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe navavyūhārcanaṃ nāmaikādaśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 12
hariruvāca /
pūjānukramasiddhyarthaṃ pūjānukrama ucyate /
oṃ nama ityādau saṃsmṛtiḥ paramātmanaḥ // GarP_1,12.1 //
yaṃ raṃ vaṃ lamiti kāyaśuddhiḥ /
oṃ nama iti caturbhujātmanirmāṇam // GarP_1,12.2 //
tatastrividhaḥ karakāyanyāsaḥ /
tato tdṛdisthayogapīṭhapūjā /
oṃ anantāya namaḥ /
oṃ dharmāya namaḥ /
oṃ jñānāya namaḥ /
oṃ vairāgyāya namaḥ /
oṃ aiśvaryāya namaḥ /
oṃ adharṃmāya namaḥ /
oṃ ajñānāya namaḥ /
oṃ avairāgyāya namaḥ /
oṃ anaiśvaryāya namaḥ /
oṃ padmāya namaḥ /
oṃ ādityamaṇḍalāya namaḥ /
oṃ candramaṇḍalāya namaḥ /
oṃ vahnimaṇḍalāya namaḥ /
oṃ vimalāyai namaḥ /
oṃ utkarṣiṇyai namaḥ /
oṃ jñānāyai namaḥ /
oṃ kriyāyai namaḥ /
oṃ yogāyai namaḥ /
oṃ prahvyai namaḥ /
oṃ satyāyai namaḥ /
oṃ īśānāyai namaḥ /
oṃ sarvatomukhyai namaḥ /
oṃ saṃgopāṅgāya harerāsanāya namaḥ /
tataḥ karṇikāyām-aṃ vāsudevāya namaḥ /
āṃ hṛdayāya namaḥ /
īṃ śirase namaḥ /
ūṃ śikhāyai namaḥ /
aiṃ kavacāya namaḥ /
auṃ netratrayāya namaḥ /
aḥ phaṭ astrāya namaḥ /
āṃ saṅkarṣaṇāya namaḥ /
aṃ pradyumnāya namaḥ /
aḥ aniruddhāya namaḥ /
oṃ aḥ nārāyaṇāya namaḥ /
oṃ tatsabdahmaṇe namaḥ /
oṃ huṃ viṣṇave namaḥ /
kṣaiṃ narasiṃhāya bhūrvarāhya kaṃ vainateyāya jaṃ khaṃ vaṃ sudarśanāya khaṃ caṃ phaṃ ṣaṃ gadāyai vaṃ laṃ maṃ kṣaṃ pāñcajanyāya ghaṃ ḍhaṃ bhaṃ haṃ śriyai gaṃ ḍaṃ vaṃ śaṃ puṣṭyai dhaṃ vaṃ vanamālāyai daṃ śaṃ śrīvatsāya chaṃ ḍaṃ yaṃ kaustubhāya śaṃ śārṅgāya iṃ iṣudhibhyāṃ caṃ carmaṇe khaṃ khaḍgāya indrāya surāya partaye agnaye tejodhipatayeyamāyadharmādhipatayekṣaṃnairṛtāyarakṣodhipataye varuṇāya jalādhipataye yoṃ vāyave prāṇādhipataye dhāṃ dhanadāya dhanādhipataye hāṃ īśānāya vidyādhipataye oṃ vajrāya śaktyai oṃ daṇḍāya khaṅgāya oṃ pāśāya dhvajāya gadāyai triśūlāya laṃ anantāya pātālādhipataye khaṃ brahmaṇe sarvalokādhipataye oṃ namo bhagavate vāsudevāya namaḥ /
oṃ oṃ namaḥ /
oṃ naṃ namaḥ /
oṃ moṃ namaḥ /
oṃ oṃ bhaṃ namaḥ /
oṃ gaṃ namaḥ /
oṃ vaṃ namaḥ /
oṃ teṃ namaḥ /
oṃ vāṃ namaḥ /
oṃ suṃ namaḥ /
oṃ deṃ namaḥ /
oṃ vāṃ namaḥ /
oṃ yaṃ namaḥ /
oṃ oṃ namaḥ /
oṃ naṃ namaḥ /
oṃ moṃ namaḥ /
oṃ nāṃ namaḥ /
oṃ rāṃ namaḥ /
oṃ ṇāṃ namaḥ /
oṃ yaṃ namaḥ /
oṃ naṃnoṃ bhagavateṃ vāṃsuṃdevāyaṃ oṃ namo nārāyaṇāya namaḥ /
oṃ puruṣottamāya namaḥ // GarP_1,12.3 //
namaste puṇḍarīkākṣa namaste viśvabhāvana /
subrahmaṇya namaste 'stu mahāpuruṣa pūrvaja // GarP_1,12.4 //
homakarṇaṇi caiteṣāṃ svāhāntamupakalpayet /
evaṃ japtvā vidhānena śatamaṣṭottaraṃ tathā // GarP_1,12.5 //
arghaṃ dattvā jitaṃ tena praṇāmaṃ ca punaḥ punaḥ /
tato 'gnāvapi sampūjyaṃ taṃ yajeta yathāvidhi // GarP_1,12.6 //
devadevaṃ svabījena aṅgādibhirathācyutam /
pūrvamullikhya cābhyukṣya praṇavena tu mantravit // GarP_1,12.7 //
bhrāmayitvānalaṃ kuṇḍe pūjayecca śubhaiḥ phalaiḥ /
pūrvaṃ tatsakalaṃ dhyātvā maṇḍale manasā nyaset // GarP_1,12.8 //
vāsudevākhyatattvena hutvā cāṣṭottaraṃ śatam /
saṃkarṣaṇādibījena yajetṣaṭkaṃ tathaiva ca // GarP_1,12.9 //
trayantrayaṃ tathāṅgānāmekaikāndikpatīṃstathā /
pūrṇāhutiṃ tathaivānte dadyātsamyagupasthitaḥ // GarP_1,12.10 //
vāgatīte pare tattve ātmānaṃ ca layaṃ nayet /
upaviśya punarmudrāṃ darśayitvā nametpunaḥ // GarP_1,12.11 //
nityamevaṃvidhaṃ homaṃ naimitte dviguṇaṃ bhavet /
gacchagaccha paraṃ sthānaṃ yatra devo nirañjanaḥ // GarP_1,12.12 //
gacchantu devatāḥ sarvāḥ svasthānasthitihetave /
sudarśanaḥ śrīhariśca acyutaḥ sa trivikramaḥ // GarP_1,12.13 //
caturbhujo vāsudevaḥ ṣaṣṭhaḥ pradyumna eva ca /
saṃkarṣaṇaḥ pūruṣo 'tha navavyūho daśātmakaḥ // GarP_1,12.14 //
aniruddho dvādaśātmā atha ūrdhamanantakaḥ /
ete ekādibhiścakrairvijñeyā lakṣitāḥ surāḥ // GarP_1,12.15 //
cakrāṅkitaiḥ pūjitaḥ syāndrṛhe rakṣetsadānaraiḥ /
oṃ cakrāya svāhā,oṃ vicakrāya svāhā,oṃ sucakrāya svāhā,oṃ mahācakrāya svāhā,oṃ mahācakrāya asurāntakṛt huṃ phaṭ oṃ huṃ sahasrāra huṃ phaṭ // GarP_1,12.16 //
dvārakācakrapūjeyaṃ gṛhe rakṣākarī śubhā // GarP_1,12.17 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pūjānukramanirūpaṇaṃ nāma dvādaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 13
hariruvāca /
pravakṣyāmyadhunā hyetadvaiṣṇavaṃ pañjaraṃ śubham /
namonamaste movidaṃ cakraṃ gṛhya sudarśanam // GarP_1,13.1 //
prācyāṃ rakṣasva māṃ viṣṇo ! tvāmahaṃ śaraṇaṃ gataḥ /
gadāṃ kaumodakīṃ gṛhṇa padmanābha namo 'sta te // GarP_1,13.2 //
yāmyāṃ rakṣasva māṃ viṣṇo ! tvāmahaṃ śaraṇaṃ gataḥ /
halamādāya saunande namaste puruṣottama // GarP_1,13.3 //
pratīcyāṃ rakṣa māṃ viṣṇo ! tvāmaha śaraṇaṃ gataḥ /
musalaṃ śātanaṃ gṛhya puṇḍarīkākṣa rakṣa mām // GarP_1,13.4 //
uttarasyāṃ jagannātha ! bhavantaṃ śaraṇaṃ gataḥ /
khaḍgamādāya carṃmātha astraśāstrādikaṃ hare ! // GarP_1,13.5 //
namaste rakṣa rakṣoghna ! aiśānyāṃ śaraṇaṃ gataḥ /
pāñcajanyaṃ mahāśaṅkhamanughoṣyaṃ ca paṅkajam // GarP_1,13.6 //
pragṛhya rakṣa māṃ viṣṇo āgnyeyyāṃ rakṣa sūkara /
candrasūryaṃ samāgṛhya khaḍgaṃ cāndramasaṃ tathā // GarP_1,13.7 //
nairṛtyāṃ māṃ ca rakṣasva divyamūrte nṛkesarin /
vaijayantīṃ smapragṛhya śrīvatsaṃ kaṇṭhabhūṣaṇam // GarP_1,13.8 //
vāyavyāṃ rakṣa māṃ deva hayagrīva namo 'stu te /
vainateyaṃ samāruhya tvantarikṣe janārdana ! // GarP_1,13.9 //
māṃ rakṣasvājita sadā namaste 'stvaparājita /
viśālākṣaṃ samāruhya rakṣa māṃ tvaṃ rasātale // GarP_1,13.10 //
akūpāra namastubhyaṃ mahāmīna namo 'stu pte /
karaśīrṣādyaṅgulīṣu satya tvaṃ bāhupañjaram // GarP_1,13.11 //
kṛtvā rakṣasva māṃ viṣṇo namaste puruṣottama /
etaduktaṃ śaṅkarāya vaiṣṇavaṃ pañjaraṃ mahat // GarP_1,13.12 //
purā rakṣārthamīśānyāḥ kātyāyanyā vṛṣadhvaja /
nāśāyāmāsa sā yena cāmarānmahiṣāsuram // GarP_1,13.13 //
dānavaṃ raktabījaṃ ca anyāṃśca surakaṇṭakān /
etajjapannaro bhaktyā śatrūnvijayate sadā // GarP_1,13.14 //

iti śrīgāruḍe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇupañjarastotraṃ nāma trayodaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 14
hariruvāca /
atha yogaṃ pravakṣyāmi bhuktimuktikaraṃ param /
dhyāyibhiḥ procyate dhyeyo dhyānena harirīśvaraḥ // GarP_1,14.1 //
tacchṛṇuṣva maheśāna sarvapāpavināśanam /
viṣṇuḥ sarveśvaro 'nantaḥ ṣaḍbhirbhūparivarjitaḥ // GarP_1,14.2 //
vāsudevo jagannātho brahmātmāsmyahameva hi /
dehidehasthito nityaḥ sarvadehavivarjitaḥ // GarP_1,14.3 //
dehadharṃmavihīnaśca kṣarākṣaravivarjitaḥ /
ṣaḍvidheṣu sthito draṣṭā śrotā ghrātā hyatīndriyaḥ // GarP_1,14.4 //
taddharṃmarahitaḥ sraṣṭā nāmagotravivarjitaḥ /
mantā manaḥ sthito devo manasā parivarjitaḥ // GarP_1,14.5 //
manodharṃmavihīnaśca vijñānaṃ jñānameva ca /
boddhā buddhisthitaḥ sākṣī sarvajño buddhivarjitaḥ // GarP_1,14.6 //
buddhidharṃmavihīnaśca sarvaḥ sarvagato manaḥ /
sarvaprāṇivinirmuktaḥ prāṇadharṃmavivarjitaḥ // GarP_1,14.7 //
prāṇaprāṇo mahāśānto bhayena parivarjitaḥ /
ahaṅkārādihīnaśca taddharṃmaparivarjitaḥ // GarP_1,14.8 //
tatsākṣī tanniyantā ca paramānandarūpakaḥ /
jāgratsvapnasuṣuptisthastatsākṣī tadvivarjitaḥ // GarP_1,14.9 //
turīyaḥ paramo dhātā dṛgrūpo guṇavarjitaḥ /
mukto buddho 'jaro vyāpī satya ātmāsmyahaṃ śivaḥ // GarP_1,14.10 //
evaṃ ye mānavā vijñā dhyāyantīśaṃ paraṃ padam /
prāpnuyuste ca tadrūpaṃ nātra kāryā vicāraṇā // GarP_1,14.11 //
iti dhyānaṃ samākhyātaṃ tava śaṅkara suvrata /
paṭhedya etatsatataṃ viṣṇulokaṃ sa gacchati // GarP_1,14.12 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe dhyānayogo nāma caturdaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 15
rudra uvāca /
saṃsārasāgarāddhorāmucyate kiṃ japanprabho /
narastanme paraṃ japyaṃ pathaya tvaṃ janārdana // GarP_1,15.1 //
hariruvāca /
pareśvaraṃ paraṃ brahma paramātmānamavyayam /
viṣṇuṃ nāmasahasreṇa stuvanmukto bhavennaraḥ // GarP_1,15.2 //
yatpa vitraṃ paraṃ japyaṃ kathayāmi vṛṣadhvaja ! /
śṛṇuṣvāvahito bhūtvā sarvapāpavināśanam // GarP_1,15.3 //
oṃ vāsudevo mahāviṣṇurvāmano vāsavo vasuḥ /
bālacandra nibho bālo balabhadro balādhipaḥ // GarP_1,15.4 //
balibandhanakṛdvedhā (11)vareṇyo vedavitkiviḥ /
vedakartā vedarūpo vedyo vedapariplutaḥ // GarP_1,15.5 //
vedāṅgavettā vedeśo(20) balādhāro balārdanaḥ /
avikāro vareśaśca varuṇo varuṇādhipaḥ // GarP_1,15.6 //
vīrahā ca bṛhadvīro vanditaḥ parameśvaraḥ (30) /
ātmā ca paramātmā ca pratyagātmā viyatparaḥ // GarP_1,15.7 //
padmanābhaḥ padmanidhiḥ padmahasto gadādharaḥ /
paramaḥ (40)parabhūtaśca puruṣottama īśvaraḥ // GarP_1,15.8 //
padmajaṅghaḥ puṇḍarīkaḥ padmamālādharaḥ priyaḥ /
padmākṣaḥ padmagarbhaśca parjanyaḥ (50)padmasaṃsthitaḥ // GarP_1,15.9 //
apāraḥ paramārthaśca parāṇāṃ ca paraḥ prabhuḥ /
paṇḍitaḥ paṇḍiteḍyaśca pavitraḥ pāpamardakaḥ // GarP_1,15.10 //
śuddhaḥ (60)prakāśarūpaśca pavitraḥ parirakṣakaḥ /
pipāsāvarjitaḥ pādyaḥ puruṣaḥ prakṛtistathāḥ // GarP_1,15.11 //
pradhānaṃ pṛthivīpadmaṃ padmanābhaḥ (70)priyapradaḥ /
sarveśaḥ sarvagaḥ sarvaḥ sarvavitsarvadaḥ suraḥ // GarP_1,15.12 //
sarvasya jagato dhāma sarvadarśo ca sarvabhṛt (80) /
sarvānugrahakṛddevaḥ sarvabhūtahṛdi sthitaḥ // GarP_1,15.13 //
sarvapūjyaśca sarvādyaḥ sarvadevanamaskṛtaḥ /
sarvasya jagato mūlaṃ sakalo niṣkalo 'nalaḥ (90) // GarP_1,15.14 //
sarvagoptā sarvaniṣṭhaḥ sarvakāraṇakāraṇam /
sarvadhyeyaḥ sarvamitraḥ sarvadesvavarūpadhṛk // GarP_1,15.15 //
sarvādhyakṣaḥ surādhyakṣa surāsuranamaskṛtaḥ /
duṣṭānāṃ ca surāṇāṃ ca sarvadā ghātako 'ntakaḥ (101) // GarP_1,15.16 //
satyapālaśca sannābhaḥ siddheśaḥ siddhavanditaḥ /
siddhasādhyaḥ siddhasiddhaḥ sādhyasiddho (siddhisiddha) hṛdīśvaraḥ // GarP_1,15.17 //
śaraṇaṃ jagataścaiva (110)śreyaḥ kṣemastathaiva ca /
śubhakṛcchobhanaḥ saumyaḥ satyaḥ satyaparākramaḥ // GarP_1,15.18 //
satyasthaḥ satyasaṅkalpaḥ satyavitsatya (tpa) dastathā (121) /
dharmo dharṃmo ca karmo ca sarvakarṃmavivarjitaḥ // GarP_1,15.19 //
karṃmakartā ca karmaiva kriyā kāryaṃ tathaiva ca /
śrīpatirnṛpatiḥ (131)śrīmānsarvasya patirūrjitaḥ // GarP_1,15.20 //
sadevānāṃ patiścaiva vṛṣṇīnāṃ patirīḍitaḥ /
patirhiraṇyagarbhasya tripurāntapatistathā // GarP_1,15.21 //
paśūnāṃ ca patiḥ prāyo vasūnāṃ patireva ca (140) /
patirākhaṇḍalasyaiva varūṇasya patistathā // GarP_1,15.22 //
vanaspatīnāṃ ca patiranilasya patistathā /
analasya patiścaiva yamasya patireva ca // GarP_1,15.23 //
kuberasya patiścaiva nakṣatrāṇāṃ patistathā /
oṣadhīnāṃ patiścaiva vṛkṣāṇāṃ ca patistathā (150) // GarP_1,15.24 //
nāgānāṃ patirarkasya dakṣasya patireva ca /
suhṛdāṃ ca patiścaiva nṛpāṇāṃ ca patistathā // GarP_1,15.25 //
gandharvāṇāṃ patiścaiva asūnāṃ patiruttamaḥ /
parvatānāṃ patiścaiva nimnagānāṃ patistathā // GarP_1,15.26 //
surāṇāṃ ca patiḥ śreṣṭhaḥ (160) kapilasya patistathā /
latānāṃ ca patiścaiva vīrudhāṃ ca patistathā // GarP_1,15.27 //
munīnāṃ ca patiścaiva sūryasya patiruttamaḥ /
patiścandramasaḥ śreṣṭhaḥ sukrasya patireva ca // GarP_1,15.28 //
grahāṇāṃ ca patiścaiva rākṣasānāṃ patistathā /
kinnarāṇāṃ patiścaiva (170)dvijānāṃ patiruttamaḥ // GarP_1,15.29 //
saritāṃ ca patiścaiva samudrāṇāṃ patistathā /
sarasāṃ ca patiścaiva bhūtānāṃ ca patistathā // GarP_1,15.30 //
vetālānāṃ patiścaiva kūṣmāṇḍānāṃ patistathā /
pakṣiṇāṃ ca patiḥ śreṣṭhaḥ paśūnāṃ patireva ca // GarP_1,15.31 //
mahātmā (180)maṅgalo meyo mandaro mandareśvaraḥ /
merurmātā pramāṇaṃ ca mādhavo malavarjitaḥ // GarP_1,15.32 //
mālādharo (190)mahādevo mahādevena pūjitaḥ /
mahāśānto mahābhāgo madhusūdana eva ca // GarP_1,15.33 //
mahāvīryo mahāprāṇo mārkaṇḍeyarṣivanditaḥ(200) /
māyātmā māyayā baddho māyayā tu vivarjitaḥ // GarP_1,15.34 //
munistuto munirmaitro (210)mahānā (rā) so mahāhanuḥ /
mahābāhurmahādānto maraṇena vivarjitaḥ // GarP_1,15.35 //
mahāvatkkro mahātmā ca mahākāyo mahodaraḥ /
mahāpādo mahāgrīvo mahāmānī mahāmanāḥ // GarP_1,15.36 //
mahāgatirmaṃhākīrtirmahārūpo (222)mahāsuraḥ /
madhuśca mādhavaścaiva mahādevo maheśvaraḥ // GarP_1,15.37 //
makhejyo makharūpī ca mānanīyo (230)makheśvaraḥ /
mahāvāto mahābhāgo maheśo 'tītamānuṣaḥ // GarP_1,15.38 //
mānavaśca manuścaiva mānavānāṃ priyaṅkaraḥ /
mṛgaśca mṛgapūjyaśca (240)mṛgāṇāṃ ca patistathā // GarP_1,15.39 //
budhasya ca patiścaiva patiścaiva bṛhaspateḥ /
patiḥ śanaiścarasyaiva rāhoḥ ketoḥ patistathā // GarP_1,15.40 //
lakṣmaṇo lakṣaṇaścaiva lambauṣṭho lalitastathā(250) /
nānālaṅkārasaṃyukto nānācandanacarcitaḥ // GarP_1,15.41 //
nānārasojjavaladvakkro nānāpuṣpopaśobhitaḥ /
rāmo ramāpatiścaiva sabhāryaḥ parameśvaraḥ // GarP_1,15.42 //
ratnado ratnahartā ca(260)rūpī rūpavivarjitaḥ /
mahārūpograrūpaśca saumyarūpastathaiva ca // GarP_1,15.43 //
nīlameghanibhaḥ śuddhaḥ sālameghanibhastathā /
dhūmavarṇaḥ pativarṇo nānārūpo(270)hyavarṇakaḥ // GarP_1,15.44 //
virūpo rūpadaścaiva śuklavarṇastathaiva ca /
sarvavarṇo mahāyogī yajño (yājyo) yajñakṛdeva ca // GarP_1,15.45 //
suvarṇavarṇavāṃścaiva suvarṇākhyastathaiva ca (280)suvarṇāvayavaścaiva suvarṇaḥ svarṇamekhalaḥ // GarP_1,15.46 //
suvarṇasya pradātā ca suvarṇeśastathaiva ca /
suvarṇasya priyaścaiva (290)suvarṇāḍhyastathaiva ca // GarP_1,15.47 //
suparṇo ca mahāparṇo suparṇasya ca kāraṇ(290) /
vainateyastathāditya ādirādikaraḥ śivaḥ // GarP_1,15.48 //
kāraṇaṃ mahataścaiva pradhānasya ca kāraṇam /
buddhīnāṃ kāraṇaṃ caiva kāraṇaṃ manasastathā // GarP_1,15.49 //
kāraṇaṃ caitasaścaiva(300)ahaṅkārasya kāraṇam /
bhūtānāṃ kāraṇaṃ tadvatkāraṇaṃ ca vibhāvasoḥ // GarP_1,15.50 //
ākāśakāraṇaṃ tadvatpṛthivyāḥ kāraṇaṃ param /
aṇḍasya kāraṇaṃ caiva prakṛteḥ kāraṇaṃ tathā // GarP_1,15.51 //
dehasya kāraṇaṃ caiva cakṣuṣaścaiva kāraṇam /
śrotrasya kāraṇaṃ(310) tadvatkāraṇaṃ ca tvacastathā // GarP_1,15.52 //
jihvāyāḥ kāraṇaṃ caiva prāṇasyaiva ca kāraṇam /
hastayoḥ kāraṇaṃ tadvatpādayoḥ kāraṇaṃ tathā // GarP_1,15.53 //
vācaścakāraṇaṃ tadvatpāyoścaiva tukāraṇam /
indrasya kāraṇaṃ caiva kuberasya ca kāraṇam // GarP_1,15.54 //
yamasya kāraṇaṃ caiva (320)īśānasya ca kāraṇam /
yakṣāṇāṃ kāraṇaṃ caiva rakṣasāṃ kāraṇaṃ param // GarP_1,15.55 //
nṛpāṇāṃ kāraṇaṃ śreṣṭhaṃ dharṃmasyaiva tu kāraṇam /
jantūnāṃ kāraṇaṃ caiva vasūnāṃ kāraṇaṃ param // GarP_1,15.56 //
manūnāṃ kāraṇaṃ caiva pakṣiṇāṃ kāraṇaṃ param /
munīnāṃ kāraṇaṃ śreṣṭha(330)yogināṃ kāraṇaṃ param // GarP_1,15.57 //
siddhānāṃ kāraṇaṃ caiva yakṣāṇāṃ kāraṇaṃ param /
kāraṇaṃ kinnarāṇāṃ ca(340) gandharvāṇāṃ ca kāraṇam // GarP_1,15.58 //
nadānāṃ kāraṇaṃ caiva nadīnāṃ kāraṇaṃ param /
kāraṇaṃ ca samudrāṇāṃ vṛkṣāṇāṃ kāraṇaṃ tathā // GarP_1,15.59 //
kāraṇaṃ vīrudhāṃ caiva lokānāṃ kāraṇaṃ tathā /
pātāla kāraṇaṃ caiva devānāṃ kāraṇaṃ tathā // GarP_1,15.60 //
sarpāṇāṃ kāraṇaṃ caiva(350)śreyasāṃ kāraṇaṃ tathā /
pūśanāṃ kāraṇaṃ caiva sarveṣāṃ kāraṇaṃ tathā // GarP_1,15.61 //
dehātmā cendriyātmā ca ātmā buddhistathaiva ca /
manasaśca tathaivātmā cātmāhaṅkāracetasaḥ // GarP_1,15.62 //
jāgrataḥ svapataścātmā (360)mahadātmā parastathā /
pradhānasya parātmā ca ākāśātmā hyapāṃ tathā // GarP_1,15.63 //
pṛthivyāḥ paramātmā ca rasasyātmā tathaiva ca /
gandhasya paramātmā ca rūpasyātmā parastathā // GarP_1,15.64 //
śabdātmā caiva (370)vāgātmā sparśātmā puruṣastathā /
śrotrātmā ca tvagātmā ca jihvāyāḥ paramastathā // GarP_1,15.65 //
ghrāṇātmā caiva hastātmā pādātmā paramastathā(380) /
upasthasya tathaivātmā pāyvātmā paramastathā // GarP_1,15.66 //
indrātmā caiva brahmātmā rudrā(śāntā)tmā ca manostathā /
dakṣaprajāpaterātmā satyā (sraṣṭā)tmā paramastathā // GarP_1,15.67 //
īśātmā(390)paramātmā ca raudrātmā mokṣavidyatiḥ /
yatnavāṃśca tathā yatnaścarṃmo khaḍgī murāntakaḥ // GarP_1,15.68 //
hrīpravartanaśīlaśca yatīnāṃ ca hite rataḥ /
yatirūpī ca (400)yogī ca yogidhyeyo hariḥ śitiḥ // GarP_1,15.69 //
saṃvinmedhā ca kālaśca ūṣmā varṣā ma(na) tistathā(410) /
saṃvatsaro mokṣakaro mohapradhvaṃsakastathā // GarP_1,15.70 //
mohakartā ca duṣṭānāṃ māṇḍavyo vaḍavāmukhaḥ /
saṃvartaḥ kālakartā ca gautamo bhṛguraṅgirāḥ (420) // GarP_1,15.71 //
atnirvasiṣṭhaḥ pulahaḥ pulastyaḥ kutsa eva ca /
yājñavalkyo devalaśca vyāsaścaiva parāśaraḥ // GarP_1,15.72 //
śarṃmadaścaiva(430) gāṅgeyo hṛṣīkeśo bṛhacchravāḥ /
keśavaḥ kleśahantā ca sukarṇaḥ karṇavarjitaḥ // GarP_1,15.73 //
nārāyaṇo mahābhāgaḥ prāṇasya patireva ca (440) /
apānasya patiścaiva vyānasya patireva ca // GarP_1,15.74 //
udānasya patiḥ śreṣṭhaḥ samānasya patistathā /
śabdasya ca patiḥ śreṣṭhaḥ sparśasya patireva ca // GarP_1,15.75 //
rūpāṇāṃ ca patiścādyaḥ khaṅgapāṇir halāyudhaḥ(450) /
cakrapāṇiḥ kuṇḍalī ca śrīvatsāṃkastathaiva ca // GarP_1,15.76 //
prakṛtiḥ kaustubhagrīvaḥ pītāmbaradharastathā /
sumukho durmukhaścaiva munakhena tu vivarjitaḥ // GarP_1,15.77 //
ananto 'nantarūpaśca(461)sunakhaḥ suramandaraḥ /
sukapolo vibhurjiṣṇurbhrājiṣṇuścaiṣudhīstathā // GarP_1,15.78 //
hiraṇyakaśiporhantā hiraṇyākṣavimardakaḥ (470) /
nihantā pūtanāyāśca bhāskarāntavināśanaḥ // GarP_1,15.79 //
keśino dalanaścaiva muṣṭikasya vimardakaḥ /
kaṃsadānavabhettā ca cāṇūrasya pramardakaḥ // GarP_1,15.80 //
ariṣṭasya nihantā ca akrūrapriya eva ca /
akrūraḥ krūrarūpaśca(480)akrūrapriyavanditaḥ // GarP_1,15.81 //
bhagahā bhagavān bhānustathā bhāgavataḥ svagavataḥ svayam /
uddhavaścoddhavasyeśo hyuddhevana vicintitaḥ // GarP_1,15.82 //
cakradhṛk cañcalaścaiva(490) calācalavivarjitaḥ /
ahaṃ kāropamāścittaṃ gaganaṃ pṛthivī jalam // GarP_1,15.83 //
vāyuścakṣustathā śrotraṃ(500)jihvā ca ghrāṇameva ca /
vākpāṇipādajavanaḥ pāyūpasthastathaiva ca // GarP_1,15.84 //
śaṅkaraścaiva sarvaśca kṣāntidaḥ kṣāntikṛnnaraḥ (511) /
bhaktapriyastatā bhartā bhaktimān bhaktivardhanaḥ // GarP_1,15.85 //
bhaktastuto bhaktaparaḥ kīrtidaḥ kīrtivardhanaḥ /
kīrtirdeptiḥ (520) kṣamākāntirbhaktaścaiva (530) dayā parā // GarP_1,15.86 //
dānaṃ dātā ca kartā ca devadevapriyaḥ śuciḥ /
śucimā nsukhado (531)mokṣaḥ kāmaścārthaḥ sahasrapāt // GarP_1,15.87 //
sahasraśīrṣā vaidyaśca mokṣadvāraṃ tathaiva ca /
prajādvāraṃ sahasrākṣaḥ sahasrakara eva ca(540) // GarP_1,15.88 //
śukraśca sukirīṭī ca sugrīvaḥ kaustubhastathā /
pradyumnaścāniruddhaśca hayagrīvaśca sūkaraḥ // GarP_1,15.89 //
matsyaḥ paraśurāmaśca(550)prahrādo balirevaca /
śaraṇyaścaiva nityaśca buddho muktaḥ śarīrabhṛt // GarP_1,15.90 //
kharadūṣaṇahantā ca rāvaṇasya pramardanaḥ /
sītāpatiśca (560)vardhiṣṇurbharataśca tathaiva ca // GarP_1,15.91 //
kumbhendrajinnihantā ca kumbhakarṇapramardanaḥ /
narāntakāntakaścaiva devāntakavināśanaḥ // GarP_1,15.92 //
duṣṭāsuranihantā ca śambarāristathaiva ca /
narakasya nihantā ca triśīrṣasya vināśanaḥ (570) // GarP_1,15.93 //
yamalārjanabhettā ca tapohitakarastathā /
vāditraṃ caiva vādyaṃ ca buddhaścaiva varapradaḥ // GarP_1,15.94 //
sāraḥ sārapriyaḥ sauraḥ kālahantṛnikṛntanaḥ(580) /
agastyo devalaścaiva nārado nāradapriyaḥ // GarP_1,15.95 //
prāṇo 'pānastathā vyāno rajaḥ sattvaṃ tamaḥ (590)śarat /
udānaśca samānaśca bheṣajaṃ ca bhiṣak tathā // GarP_1,15.96 //
kūṭasthaḥ svaccharūpaśca sarvadehavivarjitaḥ /
cakṣurindriyahīnaśca vāgindriyavivarjitaḥ(600) // GarP_1,15.97 //
hastendriyavihīnaśca pādābhyāṃ ca vivarjitaḥ /
pāyūpasthavihīnaśca marutāpavivarjitaḥ // GarP_1,15.98 //
prabodhena vihīnaśca buddhyā caiva vi varjitaḥ /
cetasā vigataścaiva prāṇena ca vivarjitaḥ // GarP_1,15.99 //
apānena vihīnaśca vyānena ca vivarjitaḥ(610) /
udānena vihīnaśca samānena vivarjitaḥ // GarP_1,15.100 //
ākāśena vihīnaśca vāyunā parivarjitaḥ /
agninā ca vihīnaśca udakena vivarjitaḥ // GarP_1,15.101 //
pṛthivyā ca vihīnaśca śabdena ca vivarjitaḥ /
sparśena ca vihīnaśca sarvarūpavivarjitaḥ(620) // GarP_1,15.102 //
rāgeṇa vigataścaiva aghena parivarjitaḥ /
śokena rahitaścaiva vacasā parivarjitaḥ // GarP_1,15.103 //
rajo vivarjitaścaiva vikāraiḥ ṣaḍbhireva ca /
kāmena varjitaścaiva krodhena parivarjitaḥ // GarP_1,15.104 //
lobhena vigataścaiva dambhena ca vivarjitaḥ /
sūkṣmaścaiva (630)susūkṣmaśca sthūlātsthūlatarastathā // GarP_1,15.105 //
viśārado balādhyakṣaḥ sarvasya kṣobhakastathā /
prakṛteḥ kṣobhakaścaiva mahataḥ kṣobhakastathā // GarP_1,15.106 //
bhūtānāṃ kṣobhakaścaiva buddheśca kṣomakastathā /
indriyāṇāṃ kṣobhakaśca(640)viṣayakṣobhakastathā // GarP_1,15.107 //
brahmaṇaḥ kṣobhakaścaiva rudrasya kṣobhakastathā /
agamyaścakṣurādeśca śrotrāgamyastathaiva ca // GarP_1,15.108 //
tvacā na gamyaḥ kūrṃmaśca jihvāgrāhyastathaiva ca /
grāṇondriyāgamya eva vācāgrāhyastathaiva ca (650) // GarP_1,15.109 //
agamyaścaiva pāṇibhyāṃ padāgamyastathaiva ca /
agrāhyo manasaścaiva buddhyāgrāhyo haristathā // GarP_1,15.110 //
ahaṃ buddhyā tathā grāhyaścetasā grāhyā eva ca /
śaṅkhapāṇiścāvyayaśca gadāpāṇistathaiva ca (660) // GarP_1,15.111 //
śārṅgapāṇiśca kṛṣṇaśca jñānamūrtiḥ parantapaḥ /
tapasvī jñānagamyo hi jñānī jñānavideva ca // GarP_1,15.112 //
jñeyaśca jñeyahīnaśca (670) jñaptiścaitanyarūpakaḥ /
bhāvo bhāvyo bhavakaro bhāvano bhavanāśanaḥ // GarP_1,15.113 //
go vindo gopatirgopaḥ(680)sarvagopīsukhapradaḥ /
gopālo gogatiścaiva gomatirgodharastathā // GarP_1,15.114 //
upendraśca nṛsiṃhaśca śauriścaiva janārdanaḥ /
āraṇeyo(690) bṛhadbhānurbṛhaddīptistathaiva ca // GarP_1,15.115 //
dāmodarastnikālaśca kālajñaḥ kālavarjitaḥ /
trisandhyo dvāparaṃ tretā prajādvāraṃ(700)trivikramaḥ // GarP_1,15.116 //
vikramo daṇḍa(ra) hastaśca hyekadaṇḍī tridaṇḍadhṛk /
sāmabhedastathopāyaḥ sāmarūpī ca sāmagaḥ // GarP_1,15.117 //
sāmavedoḥ(710)hyatharvaśca sukṛtaḥ sutarūpaṇaḥ /
atharvavedaviccaiva hyatharvācārya eva ca // GarP_1,15.118 //
ṛgrūpī caiva ṛgveda ṛgvedeṣu pratiṣṭhitaḥ /
yajurvedo(720)yajurvedavidekapāt // GarP_1,15.119 //
bahupācca supāccaiva tathaiva ca sahasrapāt /
catuṣpācca dvipāccaiva smṛtirnyāyo yamo balī(730) // GarP_1,15.120 //
sannyāsī cai sannayāsaścaturāśrama eva ca /
brahmacārī gṛhasthaśca vānaprasthaśca bhikṣukaḥ // GarP_1,15.121 //
brāhmaṇaḥ kṣatriyo vaiśyaḥ (740)śūdro varṇastathaiva ca /
śīladaḥ śīlasampanno duḥ śīlaparivarjitaḥ // GarP_1,15.122 //
mokṣo 'dhyātmasamāviṣṭaḥ stutiḥ stotā ca pūjakaḥ /
pūjyo(750)vāk karaṇaṃ caiva vācyaṃ caiva tu vācakaḥ // GarP_1,15.123 //
vettā vyākaraṇaṃ caiva vākyaṃ caiva ca vākyavit /
vākyagamyastīrthavāsī(760) tīrthastīrtho ca tīrthavit // GarP_1,15.124 //
tīrthādibhūtaḥ sāṃkhyaśca niruktaṃ tvadhidaivatam /
praṇavaḥ praṇaveśaśca praṇavena pravanditaḥ(770) // GarP_1,15.125 //
praṇavena ca lakṣyo vai gāyatrī ca gadādharaḥ /
śālagrāmanivāsī ca (780)śālagrāmastathaiva ca // GarP_1,15.126 //
jalaśāyī yogaśāyī śeṣaśāyī kuśeśayaḥ /
mahībhartā ca (790) kāryaṃ ca kāraṇaṃ pṛthivīdharaḥ // GarP_1,15.127 //
prajāpatiḥ śāśvataśca kāmyaḥ kāmayitā virāṭ /
samrāṭ pūṣā(800) tathā svargo rathasthaḥ sārathirbalam // GarP_1,15.128 //
dhanī dhanaprado dhanyo yādavānāṃ hite rataḥ /
arjunasya priyaścaiva hyarjuno(810)bhīma eva ca // GarP_1,15.129 //
parākramo durviṣahaḥ sarvaśāstraviśāradaḥ /
sārasvato mahābhīṣmaḥ pārijātaharastathā // GarP_1,15.130 //
amṛtasya pradātā ca kṣīrodaḥ kṣīrameva ca (820) /
indrātmajastasya goptā govardhanadharastathā // GarP_1,15.131 //
kaṃsasya nāśanastadvaddhastipo hastināśanaḥ /
śipiviṣṭaḥ prasannaśca sarvalokārtināśanaḥ // GarP_1,15.132 //
mudro(830)mudrā karaścaiva sarvamudrāvivarjitaḥ /
dehī dehasthitaścaiva dehasya ca niyāmakaḥ // GarP_1,15.133 //
śrotrā śrotraniyantā ca śrotavyaḥ śravaṇaṃ tathā /
tvaksthitaśca(840)sparśayitvā spṛśyaṃ ca sparśanaṃ tathā // GarP_1,15.134 //
rūpadraṣṭā ca cakṣuḥ stho niyantā cakṣuṣastathā /
dṛśyaṃ caivatu jihvāstho rasajñaśca niyāmakaḥ (850) // GarP_1,15.135 //
ghrāṇastho ghrāṇakṛd ghrātā ghrāṇendriyaniyāmakaḥ /
vākstho vaktā ca vaktavyo vacanaṃ vāṅniyāmakaḥ // GarP_1,15.136 //
prāṇisthaḥ (860)śilpa kṛcchilpo hastayośca niyāmakaḥ /
padavyaścaiva gantā ca gantavyaṃ gamanaṃ tathā // GarP_1,15.137 //
niyantā pādayoścaiva pādyabhākca visargakṛt(870) /
visargasya niyantā ca hyupasthasthaḥ sukhaṃ tathā // GarP_1,15.138 //
upasthasya niyantā ca tadānandakaraśca ha /
śatrughnaḥ kārtavīryaśca dattātreyastathaiva ca // GarP_1,15.139 //
alarkasya hitaścaiva kārtavīryanikṛntanaḥ (880) /
kālanemirmahānemirmegho meghapatistathā // GarP_1,15.140 //
annaprado 'nnarūpī ca hyannādo 'nnapravartakaḥ /
dhūmakṛddhūmarūpaśca(890) devakīputra uttamaḥ // GarP_1,15.141 //
devakyānandano nando rohiṇyāḥ priya eva ca /
vasudevapriyaścaiva vasudevasutastathā // GarP_1,15.142 //
dundubhirhāsarūpaśca puṣpahāsastathaiva ca (900) /
aṭṭahāsapriyaścaiva sarvādhyakṣaḥ kṣaro 'kṣaraḥ // GarP_1,15.143 //
acyutaścaiva satyeśaḥ satyāyāśca priyo varaḥ /
rukmiṇyāśca patiścaiva rukmiṇyā vallabhastathā // GarP_1,15.144 //
gopīnāṃ vallabhaścaiva(910)puṇyaślokaśca viśrutaḥ /
vṛṣākapiryamo guhyo makulaśca budhastathā // GarP_1,15.145 //
rāhuḥ keturgraho grāho(920) gajendramukhamelakaḥ /
grāhasya vinihantā ca grāmī rakṣakastathā // GarP_1,15.146 //
kinnaraścaiva siddhaśca chandaḥ svacchanda eva ca /
viśvarūpo viśālākṣo(930) daityasūdana eva ca // GarP_1,15.147 //
anantarūpo bhūtastho devadānavasaṃsthitaḥ /
suṣuptisthaḥ suṣuptiśca sthānaṃ sthānānta eva ca // GarP_1,15.148 //
jagatsthaścaiva jāgartā sthānaṃ jāgaritaṃ tathā (940) /
svaprasthaḥ svapravitsvapnasthānaṃ svapnastathaiva ca // GarP_1,15.149 //
jāgratsvapnasuṣuptaiśca vihīno vai caturthakaḥ /
vijñānaṃ vedyarūpaṃ ca jīvo jīvayitā tathā (950) // GarP_1,15.150 //
bhuvanādhipatiścaiva bhuvanānāṃ niyāmakaḥ /
pātālavāsī pātālaṃ sarvajvaravināśanaḥ // GarP_1,15.151 //
paramānandarūpī ca dharṃmāṇāṃ ca pravartakaḥ /
sulabho durlabhaścaiva prāṇāyāmaparastathā(960) // GarP_1,15.152 //
pratyāhāro dhārakaśca pratyāhārakarastathā /
prabhā kāntistathā hyarciḥ śuddhasphaṭikasannibhaḥ // GarP_1,15.153 //
agrāhaścaiva gauraśca sarvaḥ(970)śucirabhiṣṭutaḥ /
vaṣaṭkāro vaṣaḍ vauṣaṭ svadhā svāhā ratistathā // GarP_1,15.154 //
paktā nandayitā(980)bhoktā boddhā bhāvayitā tathā /
jñānātmā caiva dehātmā bhū(u) mā sarveśvareśvaraḥ // GarP_1,15.155 //
nadī nandī ca nandīśo(990)bhāratastarunāśanaḥ /
cakrapaḥ śrīpatiścaiva nṛpāṇāṃ cakravartinām // GarP_1,15.156 //
īśaśca sarvadevānāṃ dvārakāsaṃsthitastathā /
puṣkaraḥ puṣkarādhyakṣaḥ puṣkaradvīpa eva ca (1000) // GarP_1,15.157 //
bharato janako janyaḥ sarvākāravi varjitaḥ /
nirākāro nirnimitto nirātaṅko nirāśrayaḥ (1008) // GarP_1,15.158 //
iti nāmasahasraṃ te vṛṣabhadhvaja kīrtitam /
devasya viṣṇorīśaśya sarvapāpavināśanam // GarP_1,15.159 //
paṭhandvijaśca viṣṇutvaṃ kṣatriyo jayamāpnuyāt /
vaiśyo dhanaṃ sukhaṃ śūdro viṣṇubhaktisamanvitaḥ // GarP_1,15.160 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śrīviṣṇusahasranāmastotranirūpaṇaṃ nāma pañcadaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 16
rudra uvāca /
punardhyānaṃ samācakṣva śaṅkhacakragadādhara /
viṣṇorīśasya devasya śuddhasya paramātmanaḥ // GarP_1,16.1 //
hariruvāca /
śṛṇu rudra ! harerdhyānaṃ saṃsāratarunāśanam /
dṛśirūpamanantaṃ ca sarvavyāpyajamavyayam // GarP_1,16.2 //
akṣaraṃ sarvagaṃ nityaṃ mahabdrahmāsti kevalam /
sarvasya jagato mūlaṃ sarvagaṃ parameśavaram // GarP_1,16.3 //
sarvabhūtahṛdisthaṃ vai sarvabhūtamaheśvaram /
sarvādhāraṃ nirādhāraṃ sarvakāraṇakāraṇam // GarP_1,16.4 //
alepakaṃ tathā muktaṃ muktayogivicititam /
sthūladehavihīnaṃ ca cakṣuṣā parivarjitam // GarP_1,16.5 //
vāgindriyavihīnaṃ ca prāṇidharṃmavivarjitam /
pādendriyavihīnaṃ ca vāgdharmaparivarjitam /
pāyūpasthavihīnaṃ ca sarvaiṃndriya vivarjitam // GarP_1,16.6 //
manovirahitaṃ tadvanmanodharṃmavivarjitam /
buddhyā vihīnaṃ deveśaṃ cetasā parivarjitam // GarP_1,16.7 //
ahaṅkāravihīnaṃ vai buddhidharṃmavivarjitam /
prāṇena rahitaṃ caiva hyapānena vivarjitam // GarP_1,16.8 //
vyānākhyavāyuhīnaṃ vai prāṇadharṃmavivarjitam /
hariruvāca /
punaḥ sūryarcanaṃ vakṣye yaduktaṃ bhṛgave purā // GarP_1,16.9 //
oṃ khakholkāya namaḥ /
sūryasya mūlamantro 'yaṃ bhuktimuktipradāyakaḥ // GarP_1,16.10 //
oṃ khakholkāya tridaśāya namaḥ /
oṃ vici ṭhaṭha śirase namaḥ /
oṃ jñānine ṭhaṭha śikhāyai namaḥ /
oṃ sahasraraśmaye ṭhaṭha kavacāya namaḥ // GarP_1,16.11 //
oṃ sarvatejo 'dhipataye ṭhaṭha astrāya namaḥ /
oṃ jvalajvala prajvalaprajvala ṭhaṭha namaḥ // GarP_1,16.12 //
agniprākāramantro 'yaṃ sūryasyāghavināśanaḥ /
oṃ ādityāya vidmahe,viśvabhā vāya dhīmahi, tannaḥ sūrya pracodayāt // GarP_1,16.13 //
sakalīkaraṇaṃ kuryādrāyatryā bhāskarasya ca /
dharṃmātmane ca pūrvasminyamā yeti ca dakṣiṇe // GarP_1,16.14 //
daṇḍanāyakāya tato daivatāyeti cottare /
śyāmapiṅgalamaiśānyāmāgneyyāṃ dīkṣitaṃ yajet // GarP_1,16.15 //
vajrapāṇiṃ ca nairṛtyāṃ bhūrbhuvaḥsvaśca vāyave /
oṃ candrāya nakṣatrādhipataye namaḥ /
oṃ aṅgārakāya kṣitisutāya namaḥ /
oṃ budhāya somasutāya namaḥ /
oṃ vāgīśvarāya sarvavidyādhipataye namaḥ /
oṃ śukrāya maharṣaye bhṛgusutāya namaḥ /
oṃ śanaiścarāya sūryātmajāya namaḥ /
oṃ rāhave namaḥ /
oṃ ketave namaḥ // GarP_1,16.16 //
pūrvādīśānaparyantā ete pūjyā vṛṣadhvaja /
oṃ anūkāya namaḥ /
oṃ prathamanāthāya namaḥ /
oṃ buddhāya namaḥ // GarP_1,16.17 //
oṃ bhagavannaparimitamayūkhamālin ! sakalajagatpate ! saptāśvavāhana ! caturbhuja ! paramasiddhiprada ! visphuliṅgapiṅgala ! tata ehyehi idamarghyaṃ mama śirasi gataṃ gṛhṇagṛhṇa tejograrūpam anagna ! jvalajvala ṭhaṭha namaḥ // GarP_1,16.18 //
anenāvāhya mantreṇa tataḥ sūryaṃ visarjayet /
oṃ namo bhagavate ādityāya sahasra kiraṇāya gaccha sukhaṃ punarāgamanāyeti // GarP_1,16.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe haridhyānasūryārcanayornirūpaṇaṃ nāma ṣoḍaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 17
hariruvāca /
punaḥ sūryārcanaṃ vakṣye yaduktaṃ dhanadāya hi /
aṣṭapatraṃ likhetpadmaṃ śucau deśe sakarṇikam // GarP_1,17.1 //
āvāhanīṃ tato baddhā mudrāmāvāhayedravim /
khakholkaṃ sthāpya mudrāṃ tu sthāpayenmantrarūpiṇīm // GarP_1,17.2 //
āgneyyāṃ diśi devasya hṛdayaṃ sthāpayecchiva ! /
aiśānyāṃ tu śiraḥ sthāpyaṃ nairṛtyāṃ vinyasecchikhām // GarP_1,17.3 //
paurandaryāṃ nyaseddharṃmamekāgrasthitamānasaḥ /
vāyavyāṃ caiva netraṃ tu vāruṇyāmastrameva ca // GarP_1,17.4 //
aiśānyāṃ sthāpayetsomaṃ paurandaryāṃ tu lohitam /
āgneyyāṃ somatanayaṃ yāmyāṃ caiva bṛhaspatim // GarP_1,17.5 //
nairṛtyāṃ dānavaguruṃ vāruṇyāṃ tu śanaiścaram /
vāyavyāṃ ca tathā ketuṃ kauberyāṃ rāhumeva ca // GarP_1,17.6 //
dvitīyāyāṃ tu kakṣāyāṃ sūryāndvādaśa pūjayet /
bhagaḥ sūryor'yyamā caiva mitro vai varuṇastathā // GarP_1,17.7 //
savitā caiva dhātā ca vivasvāṃśca mahābalaḥ /
tvaṣṭā pūṣā tathā cendro dvādaśo viṣṇurucyate // GarP_1,17.8 //
pūrvādāvarcayeddevānindrādīñchraddhayā naraḥ /
jayā ca vijayā caiva jayanti cāparājitā /
śeṣaśca vāsukiścaiva nāgānityādi pūjayet // GarP_1,17.9 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sūryārcana vidhirnāma saptadaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 18
sūta uvāca /
garuḍoktaṃ kaśyapāya vakṣye mṛtyuñjayārcanam /
uddhārapūrvakaṃ puṇyaṃ sarvadevamayaṃ matam // GarP_1,18.1 //
oṅkāraṃ pūrvamuddhṛtya ju(hu)ṅkāṃraṃ tadanantaram /
savisargaṃ tṛtīyaṃ syānmṛtyudāridrayamardanam // GarP_1,18.2 //
īśaviṣṇavarkadevyādikavacaṃ sarvasādhakam /
amṛteśaṃ mahāmantrantryakṣaraṃ pūjanaṃ samam /
japanānmṛtyuhīnāḥ syuḥ sarvapāpavivarjitāḥ // GarP_1,18.3 //
śatajapyādvedaphalaṃ yajñatīrthaphalaṃ labhet /
aṣṭottaraśatājjāpyātrisandhyaṃ mṛtyu śatrujita // GarP_1,18.4 //
dhyāyecca sitapadmasthaṃ varadaṃ cābhayaṃ kare /
dvābhyāṃ cāmṛtakumbhaṃ tu cintayedamṛteśvaram // GarP_1,18.5 //
tasyaivāṅgagatāṃ devīmamṛtāmṛtabhāṣiṇī(vini) m /
kalaśaṃ dakṣiṇe haste vāmahaste saroruham // GarP_1,18.6 //
japedaṣṭasahasraṃ vai trisandhyaṃ māsamekataḥ /
jarāmṛtyumahāvyādhiśatrucchivaśāntidam // GarP_1,18.7 //
āhvānaṃ sthāpanaṃ rodhaṃ sannidhānaṃ niveśanam /
pādyamā camanaṃ snānamarghyaṃ sraganulepanam // GarP_1,18.8 //
dīpāṃbaraṃ bhūṣaṇaṃ ca naivadyaṃ pānavījanam /
mātrāmudrājapadhyānaṃ dakṣiṇā cāhutiḥ stutiḥ // GarP_1,18.9 //
vādyaṃ gatiṃ ca nṛtyaṃ ca nyāsayogaṃ pradakṣiṇam /
praṇatirmantraśayyā ca vandanaṃ ca visarjanam // GarP_1,18.10 //
ṣaḍaṅgādiprakāreṇa pūjanaṃ tu kramoditam /
parameśamukhodrītaṃ yo jānāti sa pūjakaḥ // GarP_1,18.11 //
arghyapātrārcanaṃ cādāvastreṇaiva tu tāḍanam /
śodhanaṃ kavacenaiva amṛtīkaraṇaṃ tataḥ // GarP_1,18.12 //
pūjā cādhāraśaktyādeḥ prāṇāyāmaṃ tathāsane /
pīṭhasuddhiṃ tataḥ kuryācchoṣaṇādyaistataḥ smaret // GarP_1,18.13 //
ātmānaṃ devarūpaṃ ca karāṅganyāsakaṃ caret /
ātmānaṃ pūjayetpaścājyo tīrūpaṃ hṛdabjataḥ // GarP_1,18.14 //
mūrtau vā sthaṇḍile vāpi kṣipetpuṣpaṃ tu bhāsvaram /
āhvānadvārapūjārthaṃ pūjā cādhāraśaktitaḥ // GarP_1,18.15 //
sānnidhyakaraṇaṃ deve parivārasya pūjanam /
aṅgaṣaṭkasya pūjā vai kartavyā ca vipaścitaiḥ // GarP_1,18.16 //
dharmādayaśca śakrādyāḥ sāyudhāḥ parivārakāḥ /
yugavedamuhūrtāśca pūjeyaṃ bhuktimuktikṛt // GarP_1,18.17 //
mātṛkāśca gaṇāṃścādau nandigaṅge ca pūjayet /
mahākālaṃ ca yamanāṃ dehalyāṃ pūjayetpurā // GarP_1,18.18 //
oṃ amṛteśvara oṃ bhairavāya namaḥ /
evaṃ oṃ juṃ haṃsaḥ sūryāya namaḥ // GarP_1,18.19 //
evaṃ śivāya kṛṣṇāya brahmaṇe ca gaṇāya ca /
caṇḍikāyai sarasvatyai mahālakṣmādi pūjayet // GarP_1,18.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśāvye ācārakāṇḍe 'mṛteśamṛtyuñjayapūjanaṃ nāmāṣṭādaśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 19
sūta uvāca /
prāṇeśvaraṃ gāruḍaṃ ca śivoktaṃ pravadāmyaham /
sthānānyādau pravakṣyāmi nāgadaṣṭo na jīvati // GarP_1,19.1 //
citāvalmīkaśailādau kape ca vivare taroḥ /
daṃśe rekhātrayaṃ yasya pracchannaṃ sa na jīvati // GarP_1,19.2 //
ṣaṣṭhyāṃ ca karkaṭe meṣe mūlāśleṣāmaghādiṣu /
kakṣāśroṇigale sandhau śaṅkhakarṇodarādiṣu // GarP_1,19.3 //
daṇḍī śastradharo bhikṣurna gnādiḥ kāladūtakaḥ /
bāhau ca vakkre grīvāyāṃ daṣṭāyāṃ na hi jīvati // GarP_1,19.4 //
pūrvaṃ dinapatirbhuṅkte ardhayāmaṃ tato 'pare /
śeṣā grahāḥ pratidinaṃ ṣaṭsaṃkhyā parivartanaiḥ // GarP_1,19.5 //
nāgabhogaḥ kramāñjñeyo rātrau bāṇavivartanaiḥ /
śeṣor'kaḥ phaṇipaścandrastakṣako bhauma īritaḥ // GarP_1,19.6 //
karkoṭo jño guruḥ padmo mahāpadmaśca bhārgavaḥ /
śaṅkhaḥ śanaiścaro rāhuḥ kulikaścāhayo grahāḥ // GarP_1,19.7 //
rātrau divā suragurorbhāge syādamarāntakaḥ /
paṅgoḥ kāle divā rāhuḥ kulikena saha sthitaḥ // GarP_1,19.8 //
yāmārdhasandhisaṃsthāṃ ca velāṃ kālavatīṃ caret /
bāṇadviṣaḍvahnivājiyugabhūrekabhāgataḥ? // GarP_1,19.9 //
divā ṣaḍedanetrādripañcatrimānuṣāṃśakaiḥ /
pādāṅguṣṭhe pādapṛṣṭhe pādapṛṣṭhe gulphe jānuni liṅgake // GarP_1,19.10 //
nābhau hṛdi stanataṭe kaṇṭhe nāsāpuṭe 'kṣiṇi /
karṇayośca bhruvoḥ śaṅkhe mastake pratipatkramāt // GarP_1,19.11 //
tiṣṭhaccandraśca jīvecca puṃso dakṣiṇabhāgake /
kāyasya vāmabhāge tu striyā vāyuvahātkarāt // GarP_1,19.12 //
amṛtastatkṛto moho nivarteta ca mardanāt /
ātmanaḥ paramaṃ bījaṃ haṃsākhyaṃ sphaṭikāmalam // GarP_1,19.13 //
dātavyaṃ viṣapāpaghnaṃ bījaṃ tasya caturvidham /
vindupañcasvarayutamādyamuktaṃ dvitīyakam /
ṣaṣṭhārūḍhaṃ tṛtīyaṃ syātsavisargaṃ caturthakam /
oṃ kuru kule svāhā // GarP_1,19.14 //
vidyā trailokyarakṣārthaṃ garuḍena dhṛtā purā /
vadhepsurnāganāgānāṃ mukhe 'tha praṇavaṃ nyaset // GarP_1,19.15 //
gale kuru nyaseddhīmānkule ca gulphayoḥ smṛtaḥ /
svāhā pādayuge caiva yugahā nyāsa īritaḥ // GarP_1,19.16 //
gṛhe vivikhitā yatra tannāgāḥ saṃtyajanti ca /
sahasramantraṃ japtvā tu karṇe sūtraṃ dhṛtaṃ tathā // GarP_1,19.17 //
yadrṛhe śarkarā japtā kṣiptā nāgāstyajanti tat /
saptalakṣasya japyāddhi siddhiḥ prāptā surāsuraiḥ // GarP_1,19.18 //
oṃ suvarṇarekhe kukkuṭavigraharūpiṇi svāhā /
evañcāṣṭadale padma dale varṇayugaṃ likhet // GarP_1,19.19 //
nāmaitadvāridhārābhiḥ snāto daṣṭo viṣaṃ tyajet /
oṃ pakṣi svāhā // GarP_1,19.20 //
aṅguṣṭhādi kaniṣṭhāntaṃ kare nyasyātha dehake /
ke (kai) vakkre hṛdi liṅge ca pādayorgaruḍasya hi // GarP_1,19.21 //
nākrāmanti ca tacchāyāṃ svapne 'pi viṣapannagāḥ /
yastu lakṣaṃ japeccāsyāḥ sa dṛṣṭvā(ṣṭyā) nāśayedviṣam // GarP_1,19.22 //
oṃ hrī hrau hrīṃ bhi(bhī) ruṇḍāyai svāhā /
karṇe japtā tviyaṃ vidyā daṣṭakasya viṣaṃ haret // GarP_1,19.23 //
a ā nyasettu pādāgre i ī gulaphe 'tha jānuni /
u ū e ai kaṭitaṭe o nābhau hṛdi au nyaset // GarP_1,19.24 //
vakkre amuttamāṅge aḥ nyasedvai haṃsasaṃyutāḥ /
haṃso viṣādi ca harejjapto dhyāto 'tha pūjitaḥ // GarP_1,19.25 //
garuḍo 'hamiti dhyātvā kuryādviṣaharāṃ (rīṃ) kriyām /
haṃmantraṃ gātravinyastaṃ viṣādiharamīritam // GarP_1,19.26 //
nyasya haṃsaṃ vāmakare nāsāmukhanirodhakṛt /
mantro hareddaṣṭakasya tvaṅmāṃsādigataṃ viṣam // GarP_1,19.27 //
sa vāyunā samākṛṣya daṣṭānāṃ garalaṃ haret /
tanau nyaseddaṣṭakasya nīlakaṇṭhādi saṃsmaret // GarP_1,19.28 //
pītaṃ pratyaṅgirāmūlaṃ taṇḍuladbhirviṣāpaham /
punarnavāphalinīnāṃ mūlaṃ vakkrajamīdṛśam // GarP_1,19.29 //
mūlaṃ śuklabṛhatyāstu karkoṭyāgairikarṇikam /
adbhirghṛṣṭaghṛtopetalepo 'yaṃ viṣamardanaḥ // GarP_1,19.30 //
viṣamṛddhiṃ na vrajecca uṣṇaṃ pibati yo ghṛtam /
pañcāṅgaṃ tu śirīṣasya mūlaṃ gṛñjanajaṃ tathā // GarP_1,19.31 //
sarvāṅgalepataśacāpi pānādvā viṣahṛdbhavet /
hrīṃ gonasādiviṣahṛt // GarP_1,19.32 //
hṛllalāṭavisargāntaṃ dhyātaṃ vaśyā dikṛdbhavet /
nyastaṃ yonau vaśetkanyāṃ kuryānmadajalāvilam // GarP_1,19.33 //
japtvā saptāṣṭasāhasraṃ garutmāniva sarvagaḥ /
kaviḥ syācchrutidharī ca vaśyāḥ strīścāyurāpnuyāt /
viṣahṛtsyātkathā tadvanmaṇirvyāsaḥ smṛto dhruvam // GarP_1,19.34 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sarpaviṣaharopāya(prāṇeśvaravidyā) nirūpaṇaṃ nāmaikonaviṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 20
sūta uvāca /
vakṣye tatparamaṃ guhyaṃ śivoktaṃ mantrabṛndakam /
pāśaṃ dhanuśca cakraṃ ca mudraraṃ śūlapaṭṭiśam // GarP_1,20.1 //
etairevāyudhairyuddhe mantraiḥ śatrūñjayennṛpaḥ /
mantroddhāraḥ padmapātre ādi pūrvādike likhet // GarP_1,20.2 //
aṣṭavargaṃ cāṣṭamaṃ ca khyātamīśānapatrake /
oṃ kāro brahma bījaṃ syāddhrīṅkāro viṣṇureva ca // GarP_1,20.3 //
hrīṅkā raśca śivaḥ śūle triśākhe tu kramānnyaset /
oṃ hrīṃ hrīṃ // GarP_1,20.4 //
śūlaṃ gṛhītvā hastenābhrāmya cākāśasaṃmukham /
taddarśanāndrahā nāgā dṛṣṭvā vā nāśamāpnu yuḥ // GarP_1,20.5 //
dhūmārakte karaṃ madhye dhyātvā khe cintayennaraḥ /
duṣṭā nāgā grahā meghā vinaśyanti ca rākṣasāḥ // GarP_1,20.6 //
trilokānrakṣayenmantro martyalokasya kā kathā /
oṃ jūṃ sūṃ hūṃ phaṭ // GarP_1,20.7 //
khādirānkīlakānaṣṭau kṣetre saṃmantrya vinyaset /
na tatra vajrapātasya sphūrjathvāderupadravaḥ // GarP_1,20.8 //
garuḍoktairmahāmantraiḥ kīlakānaṣṭa mantrayet /
ekaviṃśativārāṇi kṣetre tu nikhanenniśi // GarP_1,20.9 //
vidyunmūṣakavajrādisamupadrava eva ca /
harakṣamalavarayū binduyuktaḥ sadāśivaḥ // GarP_1,20.10 //
oṃ hrāṃ sadāśivāya namaḥ /
tarjanyā vinyasetpiṇḍaṃ (ṇḍe) dāḍimīkusumaprabham // GarP_1,20.11 //
tasyaiva darśanādduṣṭā meghavidyuddipādayaḥ /
rākṣasā bhūtaḍākinyaḥ pradravanti diśo daśa // GarP_1,20.12 //
oṃ hrīṃ gaṇeśāya namaḥ /
(oṃ hrīṃ) stambhanādicakrāya namaḥ /
oṃ aiṃ brahayaintrai lokyaḍāmarāya namaḥ // GarP_1,20.13 //
bhairavaṃ piṇḍamākhyātaṃ viṣapāpagrahāpaham /
kṣetrasya rakṣaṇaṃ bhūtarākṣasādeḥ pramardanam // GarP_1,20.14 //
oṃ namaḥ /
indravajraṃ kare dhyātvā duṣṭameghādivāraṇam /
viṣa śatrugaṇā bhūtā naśyante vajramudrayā // GarP_1,20.15 //
oṃ kṣuṃ(kṣa) namaḥ /
smaretpāśaṃ vāmahaste viṣabhūtādi naśyati /
oṃ hrāṃ (hro) namaḥ /
hareduccāraṇānmantro viṣameghagrahādikān // GarP_1,20.16 //
dhyātvā kṛtāntaṃ ca dahecchedakāstreṇa vai jagat /
oṃ kṣṇaṃ (kṣma) namaḥ /
dhyātvā tu bhairavaṃ kuryāndrahabhūtaviṣāpaham // GarP_1,20.17 //
oṃ lasaddijihvākṣa svāhā /
kṣetrādau grahabhūtādiviṣapakṣinivāraṇam // GarP_1,20.18 //
oṃ kṣva (kṣṇaṃ) namaḥ /
raktena paṭahe likhya śabdātresurgrahādayaḥ /
oṃ mara mara mārayamāraya svāhā /
oṃ huṃ phaṭ svāhā // GarP_1,20.19 //
śūlaṃ cāṣṭaśatairmantrya bhrāmaṇācchatruvṛndahṛt /
ūrdhaśaktinipātena adhaḥ śaktiṃ nikuñceyet // GarP_1,20.20 //
pūrake pūritā mantrāḥ kumbhakena sumantritāḥ /
praṇavenāpyāyitāste manavastadudīritāḥ /
evamāpyāyitā mantrā bhṛtyavatphaladāyakāḥ // GarP_1,20.21 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣādiharamantrabṛndanirūpaṇaṃ nāma viṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 21
sūta uvāca /
pañcavatkrārcanaṃ vakṣye pṛtha gyadbhuktimuktidam /
oṃ bhūrviṣṇave ādibhūtāya sarvādhārāya mūrtaye svāhā // GarP_1,21.1 //
sadyojātasya cāhvānamanena prathamaṃ caret /
oṃ hāṃ sadyojātāyaiva kalā hyaṣṭau prakīrtitāḥ // GarP_1,21.2 //
siddhirṛddhirdhṛtirlakṣmīrmedhā kāntiḥ svadhā sthitiḥ (8) /
oṃ hīṃ vāmadevāyaiva kalāstasya trayodaśa // GarP_1,21.3 //
rajā rakṣā ratiḥ pālyā kānti stṛṣṇā matiḥ kriyā /
kāmā buddhiśca rātriśca trāsanī mohinī tathā (13) // GarP_1,21.4 //
manonmanī aghorā ca tathā mohā kṣudhā kalāḥ /
nidrā mṛtyuśca māyā ca (8)aṣṭasaṃkhyā bhayaṅkara // GarP_1,21.5 //
oṃ haiṃ tatpuruṣāyaiva (ṣāya) nivṛttiśca pratiṣṭhā ca vidyā śāntirna kevalā // GarP_1,21.6 //
oṃ hauṃ īśānāya namo niścalā ca nirañjanā /
śaśinī cāṅganā caiva marīcirjvālinī tathā // GarP_1,21.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍaṃ pañcavakkrapūjanaṃ nāmaikaviṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 22
sūta uvāca /
śivārcanaṃ pravakṣyāmi buktimuktikaraṃ param /
śāntaṃ sarvagataṃ śūnyaṃ mātrādvādaśake sthitam // GarP_1,22.1 //
pañca vakkrāṇi hrasvāni dīrghāṇyaṅgāni bindunā /
savisargaṃ vadedastraṃ śiva ūrghvaṃ tathā punaḥ // GarP_1,22.2 //
ṣaṣṭhenādho mahāmantro haumityevākhilārthadaḥ /
hastābhyāṃ saṃspṛśetpādāvūrdhvaṃ pādānmastakam // GarP_1,22.3 //
mahāmudrā hi sarveṣāṃ karāṅganyāsamācaret /
tālahastena pṛṣṭhaṃ ca astramantreṇa śodhayet // GarP_1,22.4 //
kaniṣṭhāmāditaḥ kṛtvā tarjanyaṅgāni vinyaset /
pūjanaṃ saṃpravakṣyāmi karṇikāyāṃ tdṛdambuje // GarP_1,22.5 //
dharmaṃ jñānaṃ ca vairāgyamaiśvaryādi tdṛdārcayet /
āvāhanaṃ sthāpanaṃ ca pādyamarghyaṃ hṛdārpayet // GarP_1,22.6 //
ācāmaṃ snapanaṃ pūjāmekādhāraṇatulyakam? /
agnikāryavidhiṃ vakṣye astreṇollekhanaṃ caret // GarP_1,22.7 //
varṃmaṇābhyukṣaṇaṃ kāryaṃ śaktinyāsaṃ hṛdā caret /
tdṛdi vā śaktigarte ca prakṣipejjātavedasam // GarP_1,22.8 //
garbhādhānādikaṃ kṛtvā niṣkṛtiṃ cārasya paścimām /
hṛdā kṛtvā sarvakarṃma śivaṃ sāṃgaṃ tu homayet // GarP_1,22.9 //
pūjayenmaṇḍale śambhuṃ padmagarbhe garāṅkitam /
catuḥ ṣaṣṭyantamaṣṭādi khākṣi khādyādimaṇḍalam // GarP_1,22.10 //
khākṣīndrasūryagaṃ sarvakhādivedendu (devendu) vartanam /
āgneyyāṃ kārayetkuṇḍamardhacandranibhaṃ śubham // GarP_1,22.11 //
agniśāstra parāyustho tdṛdayādigaṇocyate /
astraṃ diśā supadmasya karṇikāyāṃ sadāśivaḥ // GarP_1,22.12 //
dīkṣāṃ vakṣye pañcatattve sthitāṃ bhūmyādikāṃ pare /
nivṛttirbhūpratiṣṭhādyairvidyāgniḥ śāntivannijaḥ // GarP_1,22.13 //
śāntyatītaṃ bhavevdyoma tatparaṃ śāntamavyayam /
ekaikasya śataṃ homā hatyevaṃ pañca homayet // GarP_1,22.14 //
paścātpūrṇāhutiṃ dattvā prā(pra)sodana śivaṃ smaret /
prāyaścittaviśuddhyarthamekaikāṣṭāhutiṃ kramāt // GarP_1,22.15 //
homayedastrabījena evaṃ dīkṣāṃ samāpayet /
yajanavyatirekeṇa gopyaṃ saṃskāramuttamam // GarP_1,22.16 //
evaṃ saṃskāraśuddhasya śivatvaṃ jāyate dhruvam // GarP_1,22.17 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śivārcanaprakāro nāma dvāviṃśo 'dhyāyaḥ

_____________________________________________________________


śrīgaruḍamahāpurāṇam- 23
sūta uvāca /
śivārcanaṃ pravakṣyāmi dharṃmakāmādisādhanam /
tribhirmantrairācāmettu svāhāntaiḥ praṇavādikaiḥ // GarP_1,23.1 //
oṃ hāṃ ātmatattvāya vidyātattvāya hīṃ tathā /
oṃ hūṃ śivatattvāya svāhā hṛdā syācchrotravandanam // GarP_1,23.2 //
bhasmasnānaṃ tarpaṇaṃ ca oṃ hāṃ svāhā sarvamantrakāḥ /
sarve devāḥ sarvamunirnamo 'nto vauṣaḍantakaḥ // GarP_1,23.3 //
svadhāntāḥ sarvapitaraḥ svadhāntāśca pitāmahāḥ /
oṃ hāṃ prapitāmahebhyastathā mātāmahādayaḥ // GarP_1,23.4 //
hāṃ namaḥ sarvamātṛbhyastataḥ syātprāṇasaṃyamaḥ /
ācāmaṃ mārjanaṃ cātho gāyatrīṃ ca japettataḥ // GarP_1,23.5 //
oṃ hāṃ tanmaheśāya vidmahe,vāgviśuddhāya dhīmahi, tanno rudraḥ pracodayāt // GarP_1,23.6 //
sūryopasthānakaṃ kṛtvā sūryamantraiḥ prapūjayet /
oṃ hāṃ hīṃ hūṃ haiṃ hauṃ haḥ śivasūryāya namaḥ /
oṃ haṃ khakholkāya sūryamūrtaye namaḥ /
oṃ hrāṃ hrīṃ saḥ sūryāya namaḥ // GarP_1,23.7 //
daṇḍine piṅgale tvātibhūtāni ca tataḥ smaret /
agnayādau vimaleśānamārādhya paramaṃ sukham // GarP_1,23.8 //
yajetpadmāṃ ca rāṃ dīptāṃ rīṃ sūkṣmāṃ rūṃ jayāṃ ca reṃ /
bhadrāṃ ca raiṃ vibhūtiṃ roṃ vimalāṃ raumamodhi (rodhi) kām // GarP_1,23.9 //
raṃ vidyutāṃ ca pūrvādau rā (raṃ) madhye sarvatomukhīm /
arkāsanaṃ sūryamūrteṃ hrāṃ hrūṃ (hrīṃ) saḥ sūryamarcayet // GarP_1,23.10 //
oṃ āṃ hṛdarkāya ca śiraḥ śikhā ca bhūrbhuvaḥ svarom /
jvālinīṃ hraṃ kavacasya cāstraṃ rājñāṃ ca dīkṣitām // GarP_1,23.11 //
yajetsūryahṛdā sarvānsoṃ somaṃ maṃ ca maṅgalam /
baṃ budhaṃ bṛṃ bṛhaspatiṃ bhaṃ bhārgavaṃ śaṃ śanaiścaram // GarP_1,23.12 //
raṃ rāhuṃ kaṃ yajetketuṃ oṃ tejaścaṇḍamarcayet /
sūryamabhyarcya cācamya kaniṣṭhāto 'ṅgakāṃnyaset // GarP_1,23.13 //
hāṃ hṛcchiro hūṃ śikhā haiṃ varṃma hauṃ caiva netrakam /
ho 'straṃ śaktisthitiṃ kṛtvā bhūtaśuddhiṃ punarnyaset // GarP_1,23.14 //
arghyapātraṃ tataḥ kṛtvā tadadbhiḥ prokṣayedyajet // GarP_1,23.15 //
ātmānaṃ padmasaṃsthaṃ ca hauṃ śivāya tato bahiḥ /
dvāre nandimahākālau gaṅgā ca yamunātha gauḥ // GarP_1,23.16 //
śrīrastraṃ vāstvadhipatiṃ brahmāṇaṃ ca gaṇaṃ gurum /
śaktyanantau yajenmadhye pūrvādau dharṃmakādikam // GarP_1,23.17 //
adharṃmādyaṃ ca vahnyādau madhye padmasya karṇike /
vāmājyeṣṭhā ca pūrvādau raudrī kālī ca pūrṣadaḥ // GarP_1,23.18 //
oṃ hauṃ kalavikariṇyai balavikariṇī tataḥ /
balapramathinī sarvabhūtānāṃ damanī tataḥ // GarP_1,23.19 //
manonmanī yajedetāḥ paṭhimadhye śivāgrataḥ /
śivāsanaṃ mahāmūrti mūrtimadhye śivāya ca // GarP_1,23.20 //
āvāhanaṃ sthāpanaṃ ca sannidhānaṃ nirodhanam /
sakalīkaraṇaṃ mudrādarśanaṃ cārghyapādyakam // GarP_1,23.21 //
ācāmābhyaṅgamudvartaṃ snānaṃ nirṃmathanaṃ caret /
vastraṃ vilepanaṃ puṣpaṃ dhūpaṃ dīpaṃ caruṃ dadet // GarP_1,23.22 //
ācāmaṃ mukhavāsaṃ ca tāmbūlaṃ hastaśodhanam /
chatracāmarapāvitraṃ paramīkaraṇaṃ caret // GarP_1,23.23 //
rūpakpena caikāhajapo jāpyasamarpaṇam /
stutirnatirhṛdādyaiśca jñeyaṃ nāmāṅga pūjanam // GarP_1,23.24 //
agnīśarakṣo vāyavye madhye pūrvāditantrakam /
indrādyāṃśca yajeccaṇḍaṃ tasmai nirmālyamarpayet // GarP_1,23.25 //
guhāyātiguhyagoptā tvaṃ gṛhāṇāsmatkṛtaṃ japam /
siddhirbhavatu me deva tatprasādāttvayi sthitiḥ // GarP_1,23.26 //
yatkiñcitkriyate karma sadā sukṛtaduṣkṛtam /
tanme śivapadasthasya rudra kṣapaya śaṅkara // GarP_1,23.27 //
śivo dātā śivo bhoktā śivaḥ sarvamidaṃ jagat /
śivo jayati sarvatra yaḥ śivaḥ so 'hameva ca // GarP_1,23.28 //
yatkṛtaṃ yatkariṣyāmi tatsarvaṃ sukṛtaṃ tava(tastavam) /
tvaṃ trātā viśvanetā ca nānyonātho 'stimeśiva // GarP_1,23.29 //
athānyena prakāreṇa śivapūjāṃ vadāmyaham /
gaṇaḥ sarasvatī nandī mahākālo 'thagaṅgayā // GarP_1,23.30 //
pavanāstraṃ vāstvadhipo dvāri pūrvāditastvime /
indrādyāḥ pūjanīyāśca tattvāni pṛthivī jalam // GarP_1,23.31 //
tejo vāyurvyoma gandho rasarūpe ca śabdakaḥ /
sparśo vāk pāṇi pādaṃ ca pāyūpasthaṃ śrutitvacam // GarP_1,23.32 //
cakṣurjihvā ghrāṇamano buddhiścāhaṃ prakṛtyapi /
pumānnāgo buddhividye kalā kālo niyatyapi // GarP_1,23.33 //
māyā ca śuddha vidyā ca īśvaraśca sadāśivaḥ /
śaktiḥ śivaśca tāñjñātvā mukto jñānī śivo bhavet // GarP_1,23.34 //
yaḥ śivaḥ sa harirbrahmā so 'haṃ brahmāsmi śaṅkara // GarP_1,23.35 //
bhūtaśuddhiṃ pravakṣyāmi yayā śuddhaḥ śivo bhavet /
hṛtpadme sadyomantraḥ syānnivṛttiśca kalā iḍā // GarP_1,23.36 //
piṅgalā dve ca nāḍyau tu prāṇo 'pānaśca mārutau /
indro deho brahmahetuścaturastraṃ ca maṇḍalam // GarP_1,23.37 //
vaktreṇa lāñchitaṃ vāyumekoddhātaguṇāḥ śarāḥ /
tdṛtsthānasādṛśyarutaṃ śatakoṭipravistaram // GarP_1,23.38 //
oṃ hrīṃ pratiṣṭhāyai hrūṃ hraḥ phaṭ /
oṃ hrīṃ hrūṃ vidyāyai hraṃ hraḥ phaṭ /
caturaśītikoṭīnāmucchrayaṃ bhūmitantrakam // GarP_1,23.39 //
tanmadhye bhavavṛkṣaṃ ca ātmānaṃ ca vicintayet /
adhomukhīṃ tataḥ pṛthvīṃ tattacchudhdaṃ bhaveddhruvam // GarP_1,23.40 //
vāmā devī pratiṣṭhā ca suṣumnā dhārikā tathā /
samānodānavaruṇā devatā viṣṇu kāraṇam // GarP_1,23.41 //
addhātāśca guṇā vedāḥ śvetaṃ dhyānaṃ tathaiva ca /
evaṃ kuryātkaṇṭhapadmamardhacandrākhyamaṇḍalam // GarP_1,23.42 //
padmāṅkitaṃ dviviṃśatikakoṭivistīrṇamau smaret /
caturnavatyucchrayaṃ ca ātmānaṃ ca adhomukham // GarP_1,23.43 //
tālusthānaṃ ca padmaṃ ca aghoro vidyayānvitaḥ /
nābhyo(ḍyo) ṣṭhayorhastijihvādhyāno nāgognidevatā // GarP_1,23.44 //
rudrahetustriruddhātāstriguṇā raktavarṇakam /
jvālākṛte trikoṇaṃ ca catuḥ koṭiśatāni ca // GarP_1,23.45 //
vistīrṇaṃ ca samutsedhaṃ rudratattvaṃ vicintayet /
lalāṭe vai tatpuruṣaḥ śāntiryaḥ śādvalaṃ budhāḥ (vṛṣā) // GarP_1,23.46 //
kūrmaśca kṛkaro vāyurdeva īśvarakāraṇam /
dviruddhāto guṇau dvau ca dhūmraṣaṭkoṇamaṇḍalam // GarP_1,23.47 //
bindvaṅkitaṃ cāṣṭakoṭivistīrṇaṃ cocchrayastathā /
caturdaśādhikaṃ koṭivāyutattvaṃ vicintayet // GarP_1,23.48 //
dvādaśati sarasije śāntya tītāstatheśvarāḥ /
kuhūśca śaṅkhinī nāḍyo devadatto dhanañjayaḥ // GarP_1,23.49 //
śikhaiśānakāraṇaṃ ca sadāśiva iti smṛtaḥ /
guṇa ekastathoddhātaḥ śuddhasphaṭikavatsmaret // GarP_1,23.50 //
ṣoḍaśakoṭivistīrṇaṃ pañcaviṃśatikocchrayam /
vartulaṃ cintayevdyoma bhutaśuddhirudāhṛtā // GarP_1,23.51 //
guṇayo gururbojaguruḥ śaktayanantau ca dharṃmakaḥ /
jñānavairāgyamaiśvaryaistataḥ pūrvādipatrake // GarP_1,23.52 //
adhordhvavadane dve ca padmakarṇikakesaram /
vāmādyā ātmavidyā ca sadā dhyāyecchivākhyakam // GarP_1,23.53 //
tattvaṃ śivāsane mūrtirhe hauṃ vidyādehāya namaḥ /
baddhapadmāsanāsīnaḥ sitaḥ ṣoḍaśavārṣikaḥ // GarP_1,23.54 //
pañcavaktraḥ karāgraiḥ svairdaśabhiścaiva dhārayan /
abhayaṃ prasādaṃ śaktiṃ śūlaṃ khaṭvāṅgamīśvaraḥ // GarP_1,23.55 //
dakṣaiḥ karairvāmakaiśca bhujaṅgaṃ cākṣasūtrakam /
ḍamarukaṃ nīlotpalaṃ bījapūrakamuttamam // GarP_1,23.56 //
icchājñānakriyāśaktistrinetro hi sadāśivaḥ /
evaṃ śivārcanadhyānī sarvadā kālavarjitaḥ // GarP_1,23.57 //
ihāhorā vacāreṇa trīṇi varṣāṇi jīvati /
dinadvayasya cāreṇa jīvedvarṣadvayaṃ naraḥ // GarP_1,23.58 //
dinatrayasya cāreṇa varṣamekaṃ sa jīvati /
nākāle śītale mṛtyuruṣṇe caiva tu kārake // GarP_1,23.59 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śivārcananirūpaṇaṃ nāma trayoviṃśo 'dhyāyaḥ

(iti śivādipūjā samāptā) /


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 24
sūta uvāca /
vakṣye gaṇādikāḥ pūjāḥ sarvadā svargadāḥ parāḥ /
gaṇāsanaṃ gaṇamūrti gaṇādhipatimarcayet // GarP_1,24.1 //
gāmādihṛdayādyaṅgaṃ durgāyā gurupādukāḥ /
durgāsanaṃ ca tanmūrtiṃ hrīṃ durge rakṣaṇīti ca // GarP_1,24.2 //
tdṛdādikaṃ nava śaktyo rudracaṇḍā pracaṇḍayā /
caṇḍogrā caṇḍanāyikā caṇḍā caṇḍavatī kramāt // GarP_1,24.3 //
caṇārūpā caṇḍikākhyā durgedurge 'tha rakṣiṇi /
vajrakhaḍgādikā mudrāḥ śivādyā vahnideśataḥ // GarP_1,24.4 //
sadāśivamahāpretapadmāsana mathāpi vā /
aiṃ klīṃ (hrīṃ) saustripurāyai namaḥ /
oṃ hrāṃ hrīṃ kṣeṃ kṣaiṃ strīṃ skīṃ roṃ spheṃ sphīṃ śāṃ padmāsanaṃ ca mūrtiṃ ca tripurātdṛdayādikam // GarP_1,24.5 //
pīṭhāmbuje tu brāhayādīrbrahmāṇī ca maheśvarī /
kaumārī vaiṣṇavī pūjyā vārāhī cendradevatā // GarP_1,24.6 //
cāmuṇḍā caṇḍikā pūjyā bhairavākhyāṃstato yajet /
asitāṅgoruruścaṇḍaḥ krodha unmattabhairavaḥ // GarP_1,24.7 //
kapālī bhīṣaṇaścaiva saṃhāraścāṣṭa bhairavāḥ /
ratiḥ prītiḥ kāmadevaḥ pañca bāṇāśca yoginī // GarP_1,24.8 //
vaṭukaṃ durgayā vighnarājo guruśca kṣetrapaḥ /
padmagarbhe maṇḍale ca trikoṇe cintayeddhṛdi // GarP_1,24.9 //
śuklāṃ varadākṣasūtrapustābhayasamanvitām /
lakṣajapyācca homācca tripurā siddhidā bhavet // GarP_1,24.10 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe tripurādipūjānirūpaṇaṃ nam caturviśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 25
sūta uvāca /
aiṃ krīṃ śrīṃ spheṃ kṣaiṃ anantaśaktipādukāṃ pūjayāmi namaḥ // GarP_1,25.1 //
aiṃ śrīṃ phraiṃ kṣaiṃ ādhāraśaktipādukāṃ pūjayāmi namaḥ /
oṃ hraṃ kālāgnirudrapādukāṃ pūjayāmi namaḥ // GarP_1,25.2 //
oṃ hrīṃ huṃ hāṭakeśvaradevapādukāṃ pūjayāmi namaḥ /
oṃ hrīṃ śeṣabhaṭṭārakapādukāṃ pūjayāmi namaḥ // GarP_1,25.3 //
oṃ hrīṃ śrīṃ pūthivītatsavarṇabhuvanadvīpasamudradiśāmanantākhyamāsanaṃ padmāsanaṃ pūjayāmi namaḥ // GarP_1,25.4 //
hrīṃ śrīṃ nivṛttyādi kalā pṛthivyāditattva manantādibhuvanamoṅkārādivarṇam /
hakārādinavātmakapadaḥ sadyodātādimantraḥ hrāṃ hṛdayādyaṅgaḥ /
evaṃ mantramaheśvara siddhavidyātmakaḥ parāmṛtārṇavaḥ sarvabhūto diksamastaṣaḍaṅgaḥ sadāśivārṇavapayaḥ pūrṇodadhipakṣaśrīmānāspadātmakaḥ vidyomāpūrṇajñatvakartṛtvalakṣaṇajyeṣṭhācakrarudraśaktyātmakakarṇi kaḥ /
navaśaktiśivādibhirmūlamaṇḍalatrayakujātmakotpannāpadmāsanapādukāṃ pūjayāmi namaḥ // GarP_1,25.5 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe āsanapūjānirūpaṇaṃ nāma pañcaviṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgarūḍamahāpurāṇam- 26
sūta uvāca /
anantaraṃ karanyāsaḥ /
vidyākarī śuddhiḥ kāryā /
padmamudrāṃ baddhvā mantranyāsaṃ kuryāt /
kaiṃ kaniṣṭhāyai namaḥ /
naiṃ anāmikāyai namaḥ /
maiṃ madhyamāyai namaḥ /
taiṃ tarjanyai namaḥ /
aṃ aṅguṣṭhāyai namaḥ /
lāṃ karatalāyai namaḥ /
vāṃ karapṛṣṭhāyai namaḥ // GarP_1,26.1 //
atha dehanyāsaḥ /
smaṃsmaṃ maṇibandhāya namaḥ /
aiṃ hrīṃ śrīṃ karāsphālāya namaḥ /
mahātejorūpaṃ huṃhuṅkāreṇa karāsphālanaṃ kuryāt // GarP_1,26.2 //
aiṃ hrīṃ śrīṃ hrīṃ sphaiṃ namo bhagavate sphaiṃ kubjīkāyai namaḥ /
hraṃ hrīṃ hrauṃ ṅañaṇaname aghorāmukhi hrāṃ hrīṃ kilikili vicce sthaulyakrośī hrīṃ hrīṃ śrīṃ aiṃ namo bhagavate urdhvavaktrāya namaḥ /
sphaiṃ kubjikāyai pūrvavaktrāya namaḥ /
hrīṃ śrīṃ hrīṃ ṅaāñaṇaname dakṣiṇavaktrāya namaḥ /
oṃ hrīṃ śrīṃ kilikili paścimavaktrāya namaḥ /
oṃ akhoramukhi uttaravaktrāya namaḥ /
oṃ namo bhagavate hṛdayāya namaḥ kṣaiṃ (kṣeṃ aiṃ) kubjikāyai śirase svāhā /
hrīṃ krīṃ hrīṃ āṃ ṅa ña ṇa name śikhāyai vaṣaṭ /
aghorāmukhi kavacāya huṃ /
haiṃ haiṃ īṃ netratrayāya vauṣaṭ /
kilikili vicce astrāya phaṭ // GarP_1,26.3 //
(1) aiṃ hrīṃ śrīṃ akhaṇḍamaṇḍalākāramahāśūlamaṇḍalamāya namaḥ (2) aiṃ hrīṃ śrīṃ vāyumaṇḍalāya namaḥ /
(3) aiṃ hrīṃ śrīṃ somamaṇḍalāya namaḥ /
(4) aiṃ hrīṃ śrīṃ mahākulabodhāvalimaṇḍalāya namaḥ (5) aiṃ hrīṃ śrīṃ mahākaulamaṇḍalāya namaḥ /
(6) aiṃ hrīṃ śrīṃ gurumaṇḍalāya namaḥ (7) aiṃ hrīṃ śrīṃ sāmamaṇḍalāya namaḥ(8) aiṃ hrīṃ śrīṃ samagra (9)siddha (10)yogīnīpīṭhāpapīṭha (11) kṣetrepakṣetramahāsantānamaṇḍalāya namaḥ /
evaṃ maṇḍalānāṃ dvādaśakaṃ krameṇa pūjyam // GarP_1,26.4 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe ācārakāṇḍe karanyāsādinirūpaṇaṃ nāma ṣaḍviṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 27
sūta uvāca /
oṃ kaṇicikīṇikakrāṇī carvāṇī bhūtahāriṇi phaṇiviṣiṇi virathanārāyayaṇi ume dahadaha haste caṇḍe raudre māheśvari mahāmukhi jvālāmukhi śaṅkukarṇi śukamuṇḍe śatruṃ hanahana sarvanāśini svedaya sarvāṅgaśoṇitaṃ tannirīkṣāsi manasā devi saṃmohayasaṃmohaya rudrasya hṛdaye jātā rudrasya tdṛdaye sthitā /
rudro raudreṇa rūpeṇa tvaṃ devi rakṣarakṣa māṃ hrūṃ māṃ hrūṃ phaphapha ṭhaṭhaḥ skandamekhalābālagrahaśatruviṣahārī oṃ śāle māle harahara viṣoṅkārarahiviṣavege hāṃ hāṃ śavari huṃ śavari ākaulavegeśe sarve viñcameghamāle sarvanāgādiviṣaharaṇam // GarP_1,27.1 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe nāgādivividhaviṣahara mantranirūpaṇaṃ nāma saptaviṃśo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 28
sūta uvāca /
gopālapūjāṃ vakṣyāmi bhuktimuktipradāyinīm /
dvāre dhātā vidhātā ca gaṅgāyamunayā saha // GarP_1,28.1 /
śaṅkhapadmanidhī caiva sāraṅgaḥ śarabhaḥ śriyā /
pūrve bhadraḥ subhadro dvau dakṣe caṇḍapracaṇḍakau // GarP_1,28.2 //
paścime balaprabalau jayaśca vijayo yajet /
uttare śrīścaturdvāre gaṇo durgā sarasvatī // GarP_1,28.3 //
kṣetrasyāgnyādikoṇeṣu dikṣu nāradapūrvakam /
siddho gururnalakūvaraṃ koṇe bhagavataṃ yajet // GarP_1,28.4 //
pūrve viṣṇuṃ viṣṇutapo viṣṇuśaktiṃ samarcayet /
tato viṣṇuparīvāraṃ madhye śaktiṃ ca kūrṃmakam // GarP_1,28.5 //
anantaṃ pṛthivīṃ dharmaṃ jñānaṃ vairāgyamagnitaḥ /
aiśvaryaṃ vāyupūrvaṃ ca prakāśātmānamuttare // GarP_1,28.6 //
sattvāya prakṛtātmane rajase moharūpiṇe /
tamase kanda padmāya yajetkaṃ kākatattvakam // GarP_1,28.7 //
vidyātattvaṃ paraṃ tattva sūryeduvahnimaṇḍalam /
vimalādyā āsanaṃ ca prācyāṃ śrīṃ hrīṃ prapūjayet // GarP_1,28.8 //
gopījanavallabhāya svāhānto manurucyate /
aṅgāni yathā-āca kraṃ ca sucakraṃ ca vicakraṃ ca tathaica // GarP_1,28.9 //
trailokyarakṣakaṃ cakramasurārisudarśanam /
hṛdādipūrvakoṇaṣu astraṃ śaktiṃ ca pūrvataḥ // GarP_1,28.10 //
rukmiṇī satyabhāmā ca sunandā nāgnajityapi /
lakṣmaṇā mitravindā ca jāmbavatyā śuśīlayā // GarP_1,28.11 //
śaṅkhacakragadāpadmaṃ musalaṃ śārṅgamarcayet /
khaṅgaṃ pāśāṅkuśaṃ prācyāṃ śrīvatsaṃ kaustubhaṃ yajet // GarP_1,28.12 //
mukuṭaṃ valamālāṃ ca aindrādyāndhvajamukhyakān /
kumudādyānviṣvaksenaṃ śriyā kṛṣṇaṃ sahārcayet /
japyāddhyānātpūjanācca sarvānkāmānavānpuyāt /

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śrīgopālapūjānirūpaṇaṃ nāmāṣṭāviṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 29
hariruvāca /
trailokyamohinīṃ vakṣye puruṣottamamukhyakām /
pūjāmantrāñchrīdharādyāndharṃmakāmādidāyakān // GarP_1,29.1 //
oṃ hrīṃ śrīṃ klīṃ hrūṃ oṃ namaḥ /
puruṣottama apratirūpa lakṣmīnivāsa jagatkṣobhaṇa sarvastrīhṛdayadāraṇa tribhuvanamadonmādanakara surāsuramanuja suṃdarī janamanāṃsi tāpayatāpaya śoṣayaśoṣaya mārayamāraya stambhayastambhaya drāvayadrāvaya ākarṣaya ākarṣaya,paramasubhaga sarvasaubhāgyakara sarvakāmaprada amukaṃ hanahana cakreṇa gadayā khaḍgena sarvabāṇairbhidhibhindhi pāśena kuṭṭakuṭṭa aṅkuśena tāḍayatāḍaya turuturu kiṃ tiṣṭhasi tārayatāraya yāvatsamīhitaṃ me siddhaṃ bhavati hrīṃ (hrūṃ) phaṭ namaḥ // GarP_1,29.2 //
oṃ śrīṃ (śrīḥ) śrīdharāya trailokyamohanāya namaḥ /
klīṃ puruṣottamāya trailokyamohanāya namaḥ // GarP_1,29.3 //
oṃ viṣṇave trailokyamohanāya namaḥ /
oṃ śrīṃ klīṃ trailokyamohanāya vipṇave namaḥ // GarP_1,29.4 //
trailokyamohanā mantrāḥ sarve sarvārthasādhakāḥ /
sarve cintyā pṛthag vāpi vyāsātsaṃkṣepato 'tha vā // GarP_1,29.5 //
āsanaṃ mūrtimantraṃ ca homādyaṅgaṣaḍaṅgakam /
cakraṃ gadāṃ ca khaḍgaṃ ca musalaṃ śaṃmakhaśarṅgakam // GarP_1,29.6 //
śaraṃ pāśaṃ cāṅkuśaṃ ca lakṣmīgaruḍasaṃyutam /
viṣvaksenaṃ vistarādvānaraḥ sarvamavāpnuyāt // GarP_1,29.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāḍe trailokyamohinī(śrīdhara) pūjanavidhirnāmaikonatriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 30
sūta uvāca /
vistareṇa pravakṣyāmi śrīdharasyārcanaṃ śubham /
parivāraśca sarveṣāṃ samojñeyo hi paṇḍitaiḥ // GarP_1,30.1 //
oṃ śrāṃ hṛdayāya namaḥ /
oṃ śrīṃśirase svāhā /
oṃ śrū śikhāyai vaṣaṭū /
oṃ śraiṃ kavacāya huṃ /
oṃ śrauṃ netratrayāya vauṣaṭ /
oṃ śraḥ astrāya phaṭ iti // GarP_1,30.2 //
darśayedātmano mudrāṃ śaṅkhacakragadādikām /
dhyātvātmānaṃ śrīdharākhyaṃ śaṅkhacakragadādharam // GarP_1,30.3 //
tatastaṃ pūjayeddevaṃ maṇḍale svastikādike /
āsanaṃ pūjayedādau devadevasya śārṅgiṇaḥ /
ebirmantrairmahādeva tānmatrāñchṛṇu śaṅkara // GarP_1,30.4 //
oṃ śrīdharāsanadevatāḥ āgacchatā /
oṃ samastaparivārāyacyutāsanāya namaḥ // GarP_1,30.5 //
oṃ dhātre namaḥ /
oṃ vidhātre namaḥ /
oṃ gaṅgāyai namaḥ /
oṃ yamunāyai namaḥ /
oṃ ādhāraśaktayai namaḥ /
oṃ kūrṃmāya namaḥ /
oṃ anantāya namaḥ /
oṃ pṛthivyai namaḥ /
oṃ dharṃmāya namaḥ /
oṃ jñānāya namaḥ /
oṃ vairāgyāya namaḥ /
oṃ aiśvaryāya namaḥ /
oṃ adharṃmāya namaḥ /
oṃ ajñānāya namaḥ /
oṃ avairāgyāya namaḥ /
oṃ anaiśvaryāya namaḥ /
oṃ kandāya namaḥ /
oṃ nālāya namaḥ /
oṃ padmāya namaḥ /
oṃ vimalāyai namaḥ /
oṃ utkarṣiṇyai namaḥ /
oṃ jñānāyai namaḥ /
oṃ kriyāyai namaḥ /
oṃ yogāyai namaḥ /
oṃ prahvyai namaḥ /
oṃ satyāyai namaḥ /
oṃ īśānāyai namaḥ /
oṃ anugrahāyai namaḥ // GarP_1,30.6 //
arcayitvā samaṃ rudra harimāvāhya saṃyajet /
mantrairebhirmahāprājñaḥ sarvapāpapraṇāśanaiḥ // GarP_1,30.7 //
oṃ hrīṃ śrīdharāya trailokyamohanāya viṣṇave namaḥ āgaccha // GarP_1,30.8 //
oṃ śriyai namaḥ /
oṃ śrāṃ hṛdayāya namaḥ /
oṃ śrīṃ śirase namaḥ /
oṃ śrūṃ śikhāyai namaḥ /
oṃ śraiṃ kavacāya namaḥ /
oṃ śrauṃ netratrayāya namaḥ /
oṃ śraḥ astrāya namaḥ /
oṃ śaṅkhāya namaḥ /
oṃ padmāya namaḥ /
oṃ cakrāya namaḥ /
oṃ gadāyai namaḥ /
oṃ śrī vatsāya namaḥ /
oṃ kaustubhya namaḥ /
oṃ vanamālāyai namaḥ /
oṃ pītāmbarāya namaḥ /
oṃ vrahmaṇe namaḥ /
oṃ nāradāya namaḥ /
oṃ gurubhyo namaḥ /
oṃ indrāya namaḥ /
oṃ agnaye namaḥ /
oṃ yamāya namaḥ /
oṃ nirṛtaye namaḥ /
oṃ varuṇāya namaḥ /
oṃ vāyave namaḥ /
oṃ somāya namaḥ /
oṃ īśānāya namaḥ /
oṃ anantāya namaḥ /
oṃ brahmaṇe namaḥ /
oṃ sattvāya namaḥ /
oṃ rajase namaḥ /
oṃ tamase namaḥ /
oṃ viṣvaksenāya namaḥ // GarP_1,30.9 //
abhiṣekaṃ tathā vasttraṃ tato yajñopavītakam /
gandhaṃ puṣpaṃ tathā dhūpaṃ dīpamannaṃ pradakṣiṇam // GarP_1,30.10 //
dadyādebhirmahāmantraiḥ samapyārtha japenmanum /
śatamaṣṭottaraṃ cāpi japtvā hyatha samarpayet // GarP_1,30.11 //
tato muhūrtamekantudhyāyeddevaṃ hṛdi sthitam /
śuddhasphaṭikasaṃkāśaṃ sūryakoṭisamaprabham // GarP_1,30.12 //
prasannavadanaṃ saumyaṃ sphuranmakarakuṇḍalam /
kirīṭinamudārāṅgaṃ vanamālāsamanvitam // GarP_1,30.13 //
parabrahmasvarūpaṃ ca śrīdharaṃ cintayetsudhīḥ /
anena caiva stotreṇa stuvīta parameśvaram // GarP_1,30.14 //
śrīnivāsāya devāya namaḥ śrīpataye namaḥ /
śrīdharāya saśārṅgāya śrīpradāya namonamaḥ // GarP_1,30.15 //
śrīvallabhāya śāntāya śrīmate ca namonamaḥ /
śrīparvatanivāsāya namaḥ śreyaskarāya ca // GarP_1,30.16 //
śreyasāṃ pataye caiva hyāśramāya namonamaḥ /
namaḥ śreyaḥ svarūpāya śrīkarāya namonamaḥ // GarP_1,30.17 //
śaraṇyāya vareṇyāya namo bhūyo namonamaḥ /
stotraṃ kṛtvā namaskṛtya devadevaṃ visarjayet // GarP_1,30.18 //
iti rudra samākhyātā pūjā viṣṇormahātmanaḥ /
yaḥ karoti mahābhaktyā sa yāti paramaṃ padam // GarP_1,30.19 //
iṃ yaḥ paṭhate 'dhyāyaṃ viṣṇupūjāprakāśakam /
sa vidhūyeha pāpāni yāti viṣṇoḥ paraṃ padam // GarP_1,30.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śrīdharā (viṣṇvar) canavidhirnāma triṃśo 'dhyāyaḥ


_____________________________________________________________


śrī garuḍamahāpurāṇam- 31
rudra uvāca /
bhūya evaṃ jagannātha pūjāṃ kathaya me prabho /
yayā tareyaṃ saṃsārasāgaraṃ hyatidustaram // GarP_1,31.1 //
hariruvāca /
arcanaṃ viṣṇudevasya vakṣyāmi vṛṣabhadhvaja /
tacchṛṇuṣva mahābhāga bhuktimuktipradaṃ śubham // GarP_1,31.2 //
kṛtvā snānaṃ tataḥ sandhyāṃ tato yāgagṛhaṃ vrajet /
prakṣālya pāṇī pādau ca ācamya ca viśeṣataḥ // GarP_1,31.3 //
mūlamantraṃ samastaṃ tu hastayorvyāpakaṃ nyaset /
mūlamantraṃ ca devasya śṛṇu rudra vadāmi te // GarP_1,31.4 //
oṃ śrīṃ hrīṃ śrīdharāya viṣṇave namaḥ /
ayaṃ mantraḥ sureśasya viṣṇorīśasya vācakaḥ // GarP_1,31.5 //
sarvavyādhiharaścaiva sarvagrahaharastathā /
sarvapāpaharaścaiva buktimuktipradāyakaḥ // GarP_1,31.6 //
aṅganyāsaṃ tataḥ kuyyāndebhirmantraurvicakṣaṇaḥ /
oṃ hāṃ hṛdayāya namaḥ /
oṃ hīṃ śirase svāhā /
oṃ hūṃ śikhāyai vaṣaṭ /
oṃ haiṃ kavacāya huṃ /
oṃ hauṃ netratrayāya vauṣaṭ /
oṃ haḥ astrāya phaṭ // GarP_1,31.7 //
iti mantraḥ samākhyāto mayā te prabhaviṣṇunā /
nyāsaṃ kṛtvātmano mudrāṃ darśayedvijitātmavān // GarP_1,31.8 //
tato dhyāyetparaṃ viṣṇu tdṛtkoṭarasamāśritam /
śaṅkhacakrasamāyuktaṃ kundendudhavalaṃ harim // GarP_1,31.9 //
śrīvatsakaustubhayutaṃ vanamālāsamanvitam /
ratnahārakirīṭena saṃyuktaṃ parameśvaram // GarP_1,31.10 //
ahaṃ viṣṇuriti dhyātvā kṛtvā vai śodhanādikam /
yaṃ kṣaiṃ ramiti bījaiśca kaṭhinī kṛtya nāmabhiḥ // GarP_1,31.11 //
aṇḍamutpādya ca tataḥ praṇavenaiva bhedayet /
tatra pūrvoktarūpaṃ tu bhāvayitvā vṛṣadhvaja // GarP_1,31.12 //
ātmapūjāṃ tataḥ kuryādrandhapuṣpādibhiḥ śubhaiḥ /
āvāhya pūjayetsarvā devatā āsanasya yāḥ // GarP_1,31.13 //
mantrairebhirmahādeva tanmantraṃ śṛṇu śaṅkara /
viṣṇavāsanadevatā āgacchata // GarP_1,31.14 //
oṃ samastaparivārāyācyutāya namaḥ /
oṃ dhātre namaḥ /
oṃ vidhātre namaḥ /
oṃ gaṅgāyai namaḥ /
oṃ yamunāyai namaḥ /
oṃ śaṅkhanidhaye namaḥ /
oṃ padmanidhaye namaḥ /
oṃ caṇḍāya namaḥ /
oṃ pracaṇḍāya namaḥ /
oṃ dvāraśriyai namaḥ /
oṃ ādhāraśaktyai namaḥ /
oṃ kūrṃmāya namaḥ /
oṃ anantāya namaḥ /
oṃ śriyai namaḥ /
oṃ dharṃmāya namaḥ /
oṃ jñānāya namaḥ /
oṃ vairāgyāya namaḥ /
oṃ aiśvaryāya namaḥ /
oṃ adharṃmāya namaḥ /
oṃ ajñānāya namaḥ /
oṃ avairāgyāya namaḥ /
oṃ anaiśvaryāya namaḥ /
oṃsaṃ sattvāya namaḥ /
oṃ raṃ rajase namaḥ /
oṃ taṃ tamase namaḥ /
oṃ kaṃ kandāya namaḥ /
oṃ naṃ nālāya namaḥ /
oṃ lāṃ padmāya namaḥ /
oṃ aṃ arkamaṇḍalāya namaḥ /
oṃ soṃ somamaṇḍalāya namaḥ /
oṃ vaṃ vahnimaṇḍalāya namaḥ /
oṃ vimalāyai namaḥ /
oṃ utkarṣiṇyai namaḥ /
oṃ jñānāyai namaḥ /
oṃ kriyāyai namaḥ /
oṃ yogāyai namaḥ /
oṃ prahvyai namaḥ /
oṃ satyāyai namaḥ /
oṃ īśānāyai namaḥ /
oṃ anugrahāyai namaḥ // GarP_1,31.15 //
gandhapuṣpādibhistvetairmantrairetāstu pūjayet /
pūjayitvā tato viṣṇuṃ sṛṣṭisaṃhārakāriṇam // GarP_1,31.16 //
āvāhya maṇḍale rudra pūjayetpa rameśvaram /
anena vidhinā rudra sarvapāpaharaṃ param // GarP_1,31.17 //
yathātmani tathā deve nyāsaṃ kurvīta cāditaḥ /
mudrāṃ pradarśayetpaścādarghyādīnarpayettataḥ // GarP_1,31.18 //
snānāṃ kuryāttato vastraṃ dadyādācamanaṃ tataḥ /
gandhapuṣpaṃ tathā dhūpaṃ dīpaṃ dadyāccaruṃ tataḥ // GarP_1,31.19 //
pradakṣiṇaṃ tato japyaṃ tatastasminsarpayet /
aṅgādīnāṃ svamantraiśca pūjāṃ kurvīta sādhakaḥ // GarP_1,31.20 //
devasya mūlamantreṇetyevaṃ viddhi vṛṣadhvaja /
mantrāñchṛṇu trinetra tvaṃ kathyamānānmayādhunā // GarP_1,31.21 //
oṃ hāṃ hṛdayāya namaḥ /
oṃ hīṃ śirase namaḥ /
oṃ hūṃ śikhāyai namaḥ /
oṃ haiṃ kavacāya namaḥ /
oṃ hauṃ netratrayāya namaḥ /
oṃ haḥ astrāya namaḥ /
oṃ śriyai namaḥ /
oṃ śaṅkāya namaḥ /
oṃ padmāya namaḥ /
oṃ cakrāya namaḥ /
oṃ gadāyainamaḥ /
oṃ śrīvatsāya namaḥ /
oṃ kaustubhāya namaḥ /
oṃ vanamālāyai namaḥ /
oṃ pītāmbarāya namaḥ /
oṃ khaḍgāya namaḥ /
oṃ musalāya namaḥ /
oṃ pāśāya namaḥ /
oṃ aṅkuśāya namaḥ /
śārṅgāya namaḥ /
oṃ śarāya namaḥ /
oṃ brahmaṇe namaḥ /
oṃ nārādāya namaḥ /
oṃ pūrvasiddhebhyo namaḥ /
oṃ bhāgavatebhyo namaḥ /
oṃ gurubhyo namaḥ /
oṃ paramagurubhyo namaḥ /
oṃ indrāya surādhipataye savāhanaparivārāya namaḥ /
oṃ agnaye tejo 'dhipataye savāhanaparivārāya namaḥ /
oṃ yamāya pretādhipataye savāhanaparivārāya namaḥ /
oṃ nirṛtaye rakṣo 'dhipataye savāhanaparivārāya namaḥ /
oṃ varuṇāya jalādhipataye savādanaparivārāya namaḥ /
oṃ vāyave prāṇādhipataye savāhanaparivārāya namaḥ /
oṃ somāya nakṣatrādhipataye savāhanaparivārāya namaḥ /
oṃ īśānāya vidyādhipataye savāhanaparivārāya namaḥ /
oṃ anantāya nāgādhipataye savāhanaparivārāya namaḥ /
oṃ brahmaṇe lokādhipataye savāhanaparivārāya namaḥ /
oṃ vajrāya huṃ phaṭ namaḥ /
oṃ śaktyai huṃ phaṭ namaḥ /
oṃ daṇḍāya huṃ phaṭ namaḥ /
oṃ khaḍgāya huṃ phaṭ namaḥ /
oṃ pāśāya huṃ phaṭ namaḥ /
oṃ dhvajāya huṃ phaṭ namaḥ /
oṃ gadāyai huṃ phaṭ namaḥ /
oṃ triśūlāya huṃ phaṭ namaḥ /
oṃ cakrāya huṃ phaṭ namaḥ /
oṃ padmāya huṃ phaṭ namaḥ /
oṃ vaiṃ viṣvaksenāya namaḥ // GarP_1,31.22 //
ebhimantrairmahādeva pūjyā aṅgādayo naraiḥ /
pūjayitvā mahātmānaṃ viṣṇuṃ brahmasvarūpiṇam // GarP_1,31.23 //
stuvīta cānayā stutyā paramātmānamavyayam /
viṣṇave devadevāya namo vai prabhaviṣṇave // GarP_1,31.24 //
viṣṇave vāsudevāya namaḥ sthitikarāya ca /
grasiṣṇave namaścaiva namaḥ pralayaśāyine // GarP_1,31.25 //
devānāṃ prabhave caiva yajñānāṃ prabhave namaḥ /
munīnāṃ prabhave nityaṃ yakṣāṇāṃ prabhaviṣṇave // GarP_1,31.26 //
jiṣṇave sarvadevānāṃ sarvagāya mahātmane /
brahmendrarudravandyāya sarveśāya namonamaḥ // GarP_1,31.27 //
sarvalokahitārthāya lokādhyakṣāya vai namaḥ /
sarvagoptre sarvakartre sarvaduṣṭavināśine // GarP_1,31.28 //
varapradāya śāntāya vareṇyāya namonamaḥ /
śaraṇyāya surūpāya dharmakāmārthadāyine // GarP_1,31.29 //
stutvā dhyāyetsvahṛdaye brahmarūpiṇamavyayam /
elaṃ tu pūjayedviṣṇuṃ mūlamantreṇa śaṅkara // GarP_1,31.30 //
mūlamantraṃ japedvāpi yaḥ sa yāti naro harim /
etatte kathitaṃ rudra viṣṇorarcanamuttamam // GarP_1,31.31 //
rahasyaṃ paramaṃ guhyaṃ bhuktimuktipradaṃ param /
etadyaśca paṭhedvidvānviṣṇubhaktaḥ pumānhara /
śṛṇuyācchrāvayedvāpi viṣṇulokaṃ sa gacchati // GarP_1,31.32 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇupūjāvidhirnāmaikatriṃśodhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 32
maheśvara uvāca /
pañcatattvārcanaṃ brūhi śaṅkhacakragadādhara /
yena vijñānamātreṇa naro yāti paraṃ padam // GarP_1,32.1 //
hariruvāca /
pañcatattvārcanaṃ vakṣye tava śaṅkara suvrata /
maṅgalyaṃ maṅgalaṃ divyaṃ rahasyaṃ kāmadaṃ param // GarP_1,32.2 //
tacchṛṇuṣva mahādeva pavitraṃ kalināśanam /
eka evāvyayaḥ śāntaḥ paramātmā sanātanaḥ // GarP_1,32.3 //
vāsudevo dhruvaḥ śuddhaḥ sarvavyāpī nirañjanaḥ /
sa eva māyāyā deva pañcadhā saṃsthito hariḥ // GarP_1,32.4 //
lokānugrahakṛdviṣṇuḥ sarvaduṣṭavināśanaḥ /
vāsudevasvarūpeṇa tathā saṅkarṣaṇena ca // GarP_1,32.5 //
tathā pradyumnarūpeṇāniruddhākhyena ca sthitaḥ /
nārāyaṇasvarūpeṇa pañcadhā hyadvayaḥ sthitaḥ // GarP_1,32.6 //
eteṣāṃ vācakānmantrānetāñchṛṇu vṛṣadhvaja ! /
oṃ aṃ vāsudevāya namaḥ /
oṃ āṃ saṃkarṣaṇāya namaḥ /
oṃ aṃ pradyumnāya namaḥ /
oṃ aniruddhāya namaḥ /
oṃ oṃ nārāyaṇāya namaḥ // GarP_1,32.7 //
pañca mantrāḥ samākhyātā devānāṃ vācakāstava /
sarvapāpaharāḥ puṇyāḥ sarvarogavināśanāḥ // GarP_1,32.8 //
adhunā saṃpravakṣyāmi pañcatattvārcanaṃ śubham /
vidhinā yena kartavyaṃ yairvā mantraiśca śaṅkara ! // GarP_1,32.9 //
ādau snānaṃ prakurvīta snātvā sandhyāṃ samācaret /
arcanāgāramāsādya prakṣālyārṅghyādikaṃ tathā // GarP_1,32.10 //
ācamyopaviśetprājño baddhāsanamabhīpsitam /
śoṣaṇādi tataḥ kuryād aṃ kṣaiṃ ramiti mantrakaiḥ // GarP_1,32.11 //
sāmānyaṃ kaṭhinīkṛtya cāṇḍamutpādayettataḥ /
vibhidyāṇḍaṃ tato hyaṇḍe bhāvayetparameśvaram // GarP_1,32.12 //
vāsudevaṃ jagannāthaṃ pītakauśeyavāsasam /
sahasrādityasaṅkāśaṃ sphuranmakarakuṇḍalam // GarP_1,32.13 //
ātmano hṛdi padme tu dhyāyettu parameśvaram /
tataḥ saṃkarṣaṇaṃ devamātmānaṃ cintayetprabhum // GarP_1,32.14 //
pradyumnamaniruddhaṃ ca śrīmannārāyaṇaṃ tataḥ /
indrādīṃśca surāṃstasmāddevadevātsamutthitān // GarP_1,32.15 //
cintayecca tato nyāsaṃ kayyāndvai kārayordvayoḥ /
vyāpakaṃ mūlamantreṇa cāṅganyāsaṃ tataḥ param // GarP_1,32.16 //
aṅgamantrairmahādeva ! tānmantrāñśṛṇu suvrata ! /
oṃ āṃ hṛdayāya namaḥ /
oṃ īṃ śirase namaḥ /
oṃ ūṃ śikhāyai namaḥ /
oṃ aiṃ kavacāya namaḥ /
oṃ auṃ netratrayāya namaḥ /
oṃ aḥ astrāya phaṭ // GarP_1,32.17 //
oṃ samastaparivārāyācyutāya namaḥ /
oṃ dhātre namaḥ /
oṃ vidhātre namaḥ /
oṃ ādhāraśaktayai namaḥ /
oṃ kūrmāya namaḥ /
oṃ anantāya namaḥ /
oṃ pṛthivyainamaḥ /
oṃ dharmāya namaḥ /
oṃ dharmāya namaḥ /
oṃ jñānāya namaḥ /
oṃ vairāgyāya namaḥ /
oṃ aiśvaryāya namaḥ /
oṃ ajñānāya namaḥ /
oṃ anaiśvaryāya namaḥ /
oṃ aṃ arkamaṇḍalāya namaḥ /
oṃ soṃ somamaṇāḍalāya namaḥ /
oṃ vaṃ vahnimaṇḍalāya namaḥ /
oṃ vaṃ vāsudevāya parabrahmaṇe śivāya tejorūpāya vyāpine sarvadevādhidevāya namaḥ /
oṃ pāñcajanyāya namaḥ /
oṃ sudarśavanāya namaḥ /
oṃ gadāyai namaḥ /
oṃ padmāya namaḥ /
oṃ śriyai namaḥ /
oṃ hriyai namaḥ /
oṃ puṣṭyai namaḥ /
oṃ gītyai namaḥ /
oṃ śaktyai namaḥ /
oṃ prītyai namaḥ /
oṃ indrāya namaḥ /
oṃ agnaye namaḥ /
oṃ yamāya namaḥ /
oṃ nirṛtaye namaḥ /
oṃ varuṇāya namaḥ /
oṃ vāyave namaḥ /
oṃ somāya namaḥ /
oṃ īśānāya namaḥ /
oṃ anantāya namaḥ /
oṃ brahmaṇe namaḥ /
oṃ viṣvaksenāya namaḥ // GarP_1,32.18 //
ete mantrāḥ samākhyātāstava rudra samāsataḥ /
pūjā caiva prakartavyā maṇḍale svastikādike // GarP_1,32.19 //
oṃ padmāya namaḥ /
aṅganyāsaṃ ca kṛtvā tu mudrāḥ sarvāḥ pradaśayat /
ātmānaṃ vāsudevaṃ ca dhyātvā caiva pareśvaram // GarP_1,32.20 //
āsanaṃ pūjayetpaścādāvāhya vidhivannaraḥ /
dvāre dhāturvidhātuśca pūjā kāryā vṛṣadhvaja // GarP_1,32.21 //
garuḍaṃ pūjayedagre vāsudevasya śaṅkara /
śaṅkhādipadmaparyantaṃ madhyadeśe prapūjayet // GarP_1,32.22 //
dharmaṃ jñānaṃ ca vairāgyamaiśvaryaṃ pūrvadeśataḥ /
āgneyādiṣvarcayedvai adharmādicatuṣṭayam // GarP_1,32.23 //
maṇḍalatrayamadhye tu kīrtitā hyasanasthitiḥ /
pūrvādipadmapatreṣu pūjyāḥ saṃkarṣaṇādayaḥ // GarP_1,32.24 //
karṇikāyāṃ vāsudevaṃ pūjayetparameśvaram /
pāñcajanyādayaḥ pūjyāḥ aiśānyādiṣu saṃsthitāḥ // GarP_1,32.25 //
śaktayaścaiva pūrvādau devadevasya śaṅkara /
indrādayo lokapālāḥ pūjyāḥ pūrvādiṣu sthitāḥ // GarP_1,32.26 //
adho nāga tadūddhva tu brahmāṇaṃ pūjayetsudhīḥ /
iti sthānakramo jñeyo maṇḍale śaṅkara tvayā // GarP_1,32.27 //
āvāhya maṇḍale devaṃ kṛtvā nyāsaṃ tu tasya ca /
mudrāṃ pradarśya pādyadīndadyānmūlena śaṅkara // GarP_1,32.28 //
snānaṃ vastraṃ tathācāmaṃ gandhaṃ puṣpaṃ ca dhūpakam /
dīpaṃ naivedyamācāmaṃ namaskāraṃ pradakṣiṇam /
kuryācchaṅkara mūlena japaṃ cāpi samarpayet // GarP_1,32.29 //
daṃ stotraṃ japetpaścādvāsudevamanusmaran /
oṃ namo vāsudevāya namaḥ sakarṣaṇāya ca // GarP_1,32.30 //
pradyumnāyādidevāyāniruddhāya namonamaḥ /
namo nārāyaṇāyaiva narāyaṇāṃ pataye namaḥ // GarP_1,32.31 //
narapūjyāya kīrtyāya stutyāya varadāya ca /
anādinidhanāyaiva purāṇāya namonamaḥ // GarP_1,32.32 //
sṛṣṭisaṃhārakartre ca brahmaṇaḥ pataye namaḥ /
mano vai vedavedyāya śaṅkhacakradharāya ca // GarP_1,32.33 //
kalikalmaṣahartre ca sureśāya namonamaḥ /
saṃkāravṛkṣacchetre ca māyābhetre namonamaḥ // GarP_1,32.34 //
vahurūpāya tīrthāya triguṇāyāguṇāya ca /
brahmaviṣṇavīśarūpaya mokṣadāya namonamaḥ // GarP_1,32.35 //
mokṣadvārāya dharmāya nirmāṇāya namonamaḥ /
sarvakāmapradāyaiva parabrahmasvarūpiṇe // GarP_1,32.36 //
saṃsārasāgare ghore nimagnaṃ māṃ samuddhara /
tvadanyo nāsti deveśa nāsti trātā jagatprabho // GarP_1,32.37 //
tvāmava sarvagaṃ viṣṇuṃ gato 'haṃ śaraṇaṃ gataḥ /
jñānadīpapradānena tamomuktaṃ prakāśaya // GarP_1,32.38 //
evaṃ stuvīta deveśaṃ sarvakleśavināśanam /
anyaiścavādakeḥ stātraiḥ stutvā vai nīlalohita // GarP_1,32.39 //
pañcatattvasamāyuktaṃ dhyāyodviṣṇuṃ naro hṛdi /
visarjayattatā devamiti pūjā prakīrtitā // GarP_1,32.40 //
sarvakāmapradā śreṣṭhā vāsudevasya śaṅkara /
etatpūjanamātreṇa kṛtakṛtyo bhavennaraḥ // GarP_1,32.41 //
idaṃ ca yaḥ paṭhedrudra pañcatattvārcanaṃ naraḥ /
śṛṇuyācchravāyedvāpi viṣṇulokaṃ sa gacchati // GarP_1,32.42 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pañcatattvā(viṣṇavar) ca navidhirnāma dvātriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 33
rudra uvāca /
sudarśanasya pūjāṃ me vada śaṅkhagadādhara /
graharogādikaṃ sarvaṃ yatkṛtvā nāśameti vai // GarP_1,33.1 //
hariruvāca /
sudarśanasya cakrasya śṛṇu pūjāṃ vṛṣadhvaja /
snānamādau prakurvīta pūjayecca hariṃ tata // GarP_1,33.2 //
mūlamantreṇa vai nyāsaṃ mūlamantraṃ śṛṇuṣvaca /
sahasrāraṃ huṃ phaṭ namo mantraḥ praṇavapūrvakaḥ // GarP_1,33.3 //
kathitaḥ sarvaduṣṭānāṃ nāśako mantrabhedakaḥ /
dhyāyetmudarśanaṃ devaṃ hṛdi padme 'male śubhe // GarP_1,33.4 //
śaṅkacakragadāpadmadharaṃ saumyaṃ kirīṭinam /
āvāhya maṇḍale devaṃ pūrvoktavidhinā hara // GarP_1,33.5 //
pūjayedrandhapuṣpādyairupacārairmaheśvara /
pūjayitvā japenmantraṃ śatamaṣṭottaraṃ naraḥ // GarP_1,33.6 //
evaṃ yaḥ kurute rudra ! cakrasyārcanamuttamam /
sarvarogavinirmukto viṣṇulokaṃ samāpnuyāt // GarP_1,33.7 //
etatstotraṃ japetpaścātsarvavyādhivināśanam /
namaḥ sudarśanāyaiva sahasrādityavarcase // GarP_1,33.8 //
jvālāmālāpradīptāya sahasrārāya cakṣuṣe /
sarvaduṣṭavināśāya sarvapātakamardine // GarP_1,33.9 //
sucakrāya vicakrāya sarvamantravibhedine /
prasavitre jagaddhātre jagadvidhvaṃsine namaḥ // GarP_1,33.10 //
pālanārthāya lokānāṃ duṣṭāsuravināśine /
ugrāya caiva saumyāya caṇḍāya ca namonamaḥ // GarP_1,33.11 //
namaścakṣuḥ kvarūpāya saṃsārabhayabhedine /
māyāpañjarabhetre ca śivāya ca namonamaḥ // GarP_1,33.12 //
grahātigraharūpāya grahāṇāṃ pateya namaḥ /
kālāya mṛtyave caiva bhīmāya ca namonamaḥ // GarP_1,33.13 //
bhaktānugrahadātre ca bhaktagoptre namonamaḥ /
viṣṇurūpāya śāntāya cāyudhānāṃ dharāya ca // GarP_1,33.14 //
viṣṇuśastrāya cakrāya namo bhūyo namonamaḥ /
iti stotraṃ mahāpuṇyaṃ cakrasya tava kīrtitam // GarP_1,33.15 //
yaḥ paṭhetparayā bhaktyā viṣṇulokaṃ sa gacchati /
cakrapūjāvidhiṃ yaśca paṭhedrudra jitondriyaḥ /
sa pāpaṃ bhasmasātkṛtvā viṣṇulokāya kalpate // GarP_1,33.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sudarśanapūjāvidhirnāma trayastriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 34
rudra uvāca /
punardevārcanaṃ brūhi hṛṣīkeśa gadādhara /
śṛṇvato nāsti tṛptirme gadatastava pūjanam // GarP_1,34.1 //
hariruvāca /
hayagrīvasya devasya pūjanaṃ kathayāmi te /
tacchṛṇuṣva jagannātho yena viṣṇuḥ pratuṣyati // GarP_1,34.2 //
mūlamantraṃ mahādeva hayagrīvasya vācakam /
pravakṣyāmi paraṃ puṇyaṃ tadādau śṛṇu śaṅkara // GarP_1,34.3 //
oṃ saiṃ kṣaiṃ śirase namaḥ iti praṇavasaṃyutaḥ /
ayaṃ navākṣaromantraḥ sarvavidyāpradāyakaḥ // GarP_1,34.4 //
asyāṅgāni mahādeva tāñchṛṇuṣva vṛṣadhvaja /
oṃ kṣāṃ hṛdayāya namaḥ /
oṃ kṣīṃ śirase svāhāśiraḥ proktaṃ kṣūṃ vaṣaṭ tathā // GarP_1,34.5 //
oṃ kārayuktā devasya śikhā jñeyā vṛṣadhvaja /
oṃ kṣaiṃ kavacāya huṃ vai kavacaṃ parikīrtitam // GarP_1,34.6 //
oṃ kṣaiṃ netratrayāya vauṣaṭ netraṃ devasya kīrtitam /
oṃ haḥ astrāya phaṭ astraṃ devasya kīrtitam // GarP_1,34.7 //
pūjāvidhiṃ pravakṣyāmi nanme nigadataḥ śṛṇu ādau snātvā tathācamya tato yāgagṛhaṃ vrajet // GarP_1,34.8 //
tataḥ praviśya vidhivatkuryādvaṃ śoṣaṇādikam /
yaṃ kṣaiṃ ramiti bījaiśca kaṭhinīkṛtya lamiti // GarP_1,34.9 //
aṇḍamutpādya ca tataḥ oṃ kāreṇaiva bhedayet /
aṇḍamadhye hayagrīvamātmānaṃ paricintayet // GarP_1,34.10 //
śaṅkhakundendudhavalaṃ mṛṇālarajataprabham /
gokṣīrasadṛśaṃ tadvatsūryakoṭisamagrabham /
śaṅkhaṃ cakraṃ gadāṃ padmaṃ dhārayantaṃ caturbhujam // GarP_1,34.11 //
kirīṭinaṃ kuṇḍalinaṃ vanamālāsamaṃnvitam /
sucakraṃ sukapolaṃ ca ṣītāmbaradharaṃ vibhum // GarP_1,34.12 //
bhāvayitvā mahātmānaṃ sarvadevaiḥ samanvitam /
aṅgamantraistato nyāsaṃ mūlamantreṇa vai tathā // GarP_1,34.13 //
tataśca darśayenmudrāṃ śaṅkhapadmādikāṃ śubhām /
dhyāyeddhyātvārcayedviṣṇuṃ mūlamantreṇa śaṅkara // GarP_1,34.14 //
tataścāvāhayedrudra devatā āsanasya yāḥ /
oṃ hayagrīvāsanasya āgacchata ca devatāḥ // GarP_1,34.15 //
āvāhya maṇḍale tāstu pūjayetsvastikādike /
dvāre dhāturvidhātuśca pūjā kāryā vṛṣadhvaja // GarP_1,34.16 //
samastaparivārāya acyutāya nama iti /
asya madhyer'canaṃ kāryaṃ dvāre gaṅgāñca pūjayet // GarP_1,34.17 //
yamunāṃ ca mahādevīṃ śaṅkhapadmanidhī tathā /
garuḍaṃ pūjayedagre madhye śaktiñca pūjayet // GarP_1,34.18 //
ādhārākhyāṃ mahādeva tataḥ kūrmaṃ samarcayet /
anantaṃ pṛthivīṃ paścāddharmajñāne(nau) tato 'cayet // GarP_1,34.19 //
vairāgyamatha caiśvaryamāgneyādiṣu pūjayet /
adharmājñānāvairāgyānaiśrargyādīṃstu pūrvataḥ // GarP_1,34.20 //
sattvaṃ rajastamaścaiva madhyadeśe 'tha pūjayet /
kandaṃ nālaṃ ca padmaṃ ca madhye caiva prapūjayet // GarP_1,34.21 //
arkasomāgnisaṃjñānāṃ maṇḍalānāṃ hi pūjanam /
madhyadeśe prakartavyamiti rudra prakīrtitam // GarP_1,34.22 //
vimalotkarṣiṇī jñānā kriyāyoge vṛṣadhvaja /
prahvī satyā tatheśānānugrahau śaktayo hyamūḥ // GarP_1,34.23 //
pūrvādiṣu ca patreṣu pūjyāśca vimalādayaḥ /
anugrahā karṇikāyāṃ pūjyā śreyo 'rthibhirnaraiḥ // GarP_1,34.24 //
praṇavādyairnamo 'ntaiśca caturthyantaiśca nāmabhiḥ /
mantrairebhirmahādeva āsanaṃ paripūjayet // GarP_1,34.25 //
snānagandhapradānena puṣpadhūpapradānataḥ /
dīpanaivedyadānena āsanasyārcanaṃ śubham // GarP_1,34.26 //
kartavyaṃ vidhinānena iti te hara kīrtitam /
tataścāvāhayeddevaṃ hayagrīvaṃ sureśvaram // GarP_1,34.27 //
vāmanāsāpuṭenaiva āgacchantaṃ vicintayet /
āgacchataḥ prayogeṇa mūlamantreṇa śaṅkara // GarP_1,34.28 //
āvāhanaṃ prakartavyaṃ devadevasya śaṅkhinaḥ /
āvāhyamaṇḍale tasya nyāsaṃ kuryādatandritaḥ // GarP_1,34.29 //
nyāsaṃ kṛtvā ca tatrasthaṃ cintayetparameśvaram /
hayagrīvaṃ mahādevaṃ surāsuranamaskṛtam // GarP_1,34.30 //
indrādilokapālaiśca saṃyuktaṃ viṣṇumavyayam /
dyātvā pradarśayenmudrāḥ śaṅkhacakrādikāḥ śubhāḥ // GarP_1,34.31 //
pādyārghyācamanīyāni tato dadyācca viṣṇave /
snāpayecca tato devaṃ padmanābhamanāmayam // GarP_1,34.32 //
devaṃ saṃsthāpya vidhivadvastraṃ dadyādvṛṣadhvaja /
tato hyācamanaṃ dadyādupavītaṃ tataḥ śubham // GarP_1,34.33 //
tataśca maṇḍale rudra dhyāyeddevaṃ pareśvaram /
dhyātvā pādyādikaṃ bhūyo dadyāddevāya śaṅkara // GarP_1,34.34 //
dadyādbhairavadevāya mūlamantreṇa śaṅkara /
oṃ kṣāṃ hṛdayāya namaḥ anena hṛdayaṃ yajet // GarP_1,34.35 //
oṃ kṣīṃ śirase namaśca śirasaḥ pūjanaṃ bhavet /
oṃ kṣūṃ śikhāyai namaśca śikhāmetena pūjayet // GarP_1,34.36 //
oṃ kṣaiṃ kavacāya namaḥ kavacaṃ paripūjayet /
oṃ kṣaiṃ netrāya namaśca netraṃ cānena pūjayet // GarP_1,34.37 //
oṃ kṣaḥ astrāya nama iti astraṃ cānena pūjayet /
hṛdayaṃ ca śiraścaiva śikhāṃ ca kavacaṃ tathā // GarP_1,34.38 //
pūrvādiṣu pradeśeṣu hyetāstu paripūjayet /
koṇeṣvastraṃ yajedrudra netraṃ madhyai prapūjayet // GarP_1,34.39 //
pūjayetparamāṃ devīṃ lakṣmīṃ lakṣmīpradāṃ śubhām /
śaṅkhaṃ padmaṃ tathā cakraṃ gadāṃ pūrvāditor'cayet // GarP_1,34.40 //
khaḍgaṃ ca musalaṃ pāśamaṅkuśaṃ saśaraṃ dhanuḥ /
pūjayetpūrvato rudra ebhirmantraiḥ svanāmakaiḥ // GarP_1,34.41 //
śrīvatsaṃ kaustubhaṃ mālāṃ tathā pītāmbaraṃ śubham /
pūjayetpūrvato rudra śaṅkhacakragadādharam // GarP_1,34.42 //
brahmāṇaṃ nāradaṃ siddhaṃ guruṃ paraguruṃ tathā /
gurośca pāduke tadvatparamasya gurostathā // GarP_1,34.43 //
indraṃ savāhanaṃ cātha parivārayutaṃ tathā /
agniṃ yamaṃ nirṛtiṃ ca varuṇaṃ vāyumeva ca // GarP_1,34.44 //
somamīśānamevaṃ vai brahmāṇaṃ paripūjayet /
pūrvādikordhvaparyantaṃ pūjayedvṛṣabhadhvaja // GarP_1,34.45 //
vajraṃ śaktiṃ tathā daṇḍaṃ khaṅgaṃ pāśaṃ dhvajaṃ gadām /
triśūlaṃ cakrapadme ca āyudhānyatha pūjayet // GarP_1,34.46 //
viṣvaksenaṃ tato devamaiśānyāṃ diśi pūjayet /
ebhirmantrairnamo 'ntaiśca praṇavādyairvṛṣadhvaja // GarP_1,34.47 //
pūjā kāryā mahādeva hyanantasya vṛṣadhvaja /
devasya mūlamantreṇa pūjā kāryā vṛṣadhvaja // GarP_1,34.48 //
gandhaṃ puṣpaṃ tathā dhūpaṃ dīpaṃ naivedyameva ca /
pradakṣiṇaṃ namaskāraṃ japyaṃ tasmai samarpayet // GarP_1,34.49 //
stuvīta cānyā stutyā praṇavādyairvṛṣadhvaja /
oṃ namo hayaśirase vidyādhyakṣāya vai namaḥ // GarP_1,34.50 //
namo vidyāsvarūpāya vidyādātre namonamaḥ /
namaḥ śāntāya devāya triguṇāyātmane namaḥ // GarP_1,34.51 //
surāsuranihantre ca sarvaduṣṭavināśine /
sarvalokādhipataye brahmarūpāya vai namaḥ // GarP_1,34.52 //
namaśceśvaravandyāya śaṅkacakradhāraya ca /
nama ādyāya dāntāya sarvasattvahitāya ca // GarP_1,34.53 //
triguṇāyāguṇāyaiva brahmaviṣṇusvarūpiṇe /
kartre hartre sureśāya sarvagāya namonamaḥ // GarP_1,34.54 //
ityevaṃ saṃstavaṃ kṛtvā devadevaṃ vicintayet /
hṛtpadme vimale rudra śaṅkhacakragadādharam // GarP_1,34.55 //
sūryakoṭipratīkāśaṃ sarvāvayavasundaram /
hayagrīvomahīśeśaṃ paramātmānamavyayam // GarP_1,34.56 //
iti te kathitā pūjā hayagrīvasya śaṅkara /
yaḥ paṭhetparayā bhaktyā sa gacchetparamaṃ padam // GarP_1,34.57 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe hayagrīvapūjāvidhirnāma catustriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 35
hariruvāca /
nyāsādikaṃ pravakṣyāmi gāyattryāḥ śṛṇu śaṅkara /
viśvāmitraṛṣiścaiva savitā cātha devatā // GarP_1,35.1 //
brahmaśīrṣā rudraśikhā viṣṇorhṛdayasaṃśritā /
viniyogaikanayanā kātyāyanasagotrajā // GarP_1,35.2 //
trailokyacaraṇā jñeyā pṛthivīkukṣisaṃsthitā /
evaṃ jñātvā tu gāyattrīṃ japeddvādaśalakṣakam // GarP_1,35.3 //
tripadāṣṭākṣarā jñeyā catuṣpādā ṣaḍakṣarā /
jepa ca tripadā groktā arcane ca catuṣpadā // GarP_1,35.4 //
nyāse jape tathā dhyāne agnikārye tathārcane /
gāyattrīṃ vinyasennityaṃ sarvapāpagraṇāśinīm // GarP_1,35.5 //
pādāṃsuṣṭhe gulphamadhye jaṅghayorviddhi jānunoḥ /
ūrvorguhye ca vṛṣaṇe nāḍyāṃ nābhau tanūdare // GarP_1,35.6 //
stanayorhṛdi kaṇṭhauṣṭhamukhe tāluni cāṃsayoḥ /
netre bhuvārlalāṭe ca pūrvasyāṃ dakṣiṇottare // GarP_1,35.7 //
paścame mūrdhni cākāraṃ nyasedvarṇānvadāmyaham /
indranīlaṃ ca vahniṃ ca pītaṃ śyāmaṃ ca kāpilam // GarP_1,35.8 //
śvetaṃ vidyutprabhaṃ tāraṃ kṛṣṇaṃ raktaṃ krameṇa tat /
śyāmaṃ śuklaṃ tathā pītaṃ śvetaṃ vai padmarāgavat // GarP_1,35.9 //
śaṅkhavarṇaṃ pāṇḍuraṃ ca raktaṃ cāsavasannibham /
arkavarṇasamaṃ saumyaṃ śaṅkhābhaṃ śvetameva ca // GarP_1,35.10 //
yadyatspṛśati hastena yacca paśyati cakṣuṣā /
pūtaṃ bhavati tatsarvaṃ gāyattryā na paraṃ viduḥ // GarP_1,35.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gāyattrīnyāsanirūpaṇaṃ nāma pañcatriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 36
hariruvāca /
sandhyāvidhiṃ pravakṣyāmi śṛṇu rudrāghanāśanam /
prāṇāyāmatrayaṃ kṛtvā sandhyāsnānamupakramet // GarP_1,36.1 //
sapraṇavāṃ savyāhṛtiṃ gāyattrīṃ śirasā saha /
triḥ paṭhedāyatapraṇaḥ prāṇāyāmaḥ sa ucyate // GarP_1,36.2 //
manovākrāyajaṃ doṣaṃ prāṇāyāmairdaheddvijaḥ /
tasmātsarveṣu kāleṣu prāṇāyāmaparo bhavet // GarP_1,36.3 //
sāyamagniśca metyuktā prātaḥ sūryetyapaḥ pibet /
āpaḥ punantu madhyāhne upaspṛśya yathāvidhi // GarP_1,36.4 //
āpohiṣṭhetyṛcā kuryānmārjanaṃ tu kuśodakaiḥ /
praṇavena tu saṃyuktaṃ kṣipedvāri padepade // GarP_1,36.5 //
rajastamaḥ svamohotthāñjāgratsvapnasuṣuptijān /
vāṅmanaḥ karmajāndoṣānnavaitānnavabhirdahet // GarP_1,36.6 //
samuddhṛtyodakaṃ pāṇau japtvā ca drupadāṃ kṣipet /
tripaḍaṣṭau dvādaśadhā vartayedaghamarpaṇam // GarP_1,36.7 //
udutyañcitramityābhyāmupatiṣṭheddivākaram /
divā rātrau ca yatpāpaṃ sarvaṃ naśyati tatkṣaṇāt // GarP_1,36.8 //
pūrvasaṃdhyāṃ japaṃstiṣṭhetpaścimāmupaviśya ca /
mahāvyāhṛtisaṃyuktāṃ gāyattrīṃ praṇavānvitām // GarP_1,36.9 //
daśabhirjanmajanitaṃ śatena tu purā kṛtam /
triyugaṃ tu sahasreṇa gāyattrī hanti duṣkṛtam // GarP_1,36.10 //
raktā bhavati gāyattrī sāvitrī śuklavarṇikā /
kṛṣṇā sarasvatī jñeyā saṃdhyātrayamudāhṛtam // GarP_1,36.11 //
oṃ bhūrvinyasya hṛdaye oṃ bhuvaḥ śirasi nyaset /
oṃ svariti śikhāyāṃ ca gāyattryāḥ prathamaṃ padam // GarP_1,36.12 //
vinyasetkavace vidvāndvitīyaṃ netrayornyaset /
tṛtīyenāṅgavinyāsaṃ caturthaṃ sarvato nyaset // GarP_1,36.13 //
saṃdhyākāle tu vinyasya japedvai vedamātaram /
śivastasyāstu sarvāhne prāṇāyāmaparaṃ nyaset // GarP_1,36.14 //
tripadā yā tu gāyattrī brahmaviṣṇumaheśvarī /
viniyogamṛṣicchando jñātvā tu japamārabhet // GarP_1,36.15 //
sarvapāpavinirmukto brahmalokamavāpnuyāt /
parorajasi sāvadoṃ turīyapadamīritam // GarP_1,36.16 //
taṃ hanti sūryaḥ sandhyāyāṃ nopāstiṃ kurute tu yaḥ /
turīyasya padasyāpi ṛṣirnirmala eva ca // GarP_1,36.17 //
chandastu devī gāyattrī paramātmā ca devatā // GarP_1,36.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe saṃdhyāvidhirnāma ṣaṭtriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 37
hariruvāca /
gāyattrī paramā devī bhuktimuktipradā ca tām /
yo japettasya pāpānivinaśyanti mahāntyapi // GarP_1,37.1 //
gāyattrīkalpamākhyāsye bhuktimuktipradaṃ ca tat /
aṣṭottaraṃ sahasraṃ vā athavāṣṭaśataṃ japet // GarP_1,37.2 //
trisandhyaṃ brahmalokīsyācchataṃ japtvā jalaṃ pibet /
saṃdhyāyāṃ sarvapāpaghnīṃ devīmāvāhya pūjayet // GarP_1,37.3 //
bhūrbhuvaḥ svaḥ svamantreṇa yutāṃ dvādaśanāmabhiḥ /
gāyatryai namaḥ /
sāvitryai sarasvatyai namonamaḥ // GarP_1,37.4 //
vedamātre ca sāṃkṛtyai brahmāṇī kauśikī kramāt /
sādhvyai sarvārthasādhinyai sahasrākṣyai ca bhūrbhuvaḥ // GarP_1,37.5 //
svarevaṃ juhuyā dagnau samidājyaṃ haviṣyakam /
aṣṭottarasahasraṃ vāpyathavāṣṭaśanta ghṛtam // GarP_1,37.6 //
dharmakāmādisiddhyarthaṃ juhuyātsarvakarmasu /
pratimāṃ candanasvarṇanirmitāṃ pratipūjya ca // GarP_1,37.7 //
yathā lakṣaṃ tu japtavyaṃ payomūlaphalārśanaiḥ /
ayutadvayahomena sarvakāmānavāpnuyāt // GarP_1,37.8 //
uttare śikhare jātā bhūmyāṃ parvata vāsinī /
brahmaṇā samanujñātā gaccha devi yathāsukham // GarP_1,37.9 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gāyattrīkalpanirūpaṇaṃ nāma saptatriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 38
hariruvāca /
navamyādau yajeddurgāṃ hrīṃ durge rakṣiṇīti ca /
mātarmātarvare durge sarvakāmārthasādhani // GarP_1,38.1 //
anena balidānena sarvakāmānprayaccha me /
gaurī kālī umā durgā bhadrā kāntiḥ sarasvatī // GarP_1,38.2 //
maṅgalā vijayā lakṣmīḥ śivā nārāyaṇī kramāt /
mārge tṛtīyāmārabhya pūjayenna viyogabhāk // GarP_1,38.3 //
aṣṭādaśabhujāṃ kheṭakaṃ ghaṇṭāṃ darpaṇaṃ tarjanīm /
dhanurdhvajaṃ ḍamarukaṃ paraśuṃ pāśameva ca // GarP_1,38.4 //
śaktimudraraśūlāni kapālaśarakāṅkuśān /
vajra cakraṃ śalākāṃ ca aṣṭādaśabhujāṃ smaret // GarP_1,38.5 //
mantraḥ śrībhagavatyāśca pravakṣyāmi japādikam // GarP_1,38.6 //
oṃ namo bhagavati cāmuṇḍe śmaśānavāsini kapālahaste mahāpretasamārūḍhe mahāvimānamālākule kālarātri bahugaṇaparivṛte mahāmukhe bahubhuje sughaṇṭāḍamarukiṅkiṇīke aṭṭāṭṭahāse kilikili huṃ sarvanādaśabdabahule gajacarmaprāvṛtaśarīre rudhiramāṃsadigdhe lolagrajihve mahārākṣasi raudradaṃṣṭrākarāle bhīmāṭṭāṭṭahāse sphuritavidyutsamaprabhe calacala karālanetre hilihili lalajjihve hraiṃ hrīṃ bhṛkuṭimukhi oṃ kārabhadrāsane kapālamālāveṣṭite jaṭāmukuṭaśaśāṅkadhāriṇi aṭṭāṭṭahāse kilikili huṃhuṃ daṃṣṭrāghorāndhakāriṇi sarvavighnavināśini idaṃ karma sādhaya sādhaya śīghraṃ kurukuru kahakaha aṅkuśe samanupraveśaya vargaṃvargaṃ (vaṅgavaṅga) kampayakampaya calacala cālayacālaya rudhiramāṃsamadyapriye hanahana kuṭṭakuṭṭa chindachinda mārayamāraya anubūma anubūma vajraśarīraṃ sādhayasādhaya trailokyagatamapi duṣṭamaduṣṭaṃ vā gṛhītamagṛhītam āveśaya āveśaya krāmayakramaya nṛtyanṛtya bandhabandha valgavalga koṭarākṣi urdhvakeśi ulūkavadane karakiṅkiṇi karaṅkamālādhāriṇi dahadaha pacapaca gṛhṇagahṇa maṇḍalamadhye praveśayapraveśaya kiṃ vilambasi brahmasatyena viṣṇusatyena ṛṣisatyena rudrasatyena āveśaya āveśaya kilikili khilikhili milimili cilicili vikṛtarūpadhāriṇi kṛṣṇabhujaṅga veṣṭitaśarīra sarvagrahāveśini pralambhoṣṭhi bhrūmagnanāsike vikaṭamukhi kapilajaṭe brāhmi bhañjabhañja jvalajvala kālamukhi khalakhala kharakharaḥ pātayapā taya raktākṣi dhūrṇāpayadhūrṇāpaya bhūmiṃ pātayapātaya śiro gṛhṇagṛhṇa cakṣurmolayamīlaya bhañjabhañja pādau gṛhṇagṛhṇa mudrāṃ sphoṭayasphoṭaya huṃ hūṃ phaṭ vidāraya vidāraya triśūlena bhedayabhedaya vajreṇa hanahana daṇḍena tāḍayatāḍaya cekraṇa chedayachedaya śaktinā bhedayabhedaya daṃṣṭrayā daṃśayadaṃśaya kīlakena kīlaya kīlaya kartārikayā pāṭayapāṭaya aṅkuśena gṛhṇagṛhṇa brahmāṇi ehi ehi māheśvari ehi ehi kaumāri ehi ehi vārāhi ehi ehi
aindri ehi ehi cāmuṇḍe ehi ehi vaiṣṇāvi ehi ehi himavantacāriṇi ehi ehi kailāsavārīṇi ehi ehi paramantraṃ chindhichindhi kilikili bimbe aghore ghorarūpiṇi cāmuṇḍe rurukrodhāndhaviniḥ) sṛte asurakṣayaṅkari ākāśagāmini pāśena bandhabandha samaye tiṣṭhatiṣṭha maṇḍalaṃ praveśayapraveśaya pātayapātaya gṛhṇagṛhṇa mukhaṃ bandhabandha cakṣurbandhayabandhaya hṛdayaṃ bandhabandha hastapādau ca bandhabandha duṣṭagrahān sarvān bandhabandha diśāṃ bandhabandha vidiśāṃ bandhabandha ūrdhvaṃ bandhabandha adhastād bandhabandha bhasmanā pānīyena mṛtikayā sarṣapairvā āveśaya āveśaya pātayapātaya cāmuṇḍe kilikili vicchehrīṃ(huṃ) phaṭ svāh // GarP_1,38.7 //
aṣṭottarapadānāṃ hi mālā mantramayī japaḥ /
ekaikrapadamaṣṭasahasradhā trimadhurāktatilāṣṭasahasrahāmeḥ // GarP_1,38.8 //
mahāmāṃsena-trimadhurāktena aṣṭottarasahsatraṃ ca ekaikaṃ ca padaṃ yajet /
tilāṃstrimadhurāktāṃśca sahasraṃ cāṣṭa homayet // GarP_1,38.9 //
mahāmāṃsaṃ trimadhurādatha vā sarvakarmakṛt /
vārisarṣapabhasmādikṣepādyuddhādike jayaḥ // GarP_1,38.10 //
aṣṭāviṃśabhujā dhyeyā aṣṭādaśabhujāthavā /
dvādaśāṣṭabhujā vāpi dhyeyā vāpi caturbhujā // GarP_1,38.11 //
asikheṭānvitau hastau gadādaṇḍayutau parau /
śaracāpayutau cānyau khaḍgamudrarasaṃyutau // GarP_1,38.12 //
khaṅkhaghaṇṭānvitau cānyau dhvajadaṇḍayutau parau /
anyau paraśucakrāḍhyau ḍamarudarpaṇānvitau // GarP_1,38.13 //
śaktihastāśritau cānyau raṭoṇī musalānvitau /
pāśatomarasaṃyuktau ḍhakrāpaṇavasaṃyutau // GarP_1,38.14 //
tarjayantī pareṇaiva anyaṃ kalakaladhvanim /
abhayasvastikādyau ca mahiṣaghnī ca siṃhagā // GarP_1,38.15 //
jaya tvaṃ kila bhūteśe sarvabhūtasamāvṛte /
rakṣa māṃ nijabhūtebhyo valiṃ gṛhṇa namo 'stu te // GarP_1,38.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe durgājapapūjābalimantranirūpaṇaṃ nāmāṣṭatriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 39
rudra uvāca /
punardevārcanaṃ brūhi saṃkṣepeṇa janārdana /
sūryasya viṣṇurūpasya bhuktimuktipradāyakam // GarP_1,39.1 //
vāsudeva uvāca /
śṛṇu sūryasya rudra tvaṃ punarvakṣyāmi pūjanam /
oṃ uccaiḥ śravase namaḥ oṃ aruṇāya namaḥ /
oṃ daṇḍine namaḥ /
oṃ piṅgalāya namaḥ /
ete dvāre prapūjyā vai epirmantrairvṛṣadhvaja // GarP_1,39.2 //
oṃ aṃ prabhūtāya namaḥ /
imaṃ tu pūjayenmadhye prabhūtāmalasaṃjñakam /
oṃ aṃ vimalāya namaḥ /
oṃ aṃ sārāya namaḥ /
oṃ aṃādhārāya namaḥ /
oṃ aṃ paramamukhāya namaḥ /
ityāgneyādikoṇeṣu pūjyā vai vimalādayaḥ // GarP_1,39.3 //
oṃ padmāya namaḥ /
oṃ karṇikāyai namaḥ /
maghye tu pūjayedrudra pūrvādiṣu tathaiva ca /
dīptādyāḥ pūjayenmadhye pūjayetsarvatomukhīḥ /
oṃ vāṃ (rāṃ) dīptāyai namaḥ /
oṃ vīṃ (rīṃ) sūkṣmāyai namaḥ /
oṃ vūṃ (rūṃ bhadrāyai namaḥ /
oṃ vaiṃ (raiṃ) jayāyai namaḥ /
oṃ vauṃ (rauṃ) vibūtyai namaḥ /
oṃ vaṃ (raṃ) adhorāyai namaḥ /
oṃ vaṃ (raṃ) vaidyutāyai namaḥ /
oṃ vaḥ (raḥ) vijayāyai namaḥ /
oṃ ro sarvatomukhyai namaḥ // GarP_1,39.4 //
oṃ arkāsanāya namaḥ /
oṃ hrāṃ sūryamūrtaye namaḥ /
etāstu pūjayenmadhye hranmantrāñchṛṇu śaṅkara /
oṃ haṃ saṃ khaṃ khakholkāya krāṃ krīṃ saḥ svāhā sūryamūrtaye namaḥ /
anenāvāhanaṃ kuryātsthāpanaṃ sannidhāpanam /
sanniropanamantreṇa sakalīkaraṇaṃ tathā // GarP_1,39.5 //
mudrāyā darśanaṃ rudra mūlamantreṇa vā hara /
tejorūpaṃ raktavarṇaṃ sitapadmopari sthitam /
ekacakrarathārūḍhaṃ dvibāhuṃ dhṛtapaṅkajam // GarP_1,39.6 //
evaṃ dhyāyetsadā sūryaṃ mūlamantraṃ śṛṇuṣva ca /
oṃ hrāṃ hrīṃ saḥ sūryāya namaḥ // GarP_1,39.7 //
vāratrayaṃ padmamudrāṃ bimbamudrāṃ ca darśayet /
oṃ āṃ hṛdayāya namaḥ /
oṃ arkāya śirase svāhā /
oṃ aḥ bhūrbhuvaḥ svaḥ jvālini śikhāyai vaṣaṭ /
oṃ huṃ kavacāya huṃ /
oṃ bhāṃ netrābhyāṃ vauṣaṭ /
oṃ vaḥ astrāya phaḍiti // GarP_1,39.8 //
āgneyyāmathavaiśānyāṃ nairṛtyāmarcayeddhara /
tdṛyadayādi hi vāyavyāṃ netraṃ cāntaḥ prapūjayet // GarP_1,39.9 //
disvastraṃ pūjayedrudra somaṃ tu śvetavarṇakam /
dale pūrver'cayedrudra budhaṃ cāmīkaraprabham // GarP_1,39.10 //
dakṣiṇe pūjayedrudra pativarṇaṃ guruṃ yajet /
paścime caiva bhūteśaṃ uttare bhārgavaṃ sitam // GarP_1,39.11 //
raktamaṅgārakaṃ caiva āgneye pūjayeddhara /
śanaiścaraṃ kṛṣṇavarṇaṃ nairṛtyāṃ diśi pūjayet // GarP_1,39.12 //
rāhuṃ vāyavyadeśe tu nandyāvartanibhiṃ hara /
aiśānyāṃ dhūmravarṇaṃ tu ketuṃ saṃ paripūjayet // GarP_1,39.13 //
ebhirmantrairmahādeva tacchṛṇuṣva ca śaṅkara // GarP_1,39.14 //
oṃ soṃ somāya namaḥ /
oṃ buṃ budhāya namaḥ /
oṃ bṛṃ bṛhaspataye namaḥ /
oṃ bhaṃ bhārgavāya namaḥ /
oṃ aṃ aṅgārakāya namaḥ /
oṃ śaṃ śanaiścarāya namaḥ /
oṃ raṃ rāhave namaḥ /
oṃ kaṃ ketave nama iti // GarP_1,39.15 //
pādyādīnmūlamantreṇa dattvā sūryāya śaṅkara /
naivedyānte dhenumudrāṃ darśayetsādhakottamaḥ // GarP_1,39.16 //
japtvā cāṣṭasahasraṃ tu tacca tasmai samarpayet /
aiśānyāṃ diśi bhūteśa tejaścaṇḍaṃ tu pūjayet // GarP_1,39.17 //
oṃ tejaścaṃṇḍāya huṃ phaṭ svadhā svāhā pauṣaṭ /
nirmālyaṃ cārpayettasmai hyarghyaṃ dadyāttato hara // GarP_1,39.18 //
tilataṇḍulasaṃyuktaṃ raktacandanacarcitam /
gandhodakena saṃmiśraṃ puṣpadhūpasamanvitam // GarP_1,39.19 //
kṛtvā śirasi tatpātraṃ jānubhyāmavaniṃ gataḥ /
darghyaṃ tu sūryāya tdṛnmantreṇa vṛṣadhvaja // GarP_1,39.20 //
gaṇaṃ gurūnprapūjyātha sarvāndevānanprapūjayet /
oṃ gaṃ gaṇapataye namaḥ /
oṃ aṃ gurubhyo namaḥ // GarP_1,39.21 //
sūryasya kathitā pūjā kṛtvaitāṃ viṣṇulokabhāk // GarP_1,39.22 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sūryārcanaprakāro nāmaikonacatvāriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 40
śaṅkara uvāca /
māheśvarīṃ ca me pūjāṃ vada śaṅkhagadādhara /
yāṃ jñātvā mānavāḥ siddhiṃ gacchanti parameśvara // GarP_1,40.1 //
hariruvāca /
śṛṇu māheśvarīṃ pūjāṃ kathyamānāṃ vṛṣadhvaja /
ādau snātvā tathācamya hyāsane copaviśya ca // GarP_1,40.2 //
nyāsaṃ kṛtvā maṇḍale vai pūjayacce maheśvaram /
mantrairetairmaheśāna parivārayutaṃ haram // GarP_1,40.3 //
oṃ hāṃ śivāsanadevatā āgacchateti /
anenāvāhayedrudra devatā āsanasya yāḥ // GarP_1,40.4 //
oṃ hāṃ gaṇapataye namaḥ /
oṃ hāṃ sarasvatyai namaḥ /
oṃ hāṃ nandine namaḥ /
oṃ hāṃ mahākālāya namaḥ /
oṃ hāṃ gaṅgāyai namaḥ /
oṃ hāṃ lakṣmyai namaḥ /
oṃ hāṃ mahākalāyai namaḥ /
oṃ hāṃ astrāya nama iti // GarP_1,40.5 //
ete dvāre prapūjyā vai snānagandhādibhirhara /
oṃ hāṃ brahmaṇe vāstvadhipataye namaḥ /
oṃ hāṃ gurubhyo namaḥ /
oṃ hāṃ ādhāraśaktyai namaḥ /
oṃ hāṃ anantāya namaḥ /
oṃ hāṃ dharmāya namaḥ /
oṃ hāṃ jñānāya namaḥ /
oṃ hāṃ vairāgyāya namaḥ /
oṃ hāṃ aiśvaryāya namaḥ /
oṃ hāṃ adharmāya namaḥ /
oṃ hāṃ ajñānāya namaḥ /
oṃ hāṃ avairāgyāya namaḥ /
oṃ hāṃ anaiśvaryāya namaḥ /
oṃ hāṃ urdhvacchandāya namaḥ /
oṃ hāṃ adhaśchandāya namaḥ /
oṃ hāṃ padmāya namaḥ /
oṃ hāṃ karṇikāyai namaḥ /
oṃ hāṃ vāmāyai namaḥ /
oṃ hāṃ jyeṣṭhāyai namaḥ /
oṃ hāṃ raudyai namaḥ /
oṃ kālyai namaḥ /
oṃ hāṃ kalavikaraṇyai namaḥ /
oṃ balapramathinyai namaḥ /
oṃ hāṃ sarvabhūtadamanyai namaḥ /
oṃ hāṃ manonmanyai namaḥ /
oṃ hāṃ maṇḍalatritayāya namaḥ /
oṃ hāṃ hauṃ haṃ śivamūrtaye namaḥ /
oṃ hāṃ vidyādhipataye namaḥ /
oṃ hāṃ hīṃ hauṃ śivāya namaḥ /
oṃ hāṃ hṛdayāya namaḥ /
oṃ śirase namaḥ /
oṃ hūṃ śikhāyai namaḥ /
oṃ haiṃ kavacāya namaḥ /
oṃ hauṃ netratrayāya namaḥ /
oṃ haḥ astrāya namaḥ /
oṃ sadyojātāya namaḥ // GarP_1,40.6 //
oṃ hāṃ siddhyai namaḥ /
oṃ hāṃ ṛddhyai namaḥ /
oṃ hāṃ vidyutāyai namaḥ /
oṃ hāṃ lakṣmyai namaḥ /
oṃ hāṃ bodhāyai namaḥ /
oṃ hāṃ kālyai namaḥ /
oṃ hāṃ svadhāyai namaḥ /
oṃ hāṃ prabhāyai namaḥ // GarP_1,40.7 //
satyasyāṣṭau kalā jñeyāḥ pūjyāḥ pūrvādiṣu sthitāḥ // GarP_1,40.8 //
oṃ hāṃ vāmadevāya namaḥ /
oṃ hāṃ rajase namaḥ /
oṃ hāṃ rakṣāyai namaḥ /
oṃ hāṃ ratyai namaḥ /
oṃ hāṃ kanyāyai namaḥ /
oṃ hāṃ kāmāyai namaḥ /
oṃ hāṃ jananyai namaḥ /
oṃ hāṃ kriyāyai namaḥ /
oṃ hāṃ vṛddhyai namaḥ /
oṃ hāṃ kāryāyai namaḥ /
oṃ rā(dhā) tryai namaḥ /
oṃ hāṃ bhrāmaṇyai namaḥ /
oṃ hāṃ mohinyai namaḥ /
oṃ hāṃ kṣa(tva)rāyai namaḥ /
vāmadevakalā jñeyāstrayo daśa vṛṣadhvaja // GarP_1,40.9 //
oṃ hāṃ tatpuruṣāya namaḥ /
oṃ hāṃ nivṛttyai namaḥ /
oṃ hāṃ pratiṣṭhāyai namaḥ /
oṃ hāṃ vidyāyai namaḥ /
oṃ hāṃ śāntyai namaḥ /
jñeyāstatpuruṣasyaiva catasro vṛṣabhadhvaja // GarP_1,40.10 //
oṃ hāṃ tṛṣṇāyai namaḥ /
kalāṣaṭkaṃ hyakhorasya vijñeyaṃ bhairavaṃ hara // GarP_1,40.11 //
oṃ hāṃ īśānāya namaḥ /
oṃ hāṃ samityai namaḥ /
oṃ hāṃ aṅgadāyai namaḥ /
oṃ hāṃ kṛṣṇāyai namaḥ /
oṃ hāṃ marīcyai namaḥ /
oṃ hāṃ jvālāyai namaḥ /
īśānasya kalāḥ pañca jānīhi vṛṣabhadhvaja // GarP_1,40.12 //
oṃ hāṃ śivaparivārebhyo namaḥ /
oṃ hāṃ indrāya surādhipataye namaḥ /
oṃ hāṃ agnaye tejo 'dhipataye namaḥ /
oṃ hāṃ yamāya pretādhipataye namaḥ /
oṃ hāṃ nirṛtaye rakṣo 'dhipataye namaḥ /
oṃ hāṃ varuṇāya jalādhipataye namaḥ /
oṃ hāṃ vāyave prāṇādhipataye namaḥ /
oṃ hāṃ somāya netrādhipataye namaḥ /
oṃ hāṃ īśānāya sarvavidyādhipataye namaḥ /
oṃ hāṃ anantāya nāgādhipataye namaḥ /
oṃ hāṃ brahmaṇe sarvalokādhipataye namaḥ /
oṃ hāṃ dhūlicaṇḍeśvarāya namaḥ // GarP_1,40.13 //
āvāhanaṃ sthāpanaṃ sannidhānaṃ ca śaṅkara /
sannirodhaṃ tathā kuryātsakalīkaraṇaṃ tathā // GarP_1,40.14 //
tattvanyāsaṃ ca mudrāyā darśanaṃ dyānameva ca /
pādyamācamanaṃ hyarghyaṃ puṣpāṇyabhyaṅgadānakam // GarP_1,40.15 //
tata udvartanaṃ snānaṃ sugandhaṃ cānulepanam /
vastrālaṃ kārabhogāṃśca hyaṅganyāsaṃ ca dhūpakam // GarP_1,40.16 //
dīpaṃ naivedyadānaṃ ca hastodvartanameva ca /
pādyārghyācamanaṃ gandhaṃ tāmbūlaṃ gītavādanam // GarP_1,40.17 //
nṛtyaṃ chatrā dikaraṇaṃ mudrāṇāṃ darśanaṃ tatā /
rūpaṃ dhyānaṃ japañcātha ekavadbhāva eva ca // GarP_1,40.18 //
mūlamantreṇa vai kuryājjapapūjāsamarpaṇam /
māheśī kathitā pūjā rudra pāpavināsinī // GarP_1,40.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe maheśvarapūjāvidhirnāma catvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 41
vāsudeva uvāca /
oṃ viśvāvasurnāma gandharvaḥ kanyānāmadhipatirlabhāmi te kanyāṃ samutpādya tasmai viśvavāsave svāhā /
strīlābho mantrajāpyācca kālarātriṃ vadāmyaham // GarP_1,41.1 //
oṃ namo bhagavati ṛkṣakarṇi caturbhuje ūrdhvakeśi trinayane kālarātri mānuṣāṇāṃ vasārudhirabhojane amukasya prāptakālasya mṛtyuprade huṃ phaṭ hanahana dahadaha māṃsarudhiraṃ pacapaca ṛkṣapatni svāhā / na tithirna ca nakṣatraṃ nopavāso vidhīyate // GarP_1,41.2 //
kruddho raktena saṃmārjya karau tābhyāṃ pragṛhya ca /
pradoṣe saṃjapelliṅgamāmapātraṃ ca mārayet /
oṃ namaḥ sarvatoyantrāṇyetadyathā jambhani mohani sarvaśatruvidāriṇi rakṣarakṣa māmamukaṃ sarvabhayopadravebhyaḥ svāhā /
śukre naṣṭe mahādeva vakṣye 'haṃ dvijapādiha // GarP_1,41.3 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaśyādisādhikamantranirūpaṇaṃ nāmaikacatvāriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 42
hariruvāca /
pavitrāropaṇaṃ vakṣye sivasyāśivanāśanam /
ācāryaḥ sādhakaḥ kuryātputrakaḥ samayī hara // GarP_1,42.1 //
saṃvatsarakṛtāṃ pūjāṃ vighneśo harate 'nyathā /
āṣāḍhe śrāvaṇe māghe kuryādbhādrapade 'pi vā // GarP_1,42.2 //
sauvarṇaraupyatāmraṃ ca sūtraṃ kārpāsikaṃ kramāt /
jñeyaṃ kujādau saṃgrāhyaṃ kanyayā kartitaṃ ca yat // GarP_1,42.3 //
triguṇaṃ triguṇīkṛtya tataḥ kuryātpavitrakam /
granthayo vāmadevena satyena kṣālayecchiva // GarP_1,42.4 //
aghoreṇa tu saṃśodhya baddhastatpuruṣādbhavet /
dhūpayedīśamantreṇa tantudevā iti (me) smṛtāḥ // GarP_1,42.5 //
oṃ kāraścandramā vahnirbrahnā nāgaḥ śikhidhvajaḥ /
ravirviṣṇuḥ śivaḥ proktaḥ kramāttantuṣu devatāḥ // GarP_1,42.6 //
aṣṭottaraśataṃ kuryātpañcāśatpañcaviṃśatim /
rudro 'ttamādi vijñeyaṃ mānaṃ ca granthayo daśa // GarP_1,42.7 //
caturaṅgulāntarāḥ syurgranthināmāni ca kramāt /
prakṛtiḥ pauruṣī vīrā caturtho cāparājitā // GarP_1,42.8 //
jayā ca vijayā rudrā ajitā ca sadāśivā /
manonmanī sarvamukhī dvyaṅgulāṅgulato 'thavā // GarP_1,42.9 //
rañjayetkuṅkumādyaistu kuryādrandhaiḥ pavitrakam /
saptamyāṃ vā trayodaśyāṃ śuklapakṣe tathetare // GarP_1,42.10 //
kṣīrādibhiśca saṃsnāpya liṅgaṃ gandhādibhiryajet /
dadyādrandhapavitraṃ tu ātmane brahmaṇe hara // GarP_1,42.11 //
puṣpaṃ gandhayutaṃ dadyānmūleneśānagocare /
pūrve ca daṇḍakāṣṭhaṃ tu uttare cāmalakīphalam // GarP_1,42.12 //
mṛttikāṃ paścime dadyāddakṣiṇe bhasma bhūtayaḥ /
nairṛtehyaguruṃ dadyācchikhāmantreṇa mantravit // GarP_1,42.13 //
vāyavyāṃ sarṣapaṃ dadyātkavacena vṛṣadhvaja /
gṛhaṃ saṃveṣṭya sūtreṇa dadyādrandhapavitrakam // GarP_1,42.14 //
homaṃ kṛtvā gneya dattvā dadyādbhūtabaliṃ tathā /
āmantrito 'si deveśa gaṇaiḥ sārdhaṃ maheśvara // GarP_1,42.15 //
prātastvāṃ pūjayiṣyāmi atra sannihito bhava /
nimantryānena tiṣṭhettu kurvan gītādikaṃ niśi // GarP_1,42.16 //
mantritāni pavitrāṇi sthāpayeddevapārśvataḥ /
snātvādityaṃ caturdaśyāṃ prāgrudraṃ ca prapūjayet // GarP_1,42.17 //
lalāṭasthaṃ viśvarūpaṃ dhyātvātmānaṃ prapūjayet /
astreṇa prokṣitānyevaṃ hṛdayenārcitānyatha // GarP_1,42.18 //
saṃhitāmantritānyeva dhūpitāni samarpayet /
śivatattvātmakaṃ cādau vidyātattvātmakaṃ tataḥ // GarP_1,42.19 //
ātmatattvātmakaṃ paścāddevakākhyaṃ tator'cayet /
oṃ hauṃ hauṃ śivatattvāya namaḥ /
oṃ hīṃ(hīḥ) vidyātattvāya namaḥ // GarP_1,42.20 //
oṃ hāṃ (hauḥ) ātmatattvāya namaḥ /
oṃ hāṃ hīṃ hūṃ kṣaiṃ sarvatattvāya namaḥ /
kālātmanā tvayā deva yaddṛṣṭaṃ māmake vidhau // GarP_1,42.21 //
kṛtaṃ kliṣṭaṃ samutsṛṣṭaṃ hutaṃ gupta ca yatkṛtam /
sarvātmanātmanā śambho pavitreṇa tvadicchayā // GarP_1,42.22 //
pūrayapūraya makhavrataṃ tanniyameśvarāya sarvatattvātmakāya sarvakāraṇapālitāya oṃ hāṃ hīṃ hūṃ haiṃ hauṃ śivāya namaḥ // GarP_1,42.23 //
pūrvairanena yo dadyātpavitrāṇāṃ catuṣṭayam /
dattvā vahneḥ (vare) pavitraṃ ca gurave dakṣiṇāṃ diśet // GarP_1,42.24 //
baliṃ dattvā dvijān bhojya caṇḍaṃ prācyai visarjayet // GarP_1,42.25 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śivapavitrāropaṇaṃ nāma dvicatvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 43
hariruvāca /
pavitrāropaṇaṃ vakṣye bhuktimuktipradaṃ hareḥ /
purā devāsure yuddhe brahmādyāḥ śaraṇaṃ yayuḥ // GarP_1,43.1 //
viṣṇuśca teṣāṃ devānāṃ dhvajaṃ graiveyakaṃ dadau /
etau dṛṣṭvā vinaṅkṣyanti dānavānabravīddhariḥ // GarP_1,43.2 //
viṣṇūkte hyabravīnnāgo vāsukeranujastadā /
vṛṇīta ca vapitrākhyaṃ varaṃ cedaṃ vṛṣadhvaja // GarP_1,43.3 //
graiveyaṃ haridattaṃ tu mannāmnā khyātimeṣyati /
ityukte tena te devāstannāmnā tadvaraṃ viduḥ // GarP_1,43.4 //
prāvṛṭkāle tu ye martyā nārciṣyanti pavitrakaiḥ /
teṣāṃ sāṃvatsarī pūjā viphalā ca bhaviṣyati // GarP_1,43.5 //
tasmātsarveṣu deveṣu pavitrāropaṇaṃ kramāt /
pratipatpaurṇamāsyāntā yasya yā tithirucyate // GarP_1,43.6 //
dvādaśyāṃ viṣṇave kāryaṃ śukle kṛṣṇe 'tha vā hara /
vyatīpāte 'yane caiva candarasūryagrahe śiva // GarP_1,43.7 //
viṣṇave vṛddhikārye ca gurorāgamane tathā /
nityaṃ pavitramuddiṣṭaṃ prāvṛṭkāle tvavaśyakam // GarP_1,43.8 //
kauśeyaṃ paṭṭasūtraṃ vā kārpāsaṃ kṣaumameva vā /
kuśasūtra dvijānāṃ syādrājñā kauśeyapaṭṭakam // GarP_1,43.9 //
vaiśyānāṃ cīraṇaṃ kṣaumaṃ śūdrāṇāṃ śaṇavalkajam /
kārpāsaṃ padmajaṃ caiva sarveṣāṃ śastamīśvara // GarP_1,43.10 //
brāhmaṇyā kartitaṃ sūtraṃ triguṇaṃ triguṇīkṛtam /
oṃ kāro 'tha śivaḥ somo hyagnirbrahyā phaṇī raviḥ // GarP_1,43.11 //
vighneśo viṣṇurityete sthitāstantuṣu devatāḥ /
brahmā viṣṇuśca rudraśca trisūtre devatāḥ smṛtāḥ // GarP_1,43.12 //
sauvarṇe rājate tāmre vaiṇave mṛnmaye nyaset /
aṅguṣṭhena catuḥ ṣaṣṭiḥ śreṣṭhaṃ madhyaṃ tadardhataḥ // GarP_1,43.13 //
tadardhā tu kaniṣṭhā syātsūtramaṣṭottaraṃ śatam /
uttamaṃ madhyamaṃ caiva kanyasaṃ pūrvavatkramāt // GarP_1,43.14 //
uttamoṃ'guṣṭhamānena madhyamo madhyamena tu /
kanyase ca kaniṣṭhena aṅgulyā granthayaḥ smṛtāḥ // GarP_1,43.15 //
vimāne sthaṇḍile caiva etatsāmānyalakṣaṇam /
śivoddhṛtaṃ pavitraṃ tu pratimāyāṃ ca kārayet // GarP_1,43.16 //
hṛnnābhirū(ru) rumāne ca jānubhyāmavalambinī /
aṣṭottarasahasreṇa catvāro granthayaḥ smṛtāḥ // GarP_1,43.17 //
ṣaṭtriṃ(ḍviṃ) śacca caturviśaddvādaśa granthayo 'thavā /
uttamādiṣu vijñeyāḥ parvabhirvā pavitrakam // GarP_1,43.18 //
carcitaṃ kuṅkumenaiva haridrācandanena vā /
sopavāsaḥ pavitrantu pātrasthamadhivāsayet // GarP_1,43.19 //
aśvatthapatrapuṭake aṣṭadikṣu niveśitam /
daṇḍakāṣṭhaṃ kuśāgraṃ ca pūrve saṅkarṣaṇena tu // GarP_1,43.20 //
rocanākuṅkumenava pradyumnena tu dakṣiṇe /
yuddhārtho phalasiddhyarthamaniruddhena paścime // GarP_1,43.21 //
candanaṃ nīlayuktaṃ ca tilabhasmākṣataṃ tathā /
āgneyādiṣu koṇeṣur śyādīnāṃ tu kramānnyaset // GarP_1,43.22 //
pavitraṃ vāsudevena abhimantrya sakṛtsakṛt /
dṛṣṭvā punaḥ prapūjyātha vastreṇācchādya yatnataḥ // GarP_1,43.23 //
devasya purataḥ sthāpyaṃ pratimāmaṇḍalasya vā /
paścime dakṣiṇe caiva uttare pūrvavatkramāt // GarP_1,43.24 //
brāhmādīṃścāpi saṃsthāpya kalaśaṃ cāpi pūjayet /
astreṇa maṇḍalaṃ kṛtvā naivedyañca samarpayet // GarP_1,43.25 //
adhivāsya pavitraṃ tu trisūtreṇa navena vā (ca) /
vedikāṃ veṣṭayitvā tu ātmānaṃma kalaśaṃ ghṛtam // GarP_1,43.26 //
agnikuṇḍaṃ vimānaṃ ca maṇḍapaṃ gṛhameva ca /
sūtramekaṃ tu saṃgṛhya dadyāddevasya mṛrdhāni // GarP_1,43.27 //
dattvā paṭhedimaṃ mantraṃ pūjayitvā maheśvaram /
āvāhito 'si deveśa pūjārthaṃ parameśvara // GarP_1,43.28 //
tatprabhāter'cayiṣyāmi sāmagyāḥ sannidhau bhava /
ekarātraṃ trirātraṃ vā adhivāsya pavitrakam // GarP_1,43.29 //
rātrau jāgaraṇaṃ kṛtvā prātaḥ saṃpūjya keśavam /
āropayetkrameṇaiva jyeṣṭhamadhyakanīyasam // GarP_1,43.30 //
dhūpayitvā pavitraṃ tu mantreṇaivābhimantrayet /
prajaptagranthikaṃ caiva pūjayetkusumādibhiḥ // GarP_1,43.31 //
gāyattryā cārcitaṃ tena devaṃ saṃpūjya dāpayet /
samaṃ putrakalatrādyaiḥ sūtrapucchaṃ tu dhārayet // GarP_1,43.32 //
viśuddhagranthikaṃ ramyaṃ mahāpātakanāśanam /
sarvapāpakṣayaṃ deva tavāgre dhārayāmyaham // GarP_1,43.33 //
evaṃ dhūpādinābhyarcya madhyamādīntsamarpayet /
pavitraṃ vaiṣṇavaṃ tejaḥ sarvapātakanāśanam // GarP_1,43.34 //
dharmakāmārthasiddhyarthaṃ svakaṇṭhe dhārayāmyaham /
vanamālāṃ samabhyarcya svena mantreṇa dāpayet // GarP_1,43.35 //
naivedyaṃ vividhaṃ dattvā kusumāderbaliṃ haret /
agniṃ saṃtarpya tatrāpi dvādaśāṅgulamānataḥ // GarP_1,43.36 //
aṣṭottaraśatenaiva dadyādekapavitrakam /
ādau dattvārghyamāditye tatra caikaṃ pavitrakam // GarP_1,43.37 //
viṣvaksenaṃ tataḥ prārcya surumarghyādibhirhara /
devasyāgre paṭhenmantraṃ kṛtāñjalipuṭaḥ sthitaḥ // GarP_1,43.38 //
jñānato 'jñānato vāpi pūjanādi kṛtaṃ mayā /
tatsarvaṃ pūrṇamevāstu tvatprasādātsureśvara // GarP_1,43.39 //
maṇividrumamālabhirmandārakusumādibhiḥ /
iyaṃ sāṃvatsarī pūjā tavāstu garuḍadhvaja // GarP_1,43.40 //
vanamālā yathā deva kaustubhaṃ satataṃ hṛdi /
tadvatpavitraṃ tantūnāṃ mālāṃ tvaṃ hṛdaye dhara // GarP_1,43.41 //
evaṃ prārthya dvijān bhojya dattvā tebhyaśca dakṣiṇām /
visarjayettu tenaiva sāyāhne tvapare 'hani // GarP_1,43.42 //
sāṃvatsarīmimāṃ pūjāṃ sampādya vidhivanmayā /
vrajeḥ pavitrakedānīṃ viṣṇulekaṃ visarjitaḥ // GarP_1,43.43 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇupavitrāropaṇaṃ nāma tricatvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 44
hariruvāca /
pūjayitvā pavitrādyairbrahma dhyātvā harirbhavet /
brahmadhyānaṃ pravakṣyāmi māyāyantrapramardakam // GarP_1,44.1 //
yacchedvāṅmanasaṃ prājñastaṃ yajejjñānamātmani /
jñānaṃ mahati saṃyacchedya icchejjñānamātmāni // GarP_1,44.2 //
dehendriyamanobuddhiprāṇāhaṅkarāvarjitam /
varjitaṃ bhūtatanmātrairguṇajanmāśanādibhiḥ // GarP_1,44.3 //
svaprakāśaṃ nirākāraṃ sadānaṃ damanādi yat /
nityaṃ śuddhaṃ buddhamṛddhaṃ satyamānandamadvayam // GarP_1,44.4 //
turīyamakṣaraṃ brahma ahamasmi paraṃ padam /
ahaṃ brahmetyavasthānaṃ samādhirapi (riti) gīyate // GarP_1,44.5 //
ātmānaṃ rathinaṃ viddhi śarīraṃ rathameva tu /
buddhiṃ ca sārathiṃ viddhi manaḥ pragrahameva ca /
indriyāṇi hayānāhurviṣayāsteṣu gocarāḥ // GarP_1,44.6 //
ātmendriyamanoyukto bhoktetyārmanīṣiṇaḥ /
yastu vijñāna bāhmena yuktena manasā sadā // GarP_1,44.7 //
sa tu tatpadamāpnoti sa hi bhūyo na jāyate /
vijñānasārathiryastu manaḥ pragrahavānnaraḥ // GarP_1,44.8 //
svardhunyāḥ pāramāpnoti tadviṣṇoḥ paramaṃ padam /
ahiṃsādiryamaḥ proktaḥ śaucādirniyamaḥ smṛtaḥ // GarP_1,44.9 //
āsanaṃ padmakādyuktaṃ prāṇāyāmo marujjayaḥ /
pratyāhā ro jayaḥ prokto dhyānamīśvaracintanam // GarP_1,44.10 //
manodhṛtirdhāraṇā sthātsamādhirbrahmaṇi sthitiḥ /
pūrvaṃ cetaḥ sthiraṃ na syāttatomūrtiṃ vicintayet // GarP_1,44.11 //
hṛtpadmakarṇikāmadhye śaṅkhacakragadābjavān /
śrīvatsakaustubhayuto vanamālāśriyā yutaḥ // GarP_1,44.12 //
nityaḥ śuddho bhūtiyuktaḥ satyānandāhvayaḥ paraḥ /
ātmāhaṃ paramaṃ brahma paramaṃ jyotireva tu // GarP_1,44.13 //
caturviśatimūrtiḥ sa śālagrāmaśilāsthitaḥ /
dvārakādiśilāsaṃstho dhyeyaḥ pūjyo 'pyahaṃ ca saḥ // GarP_1,44.14 //
manaso 'bhīpsitaṃ prāpya devo vaimāniko bhavet /
niṣkāmo muktimāpnoti mūrtiṃ dhyāyayaṃstuvañjapan // GarP_1,44.15 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe brahmamūrtidhyānanirūpaṇaṃ nāma catuścatvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 45
hariruvāca /
prasaṃgātkathayiṣyāmi śālagrāmasya lakṣaṇam /
śālagrāmaśilāsparśātkoṭijanmāghanāśanam // GarP_1,45.1 //
śakhacakragadāpadmī (hastaḥ) (keśavākhyo) gadādharaḥ /
sabjakaumādakīcakraśaṅkhī (nārāyaṇo) vibhuḥ // GarP_1,45.2 //
sacakraśaṅkhābjagado (mādhavaḥ) śrīgadādharaḥ /
gadabjaśaṅkhacakrī vā (govindo)'rcyo gadādharaḥ // GarP_1,45.3 //
padmaśaṅkhārigādine (viṣṇurūpāya) te namaḥ /
saśaṅkhābjagadācakra (madhusūdanamūrtaye) // GarP_1,45.4 //
namo gadāriśaṅkhābjayukta(traivikramāya) ca /
sārikaumodakīpadmaśaṅkha(vāmanamūrtaye) // GarP_1,45.5 //
cakrābjaśaṅkhagādine namaḥ (śrīdharamūrtaye) /
(hṛṣīkeśāyā)'bjagadāśaṅkhine cakriṇe namaḥ // GarP_1,45.6 //
sābjacakragadāśaṅkha(padmanābhasvarūpiṇe) /
śaṅkhacakragadāpadmin (dāmodara) manonamaḥ // GarP_1,45.7 //
sāriśaṅkhagadābjāya (vāsudevāya) vai namaḥ /
śaṅkhābjacakragādine namaḥ (saṅkarṣaṇāya) ca // GarP_1,45.8 //
suśaṅkhasugadābjāridhṛte (pradyumnamūrtaye) /
namo('niruddhāya) gadāśaṅkhābjārīvidhāriṇe // GarP_1,45.9 //
sābjaśaṅkhagadācakra(puruṣottamamūrtaye) /
namo('dhokṣajarūpāya) gadāśaṅkhāripadmine // GarP_1,45.10 //
(nṛsiṃhamūrtaye) padmagadāśaṅkhāridhāriṇe /
padmāriśaṅkhagadine namo '(stvacyutamūrtaye) // GarP_1,45.11 //
saśaṅkacakrābjagadaṃ (janārdana) mihānaye /
(upendraḥ) sagadaḥ sāriḥ padmaśaṅkhinnamonamaḥ // GarP_1,45.12 //
sucakrābjagadāśaṅkhayuktāya (harimūrtaye) /
sagadābjāriśaṅkhāya namaḥ (śrīkṛṣṇamūrtaye) // GarP_1,45.13 //
śālagrāmaśilādvāragatalagnadvicakradhṛk /
śuklābho(vāsudevākhyaḥ) so 'vyādvaḥ śrīgadādharaḥ // GarP_1,45.14 //
lagnadvicakro raktābhaḥ pūrvabhāgastupuṣkalaḥ /
saṃkarṣaṇo 'tha(pradyumnaḥ) sūkṣmacakrastu pītakaḥ // GarP_1,45.15 //
sa dīrghaḥ saśiraśchidro yo('niruddhastu) vartulaḥ /
nīlo dvāri trirekhaśca atha (nārāyaṇo)'sitaḥ // GarP_1,45.16 //
madhye gādakṛtī rekhā nābhicakro (kra) mahonnataḥ /
pṛthuvakṣā (nṛsiṃho) vaḥ kapilo 'vyāttribindukaḥ // GarP_1,45.17 //
athavā pañcabindustatpūjanaṃ brahmacāriṇaḥ /
(varāhaḥ) śaktiliṅgo 'vyādviṣamadvayacakrakaḥ // GarP_1,45.18 //
nīlastrirekhaḥ sthūlo 'tha (kūrmamūrtiḥ sa bindumān /
(kṛṣṇaḥ) sa vartulāvartaḥ pātu vo natapṛṣṭhakaḥ // GarP_1,45.19 //
(śrīdharaḥ) pañcarekho 'vyā (dvanamālī) gādāṅkitaḥ /
(vāmano) vartulo hrasvo vā (rā) macakraḥ sureśvaraḥ // GarP_1,45.20 //
nānāvarṇo 'nekamūrtirnāgabhogī (tvanantakaḥ) /
sthūlo (dāmodaro) nīlo madhyevakraḥ sunīlakaḥ // GarP_1,45.21 //
saṃkīrṇadvārakaḥ so 'vyādatha brahmā sulohitaḥ /
sadīrgharekhaḥ suṣira ekacakrāmbujaḥ pṛthuḥ // GarP_1,45.22 //
pṛthucchidraḥ sthūlacakraḥ(kṛṣṇo) (viṣṇuśca) bilvavat /
(hayagrīvo) 'ṅkuśākāraḥ pañcarekhaḥ sakaustubhaḥ // GarP_1,45.23 //
(vaikuṇṭho maṇiratnābha ekacakrāmbujo 'sitaḥ /
(matsyo) dīrgho 'mbujākāro dvārarekhaśca pātu vaḥ // GarP_1,45.24 //
rāmacakro dakṣarekhaḥ śyāmovo 'vyā (ttrivikramaḥ) /
śālagrāme dvārakāyāṃ sthitāya gadina namaḥ // GarP_1,45.25 //
ekadvāraścatuścakro vanamālāvibhūṣitaḥ /
svarṇarekhāsamāyukto goṣpadena virājitaḥ // GarP_1,45.26 //
kadambakusumākāro (lakṣmīnārāyaṇo)'vatu /
ekena lakṣito yovyādradādhārī (sudarśanaḥ) // GarP_1,45.27 //
(lakṣmīnārāyaṇo) dvābhyāntribhirmūrti(strivikramaḥ) /
caturbhiśca (caturvyūho) (vāsudevaśca) pañcabhiḥ // GarP_1,45.28 //
(pradyumnaḥ) ṣaḍūbhireva syāt (saṃkarṣaṇa) itastataḥ /
(puruṣottamo)'ṣṭabhiḥ syā(nnavavyūho) navāṅkitaḥ // GarP_1,45.29 //
(daśāvatāro) daśabhiraniruddho 'vatādatha /
(dvādaśātmā) dvādaśabirata ūrdhva(manantakaḥ) // GarP_1,45.30 //
viṣṇormūrtimayaṃ stotraṃ yaḥ paṭhetsa divaṃ vrajet /
(brahmā) caturmukho daṇḍī kamaṇḍaluyugānvitaḥ // GarP_1,45.31 //
(maheśvaraḥ) prañcavakro daśabāhurvṛṣadhvajaḥ /
yathāyudhastathā gaurī caṇḍikā ca sarasvatī // GarP_1,45.32 //
mahālakṣmīrmātaraśca padmahasto (divākaraḥ) /
gajāsyaśca gaṇaḥ skandaḥ ṣaṇmukhonekadhā guṇāḥ // GarP_1,45.33 //
ete 'rcitāḥ sthāpitāśca prāsāde vāstupūjite /
dharmārthakāmamokṣādyāḥ prāpyante puruṣeṇa ca // GarP_1,45.34 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śālagrāmamūrtilakṣaṇaṃ nāma pañcacatvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 46
hariruvāca /
vāstuṃ saṃkṣepato vakṣye gṛhādau vighnanāśanam /
īsānakoṇādārabhya hyekāśītipade yajet // GarP_1,46.1 //
īśāne ca śiraḥ pādau nairṛte 'gnyanile karau /
āvāsavāsaveśmādau pure grāme vaṇikpathe // GarP_1,46.2 //
prāsādārāmadurgeṣu devālayamaṭheṣu ca /
dvāviṃśati surānbāhye tadantaśca trayodaśa // GarP_1,46.3 //
īśaścaivātha parjanyo jayantaḥ kuliśāyudhaḥ /
sūryaḥ satyo bhṛguścaiva ākāśo vāyureva ca // GarP_1,46.4 //
pūṣā ca vitathaścaiva grahakṣetrayamāvubhau /
gandharvo bhṛgurājastu mṛgaḥ pitṛgaṇastathā // GarP_1,46.5 //
dauvāriko 'tha sugrīvaḥ puṣpadanto gaṇādhipaḥ /
asuraḥ śeṣapāpau (dau) ca rogo/ḍahimukha (khya) eva ca // GarP_1,46.6 //
bhallāṭaḥ somasarpau ca aditiścaditistathā /
bahirdvātriṃśadete tu tadantaścaturaḥ śṛṇu // GarP_1,46.7 //
īśānādicatuṣkoṇasaṃsthitānpūjayeddhudhaḥ /
āpaścaivātha sāvitrī jayo rudrastathaiva ca // GarP_1,46.8 //
madhye navapade brahmā tasyāṣṭhau ca samīpagān /
devānekottarānetānpūrvādau nāmataḥ śṛṇu // GarP_1,46.9 //
aryamā savitā caiva vivasvānvibudhādhipaḥ /
mitro 'tha rājayakṣmā ca tathā pṛthvīdharaḥ kramāt // GarP_1,46.10 //
aṣṭamaścāpavatsaśca parito brahmaṇaḥ smṛtāḥ /
īśānakoṇādārabhya durge car (jñeyo) vaṃśa ucyate // GarP_1,46.11 //
āgneyakoṇādārabhya vaṃśo bhavati durdharaḥ /
aditiṃ himavantaṃ ca jayantaṃ ca idaṃ trayam // GarP_1,46.12 //
nāyikā kālikā nāma śakrādrandharvagāḥ punaḥ /
vāstudevānpūjayitvā gṛhaprāsādakṛdbhavet // GarP_1,46.13 //
surejyaḥ purataḥ kāryo yasyāgneyyāṃ mahānasam /
kapinirgamane (ṇī)?yena pūrvataḥ satramaṇḍapam // GarP_1,46.14 //
gandhapuṣpagṛhaṃ kāryamaiśānyāṃ paṭṭasaṃyutam /
bhāṇḍāgāraṃ ca kauberyāṃ goṣṭhāgāraṃ ca vāyave // GarP_1,46.15 //
udagāśrayaṃ ca vāruṇyāṃ vātāyanasamanvitam /
samitkuśendhanasthānamāyudhānāṃ ca nairṛte // GarP_1,46.16 //
abhyāgatālayaṃ ramyasaśayyāsanāpadukam /
toyāgnidīpasadbhṛtyairyuktaṃ dakṣiṇato bhavet // GarP_1,46.17 //
gṛhāntarāṇi sarvāṇi sajalaiḥ kadalīgṛhaiḥ /
pañcavarṇaiśca kusumaiḥ śobhitāni prakalpayet // GarP_1,46.18 //
prākāraṃ tadvahirdadyātpañcahastapramāṇataḥ /
evaṃ viṣṇvāśramaṃ kuryādvanaiścopavanairyutam // GarP_1,46.19 //
catuḥ ṣaṣṭipado vāstuḥ prāsādādau prapūjitaḥ /
madhye catuṣpado brahmā dvipa dāstvaryamādayaḥ // GarP_1,46.20 //
karṇe caivātha śikhyādyāstathā devāḥ prakīrtitāḥ /
tebhyo hyubhayataḥ sārdhādanye 'pi dvipadāḥ surāḥ // GarP_1,46.21 //
catuḥ ṣaṣṭipadā devā ityevaṃ parikīrtitāḥ /
carakī ca vidārī ca pūtanā pāparākṣasī // GarP_1,46.22 //
īśānādyāstato bāhye devādyā hetukādayaḥ /
haitukastripurāntaśca agnivetālakau yamaḥ // GarP_1,46.23 //
agnijihvaḥ kālakaśca karālo hyakapādakaḥ /
aiśānyāṃ bhīmarūpastu pātāle pretanāyakaḥ // GarP_1,46.24 //
ākāśe gandhamālī syātkṣetrapālāṃstato yajet /
vistārābhihataṃ dairghyaṃ rāśiṃ vāstostu kārayet // GarP_1,46.25 //
kṛtvā ca vasubhirbhāgaṃ śeṣaṃ baddhā yamādiśet /
punarguṇitamaṣṭābhirṛbhāgaṃ tu bhājayet // GarP_1,46.26 //
yaccheṣaṃ tadbhavedṛkṣaṃ bhāgairhṛtvāvyayaṃ bhavet /
ṛkṣaṃ caturguṇaṃ kṛtvā navabhirbhāgahāritam // GarP_1,46.27 //
śeṣamaṃśaṃ vijānīyāddevalasya mataṃ yathā /
aṣṭābhirguṇitaṃ piṇḍaṃ ṣaṣṭibhirbhāgāharitam // GarP_1,46.28 //
yaccheṣaṃ tadbhavejjīvaṃ maraṇaṃ bhatahāritam /
vāstukroḍe gṛhaṃ kuryānna pṛṣṭhe mānavaḥ sadā // GarP_1,46.29 //
vāmapārśvena svāpiti nātra kāryā vicāraṇā /
siṃhakanyātulāyāṃ ca dvāraṃ śudhyedathottaram // GarP_1,46.30 //
evaṃ ca vṛścikādau syātpūrvadakṣiṇapaścimam /
dvāraṃ dīrghārdhavistāraṃ dvārāṇyaṣṭau smṛtāni ca // GarP_1,46.31 //
santānapreṣyanīcatvaṃ svayānaṃ svarṇabhūṣaṇam /
sutahīnaṃ tu raudreṇa vīryaghnaṃ dakṣiṇe tathā // GarP_1,46.32 //
vahnau badhaścāyurvṛddhiṃputtralābhasutṛptidaḥ /
dhanade nṛpapīḍādamarthaghnaṃ rogadaṃ jale // GarP_1,46.33 //
nṛpabhī tirmṛtāpatyaṃ hyanapatyaṃ na vairadam /
arthadaṃ cārthahānyai ca doṣadaṃ putramṛtyudam // GarP_1,46.34 //
dvārāṇyuttarasaṃjñāni pūrvadvārāṇi vacmyaham /
agnibhītirbahu kanyādhanasaṃmānakopadam // GarP_1,46.35 //
rājaghnaṃ kopadaṃ pūrve phalato dvāramīritam /
īśānādau bhavetpūrvamagneyyādau tu dakṣiṇam // GarP_1,46.36 //
nairṛtyādau paścimaṃ syādvāyavyādau tu cottaram /
aṣṭabhāge kṛte bhāge dvārāṇāṃ ca phalāphalam // GarP_1,46.37 //
aśvatthaplakṣanyagrodhāḥ pūrvādau syādudumbaraḥ /
gṛhasya śobhanaḥ prokta īśāne caiva sālmaliḥ /
pūjito vignahārī syātprāsādasya gṛhasya ca // GarP_1,46.38 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vāstumānalakṣaṇaṃ nāma ṣaṭcatvāriṃśo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 47
sūta uvāca /
prāsādānāṃ lakṣaṇaṃ ca vakṣye śaunaka tacchṛṇu /
catuḥ ṣaṣṭipadaṃ kṛtvā digvidikṣūpalakṣitam // GarP_1,47.1 //
catuṣkoṇaṃ caturbhiśca dvārāṇi sūryasaṃkhyayā /
catvāriṃśāṣṭabiścaiva bhittīnāṃ kalpanā bhavet // GarP_1,47.2 //
ūrdhvakṣetrasamā jaṅghā jaṅghārdhadviguṇaṃ bhavet /
garbhavistāravistīrṇaḥ śukāṅghriśca vidhīyate // GarP_1,47.3 //
tattribhāgena kartavyaḥ pañcabhāgena vā punaḥ /
nirgamastu śukāṅghreśca ucchrāyaḥ śikharārdhagaḥ // GarP_1,47.4 //
caturdhā śikharaṃ kṛtvā tribhāge vedibandhanam /
caturthe punarasyaiva kaṇṭhamāmūlasādhanam // GarP_1,47.5 //
atha vāpi samaṃ vāstuṃ kṛtvā ṣoḍaśabhāgikam /
tasya madhye caturbhāgamādau garbhaṃ tu kārayet // GarP_1,47.6 //
caturbhāgena bhittīnāmucchrāyaḥ syātpramāṇataḥ // GarP_1,47.7 //
dviguṇaḥ śikharocchrāyo bhittyucchāyācca mānataḥ /
śikharārdhasya cairdhena vidheyāstu pradakṣiṇāḥ // GarP_1,47.8 //
caturdikṣu tathā jñeyo nirgamastuḥ tathā budhaiḥ /
pañcabhāgena saṃbhajya garbhamānaṃ vicakṣaṇaḥ // GarP_1,47.9 //
bhāgamekaṃ gṛhītvā tu nirgamaṃ klapayetpunaḥ /
garbhasūtrasamo bhāgādagrato mukhamaṇḍapaḥ // GarP_1,47.10 //
etatsāmānyamuddiṣṭaṃ prāsādasya hi lakṣaṇam /
liṅgamānamatho vakṣye pīṭho liṅgasamo bhavet // GarP_1,47.11 //
dviguṇena bhavedrarbhaḥ samantācchaunaka dhruvam /
taddvidhā ca bhavedbhītirjaṅghā tadvistarārdhagā // GarP_1,47.12 //
dviguṇaṃ śikharaṃ proktaṃ jaṅghāyāścaiva śaunaka /
pīṭhagarbhāvaraṃ karma tanmānena śukāṅghrikam // GarP_1,47.13 //
nir gamastu samākhyātaḥ śeṣaṃ pūrvavadeva tu /
liṅgamānaṃ smṛtaṃ hyetaddvāramānamathocyate // GarP_1,47.14 //
karāgraṃ vedavatkṛtvā dvāraṃ bhāgāṣṭamaṃ bhavet /
vistareṇa samākhyātaṃ dviguṇaṃsvecchayā bhavet // GarP_1,47.15 //
dvāravatpīṭhamadhye tu śeṣaṃ suṣirakaṃ bhavet /
pādikaṃ śeṣikaṃ bhittirdvārārdhena parigrahāt // GarP_1,47.16 //
tadvistārasamā jaṅghā sikharaṃ dviguṇaṃ bhavet /
śukāṅghriḥ pūrvavajjñeyā nirgamocchrāyakaṃ bhavet // GarP_1,47.17 //
maṇḍape mānametattu svarūpaṃ cāparaṃ vade /
traivedaṃ kārayetkṣetraṃ yatra tiṣṭhanti devatāḥ // GarP_1,47.18 //
itthaṃ kṛtena mānena bāhyabhāgavinirgatam /
nemiḥ pādena vistīrṇā prāsādasya samantataḥ // GarP_1,47.19 //
garbhaṃ tu dviguṇaṃ kuryānnemyā mānaṃ bhavediha /
sa eva bhitterutsedho śikharo dviguṇo mataḥ // GarP_1,47.20 //
prāsādānāṃ ca vakṣyāmi mānaṃ yoniṃ ca mānataḥ /
vairājaḥ puṣpakākhyaśca kailāso mālikāhvayaḥ // GarP_1,47.21 //
triviṣṭapaṃ ca pañcaite prāsādāḥ sarvayonayaḥ /
prathamaścaturaśro hi dvitīyastu tadāyataḥ // GarP_1,47.22 //
vṛtto vṛttāyataścānyo 'ṣṭāśraśceha ca pañcamaḥ /
etebhya eva sambhūtāḥ prāsādāḥ sumanoharāḥ // GarP_1,47.23 //
sarvaprakṛtibhūtebhyaścatvāriṃśattathaiva ca /
meruśca mandaraścaiva vimānaśca tathāparaḥ // GarP_1,47.24 //
bhadrakaḥ sarvatā bhadro rucako nandanastathā /
nandivardhanasaṃjñaśca śrīvatsaśca navetyamī // GarP_1,47.25 //
caturaśrāḥ samudbhūtā vairājāditi gamyatām /
valabhī gṛharājaśca śā lāgṛhaṃ ca mandiram // GarP_1,47.26 //
vimānaṃ ca tathā brahmamandiraṃ bhavanaṃ tathā /
uttambhaṃ śibikā veśma navaite puṣpakodbhavāḥ // GarP_1,47.27 //
valayo dundubhiḥ padmo mahāpadmastathāparaḥ /
mukulī cāsya uṣṇīṣī śaṅkhaśca kalaśastathā // GarP_1,47.28 //
guvāvṛkṣastathānyaśca vṛttāḥ kailāsasambhavāḥ /
gajo 'tha vṛṣabho haṃso garuḍaḥ siṃhanāmakaḥ // GarP_1,47.29 //
bhūmukho bhūdharaścaiva śrījayaḥ pṛthivīdharaḥ /
vṛttāyatāḥ samudbhūtā navaite maṇikāhvayāt // GarP_1,47.30 //
vajraṃ cakraṃ tathānyacca muṣṭikaṃ vabhrusaṃjñitam /
vakraḥ svastikakhaḍgau ca gadā śrīvṛkṣa eva ca // GarP_1,47.31 //
vijayo nāmataḥ śvetastriviṣṭipasamudbhavāḥ /
trikoṇaṃ padmamardhenduścatuṣkoṇaṃ dviraṣṭakam // GarP_1,47.32 //
yatra tatra vidhātavyaṃ saṃsthānaṃ maṇḍapasya tu /
rājyaṃ ca vibhavaścaivaḥ hyāyurvardvanameva ca // GarP_1,47.33 //
putralābhaḥ striyaḥ puṣṭistrikoṇādikramādbhavet /
kuryāddhajādikaṃ khyātadvāri garbhagṛhaṃ tathā // GarP_1,47.34 //
maṇāḍapaḥ samasaṃkhyābhirguṇitaḥ sūtrakastathā /
maṇḍapasya caturthāṃśādbhadraḥ kāryo vijānatā // GarP_1,47.35 //
spardhāgavākṣakopeto nirgavākṣo 'tha vā bhavet /
sārdhabhittipramāṇena bhitimānena vā punaḥ // GarP_1,47.36 //
bhitterdvaiguṇyato vāpi kartavyā maṇḍapāḥ kracit /
prāsāde mañcarī kāryā citrā viṣamabhūmikā // GarP_1,47.37 //
parimāṇavirodhena rekhāvaiṣamyabhūṣitā /
ādhārastu caturdhāraścaturmaṇḍapaśobhitaḥ // GarP_1,47.38 //
śataśṛṅgasamāyukto meruḥ prāsāda uttamaḥ /
maṇḍapāstasya kartavyā bhadraistribhiralaṅkṛtāḥ // GarP_1,47.39 //
ghacanākāramānānāṃ bhinnābhinnā bhavanti te /
kiyanto yeṣu cādhārā nirādhārāśca kecana // GarP_1,47.40 //
praticchandakabhedena prāsādāḥ sambhavanti te /
anyonyāsaṃkarāsteṣāṃ ghaṭanānāmabhedataḥ // GarP_1,47.41 //
devatānāṃ viśeṣāya prāsādā bahavaḥ smṛtāḥ /
prāsāde niyamo nāsti devatānāṃ svayambhuvām // GarP_1,47.42 //
tāneva devatānāṃ ca pūrvamānena kārayet /
caturaśrāyatāstattra catuṣkoṇasamanvitāḥ // GarP_1,47.43 //
candraśālānvitā kāryā bherīśikharasaṃyutā /
purato vāhanānāṃ ca kartavyā lagna(ghu) maṇḍapāḥ // GarP_1,47.44 //
nāṭyaśālā ca kartavyā dvāradeśasamāśrayā /
prasāde devatānāṃ ca kāryā dikṣu vidikṣvapi // GarP_1,47.45 //
dvārapālāśca kartavyā mukhyā gatvā pṛthakpṛthak /
kiñcidadūrataḥ kāryā maṭhāstatropajīvinām // GarP_1,47.46 //
prāvṛtā jagatī kāryā phalapuṣpajalānvitā /
prasādeṣu surāṃsthāpya pūjābhiḥ pūjayennaraḥ /
vāsudevaḥ sarvadevaḥ sarvabhāk tadgṛhādikṛt // GarP_1,47.47 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśe ācārakāṇḍe prāsādaliṅgamaṇḍapādilakṣaṇanirūpaṇaṃnāma saptacatvāriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 48
sūta uvāca /
pratiṣṭhāṃ sarvadevānāṃ saṃkṣepeṇa vadāmyaham /
sutithyādau suramyāṃ ca pratiṣṭhāṃ kārayedguruḥ // GarP_1,48.1 //
ṛtvigbhiḥ saha cācāryaṃ varayenmadhyadeśagam /
svaśākhoktavidhānena atha vā praṇavena tu // GarP_1,48.2 //
pañcabhirbahubhirvātha kuryātpādyārghyameva ca /
mudrikābhistathā vastrairgandhamālyānulepanaiḥ // GarP_1,48.3 //
mantranyāsaṃ guruḥ kṛtvā tataḥ karma samārabhet /
prāsādasyāgrataḥ kuryānmaṇḍapaṃ daśahastakam // GarP_1,48.4 //
kuryāddvādaśahastaṃ vā stambhaiḥ ṣoḍaśabhiryutam /
dhvajāṣṭakaiścaturhastāṃ madhye vediṃ ca kārayet // GarP_1,48.5 //
nadīsaṃgamatīrātthāṃ vālukāṃ tatra dāpayet /
caturaśraṃ kārmukābhaṃ vartulaṃ kamalākṛti // GarP_1,48.6 //
pūrvāditaḥ samārabhya kartavyaṃ kuṇḍapañcakam /
athavā caturaśrāṇi sarvāṇyetāni kārayet // GarP_1,48.7 //
śāntikarmidhānena sarvakāmārthasiddhaye /
śiraḥ sthāne tu devasya ācāryo homamācaret // GarP_1,48.8 //
aiśānyāṃ kecidicchanti upalipyāvaniṃ śubhām /
dvārāṇi caiva catvāri kṛtvā vai toraṇāntike // GarP_1,48.9 //
nyagrodhodumbarāśvatthabailvapālāśakhādirāḥ /
toraṇāḥ pañcahastāśca vastrapuṣpādyalaṅkṛtāḥ // GarP_1,48.10 //
nikhaneddhastamekakaṃ catvāraścaturo diśaḥ /
pūrvadvāre mṛgendraṃ tu hayarājaṃ tu dakṣiṇe // GarP_1,48.11 //
paścime gopatirnāma suraśārdūlamuttare /
agnimīleti hi mantreṇa prathamaṃ pūrvato nyaset // GarP_1,48.12 //
īṣetvetihi mantreṇa dakṣiṇasyāṃ dvitīyakam /
agnāyāhimantreṇa paścimasyāṃ tṛtīyakam // GarP_1,48.13 //
śannodevīti mantreṇa uttarasyāṃ caturthakam /
pūrve ambudavatkāryā āgnoyyāṃ dhūmarūpiṇī // GarP_1,48.14 //
yāmyāṃ vai kṛṣṇarūpā tu nairṛtyā śyāmalā (dhūsarā) bhavet /
vāruṇyāṃ pāṇḍurā jñeyā vāyavyāṃ pītavarṇikā // GarP_1,48.15 //
uttare raktavarṇā tu śukleśī ca patākikā /
bahurūpā tathā madhye indravidyeti pūrvake // GarP_1,48.16 //
āgniṃ saṃsuptimantreṇa yamonāgeti dakṣiṇe /
pūjyā rakṣohanoveti paścime uttare 'pi ca // GarP_1,48.17 //
vāta ityabhiṣicyātha āpyāyasveti cottare /
tamīśānamataścaiva viṣṇornuketi madhyame // GarP_1,48.18 //
kalaśau tu tato dvaudvau niveśyau toraṇāntike /
vastrayugmasamāyuktāścandanādyaiḥ svalaṅkṛtāḥ // GarP_1,48.19 //
puṣpairvitānairbahulairādivarṇābhimantritāḥ /
dikpālāśca tataḥ pūjyāḥ śāstradṛṣṭena karmaṇā // GarP_1,48.20 //
trātāramindrabhantreṇa agnirmūrdheti cāpare /
asminvṛkṣa itaṃ caiva pracārīti parā smṛtā // GarP_1,48.21 //
kiñcedadhātu ācatvābhitvādeti ca saptamī /
imārudreti dikyālānpūjayitvā vicakṣaṇaḥ // GarP_1,48.22 //
homadravyāṇi vāyavye kuryātsopaskarāṇi ca /
śaṅkhāñchāstroditāñchvetānnetrābhyāṃ vinyasedguruḥ // GarP_1,48.23 //
ālokanena dravyāṇi śuddhiṃ yānti na saṃśayaḥ /
tdṛdayādīni cāṅgāni vyāhṛtipraṇavena ca // GarP_1,48.24 //
astraṃ caiva samastānāṃ nyāso 'yaṃ sarvakāmikaḥ /
akṣatānviṣṭaraṃ caiva astreṇaivābhimantritān // GarP_1,48.25 //
viṣṭareṇa spṛśedduvyānyāgamaṇḍapasaṃbhṛtān /
akṣatānvikiretpaścādastrapūtānsamantataḥ // GarP_1,48.26 //
śakrīṃ diśamathārabhya yāvadīśānagocaram /
avakīryākṣatārnsaṃvāṃllepayenmaṇḍapaṃ tataḥ // GarP_1,48.27 //
gandhādyairarghyapātre ca mantragrāmaṃ nyasedguruḥ /
tenārghyapātratoyena prokṣayedyāgamaṇḍapam // GarP_1,48.28 //
pratiṣṭhā yasya devasya tadākhyaṃ kalaśaṃ nyaset /
aiśānyāṃ pūjayedyāmye astreṇaiva ca bardhanīm // GarP_1,48.29 //
kalaśaṃ vardhanīṃ caiva grahānvāsttoṣpatiṃ tathā /
āsanetāni sarvāṇi praṇavākhyaṃ japedguruḥ // GarP_1,48.30 //
sūtragrīvaṃ ratnagarbhaṃ vastrayugmena veṣṭitam /
sarvauṣadhīgandhaliptaṃ pūjayetkalaśaṃ guruḥ // GarP_1,48.31 //
devastu kalaśe pūjyo vardhanyā vastramuttamam /
vardhanyā tu samāyuktaṃ kalaśaṃ bhrāmayedanu // GarP_1,48.32 //
vardhanīdhārayā siñcannagrato dhārayettataḥ /
abhyarcya vardhanīkumbhaṃ sthaṇḍile devamarcayet // GarP_1,48.33 //
ghaṭaṃ cāvāhya vāyavyāṃ gaṇānāṃ tveti sadgaṇam /
devamīśānakoṇe tu japedvāstoṣpatiṃ budhaḥ // GarP_1,48.34 //
vāstoṣpatīti mantreṇa vāstudoṣopaśāntaye /
kumbhasya pūrvato bhūtaṃ gaṇadevaṃ baliṃ haret // GarP_1,48.35 //
paṭhediti ca vidyāśca kuryādālambhanaṃ budhaḥ /
yogeyogeti mantreṇāstaraṇaṃ śādvalaiḥ kuśaiḥ // GarP_1,48.36 //
ṛtvigbhiḥ sārdhamācāryaḥ snānapīṭhe gurustadā /
vividhairbrahmaghoṣaiśca puṇyāhajayamaṅgalaiḥ // GarP_1,48.37 //
kṛtvā brahmarathe devaṃ pratiṣṭhanti tato dvijāḥ /
aiśānyāmānayetpīṭhamaṇḍape vinyasedguruḥ // GarP_1,48.38 //
bhadraṅkarṇetyatha snātvā sūtravalkalajena tu /
saṃsnāpya lakṣaṇoddhāraṃ kuryāttūryādi (dūrābhi) vādanaiḥ // GarP_1,48.39 //
madhusarpiḥ samāyuktaṃ kāṃsye vā tāmrabhājane /
akṣiṇī cāñjayeccāsya suvarṇasya śalākayā // GarP_1,48.40 //
agnirjyotīti mantreṇa netrodvāṭaṃ tu kārayet /
lakṣaṇe kriyamāṇe tu nāmaikaṃ sthāpako va(da) det // GarP_1,48.41 //
imaṃmegaṅgemantreṇa netrayoḥ śītalakriyā /
agnirmūrdheti mantreṇa dadyādvalmī kamṛttikām // GarP_1,48.42 //
bilvodumbaramaśvatthaṃ vaṭaṃ pālāśameva ca /
yajñāyajñeti mantreṇa dadyātpañcakaṣāyakam // GarP_1,48.43 //
pañcagavyaṃ snāpayecca sahadevyādi bhistataḥ /
sahadevī balā caiva śatamūlī śatāvarī // GarP_1,48.44 //
kumārī ca guḍūcī ca siṃhī vyāghrī tathaiva ca /
yā oṣadhīti mantreṇa snānamoṣadhimajjalaiḥ // GarP_1,48.45 //
yāḥ phalinīti mantreṇa phalasnānaṃ vidhīyate /
drupadādiveti mantreṇa kāryamudvartanaṃ budhaiḥ // GarP_1,48.46 //
kalaśeṣu ca vinyasya uttarādiṣvanukramāt /
ratnāni caiva dhānyāni oṣadhīṃ śatapuṣpikām // GarP_1,48.47 //
samudrāṃścaiva vinyasya caturaścaturo diśaḥ /
kṣīraṃ dadhi kṣīrodasya ghṛtodasyeti vā punaḥ // GarP_1,48.48 //
āpyāyasva dadhikrāvṇo yā auṣadhīritīti ca /
tejo 'sīti ca mantraiśca kumbhaṃ caivābhimantrayet // GarP_1,48.49 //
samudrākhyaiścaturbhiśca snāpayetkalaśaiḥ punaḥ /
snātaścaiva suveṣaśca dhūpo deyaśca gugguluḥ // GarP_1,48.50 //
abhiṣekāya kumbheṣu tattattīrthāni vinyaset /
pṛthivyāṃ yāni tīrthāni saritaḥ sāgarāstathā // GarP_1,48.51 //
yā oṣadhīti mantreṇa kumbhaṃ caivābhimantrayet /
tena toyena yaḥ snāyātsa mucyetsarvapātakaiḥ // GarP_1,48.52 //
abhiṣicya samudraiśca tvarghyaṃ dadyāttataḥ punaḥ /
gandhadvāreti gandhaṃ ca nyāsaṃ vai vedamantrakaiḥ // GarP_1,48.53 //
svaśāstravihitaiḥ prāptairyuvaṃvastreti vastrakam /
kavihāviti mantreṇa ānayenmaṇḍapaṃ śubham // GarP_1,48.54 //
śambhavāyeti mantreṇa śayyāyāṃ viniveśayet /
viśvataścakṣurmantreṇa kuryātsakalaniṣkalam // GarP_1,48.55 //
sthitvā caiva pare tattve mantranyāsaṃ tu kārayet /
svaśāstravihito mantro nyāsastasmiṃstathoditaḥ // GarP_1,48.56 //
vastreṇācchādayitvā tu pūjanīyaḥ svabhāvataḥ /
yathāśāstraṃ nivedyāni pādamūle tu dāpayet // GarP_1,48.57 //
atha praṇavasaṃyuktaṃ vastrayugmena veṣṭitam /
kalaśaṃ sahiraṇyaṃ ca śiraḥ sthāne nivedayet // GarP_1,48.58 //
sthitvā kuṇḍasamīpe 'tha agneḥ sthāpanamācaret /
svaśāstravihitairmantrairvedoktairvātha vā guruḥ // GarP_1,48.59 //
śrīsūktaṃ pāvamānyaṃ ca vāsadāmyasavājinam /
vṛṣākapiṃ ca mitraṃ bahvacaḥ pūrvato japet // GarP_1,48.60 //
rudraṃ puruṣasūktaṃ ca ślokādhyāyaṃ ca śukriyam /
brahmāṇaṃ pitṛmaitraṃ ca adhvaryurdakṣiṇe japet // GarP_1,48.61 //
vedavrataṃ vāmadevyaṃ jyeṣṭhasāma rathantaram /
bheruṇḍāni ca sāmāni chandogaḥ paścime japet // GarP_1,48.62 //
atharvaśirasaṃ caiva kumbhasūktamatharvaṇaḥ /
nīlarudrāṃśca maitraṃ ca atharvaścottare japet // GarP_1,48.63 //
kuṇḍaṃ cāstreṇa saṃprokṣya ācāryastu viśeṣataḥ /
tāmrapātre śarāve vā yathāvibhavato 'pi vā // GarP_1,48.64 //
jātavedasamānīya agratastaṃ niveśayet /
astreṇa jvālayedvahniṃ kavacena tu veṣṭayet // GarP_1,48.65 //
amṛtīkṛtya taṃ paścānmantraiḥ sarvaiśca deśikaḥ /
pātraṃ gṛhya karābhyāṃ ca kuṇḍaṃ bhrāmya tataḥ punaḥ // GarP_1,48.66 //
vaiṣṇavena tu yogena paraṃ tejastu niḥ kṣipet /
dakṣiṇe sthāpayedbrahma praṇītāñcottareṇa tu // GarP_1,48.67 //
sādhāraṇena mantreṇa svasūtravihitena vā /
dikṣudikṣu tato dadyātparidhiṃ viṣṭaraiḥ saha // GarP_1,48.68 //
brahmaviṣṇuhareśānāḥ pūjyāḥ sādhāraṇena tu /
darbheṣu sthāpayedvahniṃ darbhaiśca pariveṣṭitam // GarP_1,48.69 //
darbhatoyena saṃspṛṣṭo mantrahīno 'pi śudhyati /
prāgagrairudagagraiśca pratyagagrairakhaṇḍitaiḥ // GarP_1,48.70 //
vitatairveṣṭito vahniḥ svayaṃ sānnidhyamāvrajet /
agnestu rakṣaṇārthāya yaduktaṃ karma ntravit // GarP_1,48.71 //
ācāryāḥ kecidicchanti jātakarmādyanantaram /
pavitraṃ tu tataḥ kṛtvā kuryādājyasya saṃskṛtim // GarP_1,48.72 //
ācāryo 'tha nirīkṣyāpi nīrājyamabhimantritam /
ājyabhāgābhighārāntamavekṣetājyasiddhaye // GarP_1,48.73 //
pañcapañcāhutīrhutvā ājyena tadanantaram /
garbhādhānāditastāvadyāvadgaudānikaṃ bhavet // GarP_1,48.74 //
svaśāstravihitairmantraiḥ praṇavenātha homayet /
tataḥ pūrṇāhutiṃ dattvā pūrṇātpūrṇamanārethaḥ // GarP_1,48.75 //
evamutpādito vahniḥ sarvakarmasu siddhidaḥ /
pūjayitvā tato vahniṃ kuṇḍeṣu viharettathā // GarP_1,48.76 //
indrādīnāṃ svamantraiśca tathāhutiśataṃśatam /
purṇāhutiṃ śatasyānte sarveṣāṃ caiva homayet // GarP_1,48.77 //
svāmāhutimathājyeṣu hotā tatkalaśe nyaset /
devatāścaiva mantrāṃśca tathaiva jātavedasam // GarP_1,48.78 //
ātmānamekataḥ kṛtvā tataḥ pūrṇāṃ pradāpayet /
niṣkṛṣya bahirācāryo dikpālānāṃ baliṃ haret // GarP_1,48.79 //
bhūtānāṃ caiva devānāṃ nāgānāṃ ca prayogataḥ /
tilāśca samidhaścaiva homadravyaṃ dvayaṃ smṛtam // GarP_1,48.80 //
ājyaṃ tayoḥ sahakāri tatpradhānaṃ yadaṅka(kṣa)yoḥ /
paruṣasuktaṃ pūrveṇaiva rudracaiva tu dakṣiṇe // GarP_1,48.81 //
jyeṣṭhasāma ca bhāruṇḍaṃ tannayāmīti paścime /
nīlarudro mahāmantraḥ kumbhasūktamatharvaṇaḥ // GarP_1,48.82 //
hutvā sahasramekaikaṃ devaṃ śirasi kalpayet /
evaṃ madhye tathā pāde pūrṇāhutyā tathā punaḥ // GarP_1,48.83 //
śiraḥ sthāneṣu juhuyādāviśeccāpyanukramāt /
vedānāmādimantrairvā mantrairvā devanāmabhiḥ // GarP_1,48.84 //
svaśāstravihitairvāpi gāyattryā vātha te dvijāḥ /
gāyattryā vāthavācāryo vyāhṛtipraṇavena tu // GarP_1,48.85 //
evaṃ homavidhiṃ kṛtvā nyasenmantrāṃstu deśikaḥ /
caraṇāvagnimīḷe tu iṣetvo gulphayoḥ sthitāḥ // GarP_1,48.86 //
agna āyāhi jaṅghe dve śannodevīti jānunī /
bṛhadrathantare ūrū udareṣvātilo (svātino) nyaset // GarP_1,48.87 //
dīrghāyuṣṭvāya hṛdaye śrīścate galake nyaset /
trātāramindramurasi netrābhyāṃ tu triyambakam // GarP_1,48.88 //
mūrdhābhava tathā mūrdhni ālagnāddhomamācaret /
utthā payettato devamuttiṣṭhabrahmaṇaspate ! // GarP_1,48.89 //
vedapuṇyāhaśabdena prāsādānāṃ pradakṣiṇam /
piṇḍikālaṃbhanaṃ kṛtvā devasyatveti mantravit // GarP_1,48.90 //
dikpā lānsaha ratnaiśca dhātūnoṣadhayastathā /
lauhabījāni siddhāni paścāddevaṃ tu vinyaset // GarP_1,48.91 //
na garbhe sthāpayeddevaṃ na garbhaṃ tu parityajet /
īṣanmadhyaṃ parityajya tato doṣāpahaṃ tu tat // GarP_1,48.92 //
tilasya tuṣamātraṃ tu uttaraṃ kiñcidānayet /
oṃ sthiro bhava śivo bhava prajābhyaśca namonamaḥ // GarP_1,48.93 //
devasya tvā saviturvaḥ ṣaḍbhyo vai vinyasedguruḥ /
tattvavarṇakalāmātraṃ prajāni bhuvanātmaje // GarP_1,48.94 //
ṣaḍbhyo vinyasya siddhārthaṃ dhruvārthairabhimantrayet /
sampātakalaśenaiva snāpayetsupratiṣṭhitam // GarP_1,48.95 //
dīpadhūpasugandhaiśca naivedyaiśca prapūjayet /
arghyaṃ dattvā namaskṛtya tato devaṃ kṣamāpayet // GarP_1,48.96 //
pātraṃ vastrayugaṃ chatraṃ tathā divyāṅgulīyakam /
ṛttvigbhyaśca pradātavyā dakṣiṇā caiva śaktitaḥ // GarP_1,48.97 //
caturthau juhuyātpaścādyajamānaḥ samāhitaḥ /
āhutīnāṃ śataṃ hutvā tataḥ pūrṇāṃ pradāpayet // GarP_1,48.98 //
niṣkramya bahirācāryo dikpālānāṃ baliṃ haret /
ācāryaḥ puṣpahastastu kṣamasveti visarjayet // GarP_1,48.99 //
yāgānte kapilāṃ dadyādācāryāya ca cāmaram /
mukuṭaṃ kuṇḍalaṃ chatraṃ keyūraṃ kaṭisūtrakam // GarP_1,48.100 //
vyajanaṃ grāmavastrādīnsopaskāraṃ sumaṇḍapam /
bhojanaṃ ca mahātkuryātkṛtakṛtyaśca jāyate /
yajamāno vimuktaḥ syātsthāpakasya prasādataḥ // GarP_1,48.101 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe devapratiṣṭhādinirūpaṇaṃ nāmāṣṭacatvāriṃśo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 49
iti pratiṣṭhāprakaraṇaṃ samāptam /
brahmovāca /
sargādikṛddhariścaiva pūjyaḥ svāyambhuvādibhiḥ /
viprādyaiḥ svena dharmeṇa taddharmaṃ vyāsa ! vai śṛṇu // GarP_1,49.1 //
yajanaṃ yājanaṃ dānaṃ brāhmaṇasya pratigrahaḥ /
adhyāpanaṃ cādhyayanaṃ ṣaṭ karmāṇidvijottame // GarP_1,49.2 //
dānamadhyayanaṃ yajño dharmaḥ kṣattriyavaiśyayoḥ /
daṇḍastasya kṛṣirvaiśyasya śasyate // GarP_1,49.3 //
śuśrūṣaiva dvijātīnāṃ śūdrāṇāṃ dharmasādhanam /
kārukarma tathā'jīvo pākayajño 'pi dharmataḥ // GarP_1,49.4 //
bhikṣācaryātha śuśrūṣā guroḥ svādhyāya eva ca /
sandhyākarmāgnikāryañca dharmo 'yaṃ brahmacāriṇaḥ // GarP_1,49.5 //
sarveṣāmāśramāṇāṃ ca dvaividhyaṃ tu caturvidham /
brahmacāryupakurvāṇo naiṣṭhiko brahmatatparaḥ // GarP_1,49.6 //
yo 'dhītya vidhivadvedān gṛhasthāśramamāvrajet /
upakurvāṇako jñeyo naiṣṭhiko maraṇāntikaḥ // GarP_1,49.7 //
agnayo 'tithiśuśrūṣā yajño dānaṃ surārcanam /
gṛhasthasya samāsena dharmo 'yaṃ dvijasattama ! // GarP_1,49.8 //
udāsīnaḥ sādhakaśca gṛhastho dvividho bhavet /
kuṭumbabharaṇe yuktaḥ sādhako 'sau gṛhī bhavet // GarP_1,49.9 //
ṛṇāni trīṇyapākṛtya tyaktvā bhāryādhanādikam /
ekākī yastu vicaredudāsīnaḥ sa maukṣikaḥ // GarP_1,49.10 //
bhūmau mūlaphalāśitvaṃ svādhyāyastapa eva ca /
saṃvibhāgo yathānyāyaṃ dharmo 'yaṃ vanavāsinaḥ // GarP_1,49.11 //
tapastapyati yo 'raṇye yajeddevāñjuhoti ca /
svādhyāye caiva nirato vanasthastāpasottamaḥ // GarP_1,49.12 //
tapasā karśito 'tyarthaṃ yastu dhyānaparo bhavet /
sanyāsī sa hi vijñeyo vānaprasthāśrame sthitaḥ // GarP_1,49.13 //
yogābhyāsarato nityamārurukṣurjitendriyaḥ /
jñānāya vartate bhukṣuḥ procyate pārameṣṭhikaḥ // GarP_1,49.14 //
yastvātmaratireva syānnityatṛpto mahāmuniḥ /
samyak ca damasampannaḥ sa yogī bhikṣurucyate // GarP_1,49.15 //
bhaikṣyaṃ śrutaṃ ca maunitvaṃ tapo dhyānaṃ viśeṣataḥ /
samyak ca jñānavairāgyaṃ dharmo 'yaṃ bhikṣuke mataḥ // GarP_1,49.16 //
jñānasanyāsinaḥ kecidvedasanyāsino 'pare /
karmasanyāsinaḥ kecittrividhaḥ pārameṣṭhikaḥ // GarP_1,49.17 //
yogī ca trividho jñeyo bhautikaḥ kṣattra evaca /
tṛtīyo 'ntyāśramī prokto yogamūrtiṃsamāsthitaḥ // GarP_1,49.18 //
prathamā bhāvanā pūrve mokṣe tvakṣa(duṣka) rabhāvanā /
tṛtīye cāntimā proktā bhāvanā pārameśvarī // GarP_1,49.19 //
dharmātsaṃjāyate mokṣo hyarthātkāmo 'bhijāyate /
pravṛttiśca nivṛttiśca dvividhaṃ karma vaidikam // GarP_1,49.20 //
jñānaṃ pūrvaṃ nivṛttaṃ syātpravṛttaṃ cāgnidevakṛt /
kṣamā damo dayā dānamalobhā (bho) bhyāsa eva ca // GarP_1,49.21 //
ārjavaṃ cānsūyā ca tīrthānusaraṇaṃ tathā /
satyaṃ saṃtoṣa āstikyaṃ tathā cendriyanigrahaḥ // GarP_1,49.22 //
devatābhyarcanaṃ pūjā brāhmaṇānāṃ viśeṣataḥ /
ahiṃsā priyavāditvamapaiśunyamarūkṣatā // GarP_1,49.23 //
ete āśramikā dharmāścaturvarṇyaṃ bavīmyataḥ /
prājāpatyaṃ brāhmaṇānāṃ smṛtaṃ sthānaṃ kriyāvatām // GarP_1,49.24 //
sthānamaindraṃ kṣattriyāṇāṃ saṃgrāmeṣvapalāyinām /
vaiśyānāṃ mārutaṃ sthānaṃ svadharamamanuvartatām // GarP_1,49.25 //
gāndharvaṃ śūdrajātīnāṃ paricāre ca vartatām /
aṣṭāśītisahasrāṇāmṛṣīṇāmūrdhvaretasām // GarP_1,49.26 //
smṛtaṃ teṣāṃ tu yatsthānaṃ tadeva vana (guru) vāsinām /
saptarṣīṇāṃ tu yatsthānaṃ sthānaṃ tadvai vanaukasām // GarP_1,49.27 //
yatīnāṃ yatacittānāṃ nyāsināmūrdhvaretasām /
ānandaṃ brahma tatsthānaṃ yasmānnāvartate muniḥ // GarP_1,49.28 //
yogināmamṛtasthānaṃ vyomākhyaṃ paramākṣaram /
ānandamaiśvaraṃ yasmānmukto nāvartate naraḥ // GarP_1,49.29 //
muktiraṣṭāṅgavijñānātsaṃkṣepāttadvade śṛṇu /
yamāḥ pañca tvahiṃsādyā ahiṃsā prāṇyahiṃsanam // GarP_1,49.30 //
satyaṃ bhūtahitaṃ vākyamasteyaṃ svāgrahaṃ param /
amaithunaṃ brahmacaryaṃ sarvatyāgo 'parigrahaḥ // GarP_1,49.31 //
niyamāḥ pañca satyādyā bāhmamābhyantaraṃ dvidhā /
śaucaṃ tuṣṭiśca santoṣastapaścondriyanigrahaḥ // GarP_1,49.32 //
svādhyāyaḥ syānmantrajāpaḥ praṇidhānaṃ hareryajiḥ /
āsanaṃ padmakādyuktaṃ prāṇāyāmo marujjayaḥ // GarP_1,49.33 //
mantradhyāna to garbho viparīto hyagarbhakaḥ /
evaṃ dvidhā tridhāpyuktaṃ puraṇātpūrakaḥ sa ca // GarP_1,49.34 //
kumbhako niścalatvācca recanādrecakastridhā /
laghurdvādaśamātraḥ syāccaturviṃśatikaḥ paraḥ // GarP_1,49.35 //
ṣaṭtriṃśanmātrikaḥ śreṣṭhaḥ pratyāhāraśca rodhanam /
brahmātmacintā dhyānaṃ syāddhāraṇā manaso dhṛtiḥ // GarP_1,49.36 //
ahaṃ brahmetyavasthānaṃ samādhirbrahmaṇaḥ sthitiḥ /
ahamātmā paraṃ brahma satyaṃ jñānamanantakam // GarP_1,49.37 //
brahma vijñānamānandaḥ sa tattvamasi kevalam /
ahaṃ brahmāsmyahaṃ brahma aśarīramānindriyam // GarP_1,49.38 //
ahaṃmanobuddhimahadahaṅkārādivarjitam /
jāgratsvapnasuṣuptyādiyuktajyotistadīyakam // GarP_1,49.39 //
nityaṃ śuddhaṃ buddhamuktaṃ satyamānandamadvayam /
yo 'sāvādityapuruṣaḥ so 'sāvahamakhaṇḍitam /
iti dhyāyanvimucyet brāhmaṇo bhavabandhanāt // GarP_1,49.40 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe varṇāśramadharmanirūpaṇaṃ nāmaikonapañcāśattamodhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 50
brahmovāca /
ahanyahani yaḥ kuryātkriyāṃ sa jñānamāpnuyāt /
brāhme muhūrte cotthāya dharmamarthaṃ ca cintayet // GarP_1,50.1 //
cintayeddhṛdi padmasthamānandamajaraṃ harim /
uṣaḥ kāle tu saṃprāpte kṛtvā cāvaśyakaṃ budhaḥ // GarP_1,50.2 //
strāyānnadīṣu śuddhāsu śaucaṃ kṛtvā yathāvidhi /
prataḥ snānena pūyante ye 'pi pāpakṛto janāḥ // GarP_1,50.3 //
tasmātsarvaprayatnena prātaḥ snānaṃ samācaret /
prātaḥ snānaṃ praśaṃsanti dṛṣṭādṛṣṭaṣṭakaraṃ hi tat // GarP_1,50.4 //
sukhātsuptasya satataṃ lālādyāḥ saṃstravanti hi /
ato naivācaretkarmāṇyakṛtvā snānamāditaḥ // GarP_1,50.5 //
alakṣmīḥ kālakarṇo ca duḥ svapnaṃ durvicintitam /
prataḥ snānena pāpāni dhūyante nātra saṃśayaḥ // GarP_1,50.6 //
na ca snānaṃ vinā puṃsāṃ prāśastyaṃ karma saṃsmṛtam /
home japye viśeṣeṇa tasmātsnānaṃ samācaret // GarP_1,50.7 //
aśaktāvaśiraskaṃ tu snānamasya vidhīyate /
ārdreṇa vāsasā vāpi mārjanaṃ kāyikaṃ smṛtam // GarP_1,50.8 //
brāhmamāgneyamuddiṣṭaṃ vāyavyaṃ divyameva ca /
vāruṇaṃ yaugikaṃ tadvatṣaḍaṅgaṃ snānamācaret // GarP_1,50.9 //
brāhmaṃ tu mārjanaṃ mantraiḥ kuśaiḥ sodakabindubhiḥ /
āgreyaṃ bhasmanā'pādamastakāddehadhūnanam // GarP_1,50.10 //
gavāṃ hi rajasā proktaṃ vāyavyaṃ snānamuttamam /
yattu sātapavarṣeṇa snānaṃ taddivyamucyate // GarP_1,50.11 //
vāruṇaṃ cāvagāhaṃ ca mānarsa tvātmavedanam /
yaugikaṃ snānamākhyātaṃ yogena haricintanam // GarP_1,50.12 //
ātmatīrthamiti khyātaṃ sevitaṃ brahmavādibhiḥ /
kṣīravṛkṣasamudbhūtaṃ mālatīsambhavaṃ śubham // GarP_1,50.13 //
apāmārgaṃ ca vilvaṃ ca karavīraṃ ca dhāvane /
udaṅmukhaḥ prāṅmukho vā bhakṣayeddantadhāvanam // GarP_1,50.14 //
prakṣālya bhuktvā tajjahyācchucau deśe samāhitaḥ /
snātvā santarpayeddevānṛṣīnpitṛgaṇāṃstathā // GarP_1,50.15 //
ācamya vidhivannityaṃ punarācamya vāgyataḥ /
saṃmārjya mantrai rātmānaṃ kuśaiḥ sodakabindubhaiḥ // GarP_1,50.16 //
āpohiṣṭhāvyāhṛtibhiḥ sāvitryā vāruṇaiḥ śubhaiḥ /
oṅkāravyāhṛtiyutāṃ gāyattrīṃ vedamātaram // GarP_1,50.17 //
japtvā jalāñjaliṃ dadyādbhāraskaraṃ prati tanmanāḥ /
prākkūleṣu tataḥ sthitvā darbheṣu susamāhitaḥ // GarP_1,50.18 //
prāṇāyāmaṃ tataḥ kṛtvā dhyāyetsandhyāmiti śrutiḥ /
yā sandhyā sā jagatsūtirmāyātītā hi niṣkalā // GarP_1,50.19 //
aiśvarī kevalā śaktistattvatrayasamudbhavā /
dhyātvā raktāṃ sitāṃ kṛṣṇāṃ gāyattrīṃ vai japedvudhaḥ // GarP_1,50.20 //
prāṅmukhaḥ satataṃ vipraḥ sandhyopāsanamācaret /
sandhyāhīno 'śucirnityamanarhaḥ sarvakarmasu // GarP_1,50.21 //
yadanyatkurute kiñcinna tasya phalabhāgbhavet /
ananyacetasaḥ santo brāhmaṇā vedapāragāḥ // GarP_1,50.22 //
upāsya vidhivatsandhyāṃ prāptāḥ pūrvaparāṃ gatim /
yo 'nyatra kurute yatnaṃ dharma kārye dvijottamaḥ // GarP_1,50.23 //
vihāya sandhyāpraṇatiṃ sa yāti narakāyutam /
tasmātsarvaprayatnena sandhyopāsanamācaret // GarP_1,50.24 //
upāsito bhavettena devo yogatanuḥ paraḥ /
sahasraparamāṃ nityāṃ śatamadhyāṃ daśāvarām // GarP_1,50.25 //
gāyattrīṃ vai japedvidvānprāṅmukhaḥ prayataḥ śuciḥ /
athopatiṣṭhedādityamudayasthaṃ samāhitaḥ // GarP_1,50.26 //
mantraistu vividhaiḥ sauraiḥ ṛgyajuḥsāmasaṃjñitaiḥ /
upasthāya mahāyogaṃ devadevaṃ divākaram // GarP_1,50.27 //
kurvīta praṇatiṃ bhūmau mūrdhānamabhimantritaḥ /
oṃ khakholkāya śāntāya kāraṇatrayahetave // GarP_1,50.28 //
nivedayāmi cātmānaṃ namaste jñānarūpiṇe /
tvameva brahma paramamāpo jyotī raso 'mṛtam // GarP_1,50.29 //
bhūrbhuvaḥ svastvamoṅkāraḥ sarvo rudraḥ sanātanaḥ /
etadvai sūryahṛdayaṃ japtvā stavanamuttamam // GarP_1,50.30 //
prātaḥ kāle ca madhyāhne namaskuryāddivākaram /
athāgamya gṛhaṃ vipraḥ (paścāt) samācamya yathāvidhi // GarP_1,50.31 //
prajvālya vahniṃ vidhivajjuhuyājjātavedasam /
ṛtvik putro 'tha patnī vā śiṣyo vāpi sahodaraḥ // GarP_1,50.32 //
prāpyānujñāṃ viśeṣeṇa juhuyādvā yathāvidhi /
vinā ma (ta) ntreṇa yatkarma nāmutreha phalapradam // GarP_1,50.33 //
daivatāni namaskuryādupahārānnivedayet /
guruṃ caivāpyupāsīta hitaṃ cāsya samācaret // GarP_1,50.34 //
vedābhyāsaṃ tataḥ kuryātprayatnācchaktito dvijaḥ /
japedvādhyāpayecchiṣyāndhārayedvai vicārayet // GarP_1,50.35 //
avekṣeta ca śāstrāṇi dharmādīni dvijottamaḥ /
vaidikāṃścaiva nigamānvedāṅgāni ca sarvaśaḥ // GarP_1,50.36 //
upayādīśvaraṃ caiva yogakṣemaprāsiddhaye /
sādhayedvividhānarthānkuṭumbārthaṃ tato dvijaḥ // GarP_1,50.37 //
tato madhyāhnasamaye snānārthaṃ mṛdamāharet /
puṣpākṣatāṃstilakuśān gomayaṃ śuddhameva ca // GarP_1,50.38 //
nadīṣu devakhāteṣu taḍāgeṣu saraḥ su ca /
snānaṃ samācarennaiva parakīye kadācana // GarP_1,50.39 //
pañca piṇḍānanuddhṛtya snānaṃ duṣyanti nityaśaḥ /
mṛdaikayā śiraḥ kṣālyaṃ dvābhyāṃ nābhestathopari // GarP_1,50.40 //
adhaśca tisṛbhiḥ kṣālyaṃ pādau ṣaṭbhistathaiva ca /
mṛttikā ca samuddiṣṭā vṛddhāmalakamātnikā // GarP_1,50.41 //
gomayasya pramāṇaṃ tu tenāṅgaṃ lepayettataḥ /
prakṣālyācamya vidhivattataḥ snāyātsamāhitaḥ // GarP_1,50.42 //
lepayitvā tu tīrasthastalliṅgaireva mantrataḥ /
abhimantrya jalaṃ mantrairāliṅgairvāruṇaiḥ śubhaiḥ // GarP_1,50.43 //
tnānakāle smaredviṣṇamāpo nārāyaṇo yataḥ /
prekṣya oṅkāramādityaṃ trirnimajjejjalāśaye // GarP_1,50.44 //
ācāntaḥ punarācāmenmantreṇānena mantravit /
antaścarasi bhūteṣu guhāyāṃ viśvatomukhaḥ // GarP_1,50.45 //
tvaṃ yajñastvaṃ vaṣaṭkāra āpo jyotī raso 'mṛtam /
drupadāṃ vā trirabhyasyevdyāhṛtipraṇavānvitām // GarP_1,50.46 //
sāvitrīṃ vā jape dvidvāṃstathā caivāghamarṣaṇam /
tataḥ saṃmārjanaṃ kuryādāpohiṣṭhāmayobhuvaḥ // GarP_1,50.47 //
idamāpaḥ pravahatavyāhṛtibhistathaiva ca /
tato 'bhimantritaṃ topamāpo hiṣṭhādimantrakaiḥ // GarP_1,50.48 //
antarjalamavāṅmagno japettriraghamarṣaṇam /
drupadāṃ vātha sāvitrariṃ tadviṣṇoḥ paramaṃ padam // GarP_1,50.49 //
āvartayedvā praṇavaṃ devadevaṃ ramareddharim /
apaḥ pāṇau samādāya japtvā vai mārjane kṛte // GarP_1,50.50 //
vinyasya mūrdhni tattoyaṃ mucyate sarvapātakaiḥ /
sandhyāmupāsya cācamya saṃsmarennityamīśvaram // GarP_1,50.51 //
athopatiṣṭhedādityamūrdhvapuṣpānvitāñjalim /
prakṣipyālokayeddevamudayantaṃ na śakyate // GarP_1,50.52 //
udutyaṃ citramityevaṃ taccakṣuriti mantrataḥ /
haṃsaḥ śuciṣadetena sāvitryā ca viśeṣataḥ // GarP_1,50.53 //
anyaiḥ saurairvaidikaiśca gāyattrīṃ ca tato japet /
mantrāṃśca vividhānpaścātprākkūle ca kaśāsane // GarP_1,50.54 //
tiṣṭhaṃśca vīkṣyamāṇor'kaṃ japaṃ kuryātsamāhitaḥ /
sphaṭikābjākṣarudrākṣaiḥ putrajīvasamudbhavaiḥ // GarP_1,50.55 //
kartavyā tvakṣālā syādantarā tatra sā smṛtā /
yadi syātklinnavāsā vai vārimadhyagataścaret // GarP_1,50.56 //
anyathā ca śucau bhūmyāṃ darbheṣu ca samāhitaḥ /
pradakṣiṇaṃ samāvṛtya namaskṛtya tataḥ kṣitau // GarP_1,50.57 //
ācamya ca yathāśāstraṃ śaktyā svādhyāyamācaret /
tataḥ santarpayeddevānṛṣīnpitṛgaṇāṃstathā // GarP_1,50.58 //
ādāvoṅkāramuccārya namo 'nte tarpayāmi ca /
devānbrahmaṛṣīṃścaiva tarpayedakṣatodakaiḥ // GarP_1,50.59 //
pitṝndevānmunīn bhaktyā svasūtroktavidhānataḥ // GarP_1,50.60 //
devarṣoṃstarpayeddhīmānudakāñjalibhiḥ pitṝt /
yajñopavītī devānāṃ nivītī ṛṣitarpaṇe // GarP_1,50.61 //
prācīnāvītī pitrye tu tena tīrthena bhārata /
niṣpīḍya snānavastraṃ vai samācamya ca vāgyataḥ // GarP_1,50.62 //
svairmantrairarcayeddevānpuṣpaiḥ patraistathāmbubhiḥ /
brahmāṇaṃ śaṅkaraṃ sūryaṃ tathaiva madhusūdanam // GarP_1,50.63 //
anyāṃścābhimatāndevān bhaktyā cākrodhano hara ! /
pradadyādvātha puṣpādi sūktena puruṣeṇa tu // GarP_1,50.64 //
āpo vā devatāḥ sarvāstena samyak samarcitāḥ /
dhyātvā praṇavapūrvaṃ vai devaṃ vārisamāhitaḥ // GarP_1,50.65 //
namaskāreṇa puṣāpāṇi vinyasedvai pṛthakpṛthak /
narte hyārādhanātpuṇyaṃ vidyate karma vaidikam // GarP_1,50.66 //
tasmāttatrādimadhyānte cetasā dhārayeddharim /
tadviṣṇoriti mantreṇa sūktena puruṣeṇa tu // GarP_1,50.67 //
nivedayecca ātmānaṃ viṣṇave 'malatejase /
tadādhyātmamanāḥ śāntastadviṣṇoriti mantrataḥ // GarP_1,50.68 //
aprete saśirā vetiyajetvā puṣpake harim /
devayajñaṃ pitṛyajñaṃ tathaiva ca /
mānuṣaṃ brahmayajñaṃ ca pañca yajñānsamācaret // GarP_1,50.69 //
yadi syāttarpaṇādarvāgbrayajñaṃ kuto bhavet /
kṛtvā manuṣyayajñaṃ vai tataḥ svādhyāyamācaret // GarP_1,50.70 //
vaiśvadevastu kartavyo devayajñaḥ sa tu smṛtaḥ /
bhūtayajñaḥṛ sa vai jñeyo bhūtebhyo yastvayaṃ baliḥ // GarP_1,50.71 //
śvabhyaśca śvapacebhyaśca patitādibhya eva ca /
dadyādbhūmau bahistvannaṃ pakṣibhyaśca dvijottamaḥ // GarP_1,50.72 //
ekaṃ tu bhojayedvipraṃ pitṝnuddiśya sattamāḥ /
nityaśrāddhaṃ taduddiśya pitṛyajño gatipradaḥ // GarP_1,50.73 //
uddhṛtya vā yathāśakti kiñcidannaṃ samāhitaḥ /
vedatattvārthaviduṣe dvijāyaivopapādayet // GarP_1,50.74 //
pūjayedatithiṃ nityaṃ namasyedarcayoddvijam /
manovākkarmabhiḥ śāntaṃ svāgataiḥ svagṛhaṃ tataḥ // GarP_1,50.75 //
bhikṣāmāhurgrāsamātramannaṃ tatsyāccaturguṇam /
puṣkalaṃ hantakāraṃ tu taccaturguṇamucyate // GarP_1,50.76 //
godohamātrakālaṃ vai pratīkṣyo hyatithiḥ svayam /
abhyāgatānyathāśakti pūjayedatithiṃ tathā // GarP_1,50.77 //
bhikṣāṃ vai bhikṣave dadyādvidhivadbrahyacāriṇe /
dadyādannaṃ yathāśakti arthibhyo lobhavarjitaḥ // GarP_1,50.78 //
bhuñjati bandhubhiḥ sārdhaṃ vāgyato 'nnamakutsayan /
akṛtvā tu dvijaḥ pañca mahāyajñān dvijottamaḥ // GarP_1,50.79 //
bhuñjate cetsa mūḍhātmā tiryagyoniṃ ca gacchati /
vedābhyāso 'nvahaṃ śaktyā mahāyajñakriyākṣamāḥ // GarP_1,50.80 //
nāśayantyāśu pāpāni devānāmarcanaṃ tathā /
yo mohādatha vālasyādakṛtvā devatārcanam // GarP_1,50.81 //
bhuṅkte sa yāti narakāntsūṃkareṣveva jāyate /
aśaucaṃ saṃpravakṣyāmi aśuciḥ pātakī sadā // GarP_1,50.82 //
aśaucaṃ caiva saṃsargācchuddhiḥ saṃsargavarjanāt /
daśāhaṃ prāhurāśaucaṃ sarveviprā vipaścitaḥ // GarP_1,50.83 //
mṛteṣu vātha jāteṣu brāhmaṇānāṃ dvijottama /
ādantajananāt sadya ācūḍādekarātrakam // GarP_1,50.84 //
trirātramaupanayanāddaśarātramataḥ param /
kṣattriyo dvādaśahena daśabhiḥ pañcabhirviśaḥ // GarP_1,50.85 //
śudhyenmāsena vai śūdro yatīnāṃ nāsti pātakam /
rātribhirmāsatulyābhirgarbhastrāveṣu śaucakam // GarP_1,50.86 //

iti gāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe nityakarmāśaucayornirūpaṇaṃ nāma pañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 51
brahmovāca /
athātaḥ saṃpravakṣyāmi dānadharmamanuttamam /
arthānāmucite pātre śraddhayā pratipādanam // GarP_1,51.1 //
dānaṃ tu kathitaṃ tajjñairbhuktimuktiphalapradam /
nyāyenopārjayedvittaṃ dānabhogaphalaṃ ca tat // GarP_1,51.2 //
adhyāpanaṃ yājanaṃ ca vṛttamāhuḥ pratigraham /
kusīdaṃ kṛṣivāṇijyaṃ kṣattravṛtto 'tha varjayet // GarP_1,51.3 //
yaddīyate tu pātrebhyastaddānaṃ parikīrtitam /
nityaṃ naimittikaṃ kāmyaṃ vimalaṃ dānamīritam // GarP_1,51.4 //
ahanyahani yatkiñciddīyate 'nupakāriṇe /
anuddiśya phalaṃ tasmādbrāhmaṇāya tu nityaśaḥ // GarP_1,51.5 //
yattu pāpopaśāntyai ca dīyate vidupāṃ kare /
naimittikaṃ taduddiṣṭandānaṃ sadbhiranuṣṭhitam // GarP_1,51.6 //
apatyavijayaiśvaryasvargārthaṃ yatpradīyate /
dānaṃ tatkāmyamākhyātamṛṣibhirdharmācintakaiḥ // GarP_1,51.7 //
īśvaraprīṇanārthāya brahmāvitsupradīyate /
cetasā sattvayuktena dānaṃ tadvimalaṃ śivam // GarP_1,51.8 //
ikṣubhiḥ santatāṃ bhumiṃ yavagodhūmaśālinīm /
dadāti vedaviduṣe sa na bhūyo 'bhijāyate // GarP_1,51.9 //
bhūmidānātparaṃ dānaṃ na bhūtaṃ na bhaviṣyati /
vidyāṃ dattvā brāhmaṇāya brahmaloke mahīyate // GarP_1,51.10 //
dadyādaharahastāstu śraddhayā brahmacāriṇe /
sarvapāpavinirmukto brahmasthānamavāpnuyāt // GarP_1,51.11 //
vaiśākhyāṃ paurṇamāsyāṃ tu brāhmaṇānsapta pañca ca /
upoṣyābhyarcayedvidvānmadhunā tilasarpiṣā // GarP_1,51.12 //
gandhādibhiḥ samabhyarcya vācayedvā svayaṃ vadet /
prīyatāṃ dharmarājeti yathā manasi vartate // GarP_1,51.13 //
yāvajjīvaṃ kṛtaṃ pāpaṃ tatkṣaṇādeva naśyati /
kṛṣṇājine tilānkṛtvā hiraṇyamadhusarpiṣā // GarP_1,51.14 //
dadāti yastu viprāya sarvaṃ tarati duṣkṛtam /
ghṛtānnamudakaṃ caiva vaiśākhyāṃ ca viśeṣataḥ // GarP_1,51.15 //
nirdiśya dharmarājāya viprebhyo mucyate bhayāt /
dvādaśyāmarcayedviṣṇumupoṣyāghapraṇāśanam // GarP_1,51.16 //
sarvapāpavinirmukto naro bhavati niścitam /
yo hi yāṃ devatāmicchetsamārādhayituṃ naraḥ // GarP_1,51.17 //
brāhmaṇānpūjayeddatnādbhojayedyoṣitaḥ surān /
santānakāmaḥ satataṃ pūjayedvai purandaram // GarP_1,51.18 //
brahmavarcasakāmastu brāhmaṇānbrahmaniścayāt /
ārogyakāmo 'tha raviṃ dhanakāmo hutāśanam // GarP_1,51.19 //
karmaṇāṃ siddhikāmastu pūjayedvai vināyakam /
bhogakāmo hi śaśinaṃ balakāmaḥ samīraṇam // GarP_1,51.20 //
mumukṣuḥ sarvasaṃsārātprayatnenārcayeddharim /
akāmaḥ sarvakāmo vā pūjayettu gadādharam // GarP_1,51.21 //
vāridastṛptimāpnoti sukhamakṣayyamannadaḥ /
tilapradaḥ prajāmiṣṭāṃ dīpadaścakṣuruttamam // GarP_1,51.22 //
bhūmidaḥ sarvamāpnoti dīrghamāyurhiraṇyadaḥ /
gṛhado 'gryāṇi veśmāni rūpyado rūpamuttamam // GarP_1,51.23 //
vāsodaścāndrasālokyamaśvisālokyamaśvadaḥ /
anaḍuddaḥ śriyaṃ puṣṭāṃ godo bradhnasya viṣṭapam // GarP_1,51.24 //
yānaśayyāprado bhāryāmaiśvaryamabhayapradaḥ /
dhānyadaḥ śāvataṃ saukhyaṃ brahmado brahma śāśvatam // GarP_1,51.25 //
vedavitsu dadajjñānaṃ svargaloke mahīyate /
gavāṃ ghāsapradānena sarvapāpaiḥ pramucyate // GarP_1,51.26 //
indhanānāṃ pradānena dīptāgnirjāyate naraḥ /
auṣadhaṃ snehamāhāraṃ rogirogapraśāntaye // GarP_1,51.27 //
dadāno rogarahitaḥ sukhī dīrghāyureva ca /
asipatravanaṃ mārgaṃ kṣuradhārāsamanvitam // GarP_1,51.28 //
tīkṣṇā tapaṃ ca taraticchatropānatprado naraḥ /
yadyadiṣṭatamaṃ loke yaccāsya dayitaṃ gṛhe // GarP_1,51.29 //
tattadguṇavate deyaṃ tadevākṣayamicchatā /
ayena viṣuve caiva grahaṇe candrasūryayoḥ // GarP_1,51.30 //
saṃkrāntyādiṣu kāleṣu dattaṃ bhavati cākṣayam /
prayāgādiṣu tīrtheṣu gayāyāṃ ca viśeṣataḥ // GarP_1,51.31 //
dānadharmātparo dharmo bhūtānāṃ nahe vidyate /
svargāyurbhūtikāmena dānaṃ pāpopaśāntaye // GarP_1,51.32 //
dīyamānaṃ tu yo mohādgoviprāgnisureṣu ca /
nivārayati pāpātmā tiryagyoniṃ vrajennaraḥ // GarP_1,51.33 //
yastu durbhikṣavelāyāmannādyaṃ na prayacchati /
mriyamāṇeṣu vipreṣu brahmahā sa tu garhitaḥ // GarP_1,51.34 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe dānadharmanirūpaṇaṃ nāmaikapañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 52
brahmovāca /
ataḥ paraṃ pravakṣyāmi prāyaścittavidhiṃ dvijāḥ /
brahmahā ca surāpaśca steyī ca gurutalpagaḥ // GarP_1,52.1 //
pañca pātakinastvete tatsaṃyogī ca pañcamaḥ /
upapāpāni gohatyāprabhṛtīni surā jaguḥ // GarP_1,52.2 //
brahmahā dvādaśābdāni kuṭīṃ kṛtvā vane vaset /
kuryādanaśanaṃ vātha bhṛgoḥ patanameva ca // GarP_1,52.3 //
jvalantaṃ vā viśedagniṃ jalaṃ vā praviśetsvayam /
brāhmaṇārthe gavārthe vā samyak prāṇānparityajet // GarP_1,52.4 //
dattvā cānnaṃ ca viduṣe brahmahatyāṃ vyapohati /
aśvamedhāvabhṛthake snātvā vā mucyate dvijaḥ // GarP_1,52.5 //
sarvasvaṃ vā vedavide brāhmaṇāya pradāpayet /
sarasvatyāstaraṅgiṇyāḥ saṅgame lokaviśrute // GarP_1,52.6 //
śuddhe triṣavaṇasnātastrirātropoṣito dvijaḥ /
setubandhe naraḥ snātvā mucyate brahmahatyayā // GarP_1,52.7 //
kapālamocane snātvā vārāṇasyāṃ tathaiva ca /
surāpastu surāṃ pītvā agnivarṇāṃ dvijottamaḥ // GarP_1,52.8 //
payo ghṛtaṃ vā gomūtraṃ tasmātpāpātpramucyate /
suvarṇasteyī muktaḥ syānmusalena hato nṛpaiḥ // GarP_1,52.9 //
cīravāsā dvijo 'raṇye caredbrahmahaṇavratam /
gurubhāryāṃ samāruhya brāhmaṇaḥ kāmamohitaḥ // GarP_1,52.10 //
avagūhetstriyaṃ taptāṃ dīptāṃ kārṣṇāyasīṃ kṛtām /
gurvaṅganāgāminaśca careyurbahmahavratam // GarP_1,52.11 //
cāndrāyaṇāni vā kuryātpañca catvāri vā punaḥ /
patitena ca saṃsargaṃ kurute yastu vai dvijaḥ // GarP_1,52.12 //
sa tatpāpāpanodārthaṃ tasyaiva vratamācaret /
taptakṛcchraṃ caredvātha saṃvatsaramatandritaḥ // GarP_1,52.13 //
sarvasvadānaṃ vidhivatsarvapāpaviśodhanam /
cāndrāyaṇaṃ ca vidhinā kṛtaṃ caivātikṛcchrakam // GarP_1,52.14 //
puṇyakṣetre gayādau ca gamanaṃ pāpanāśanam /
amāvasyāṃ tithiṃ prāpya yaḥ samārādhayedbhavam // GarP_1,52.15 //
brāhmaṇān bhojayitvā tu sarvapāpaiḥ pramucyate /
upoṣitaścaturdaśyāṃ kṛṣṇapakṣe samāhitaḥ // GarP_1,52.16 //
yamāya dharmarājāya mṛtyave cāntakāya ca /
vaivasvatāya kālāya sarvabhūtakṣayāya ca // GarP_1,52.17 //
pratyekaṃ tilasaṃyuktāndadyātsapta jalāñjalīn /
snātvā nadyāṃ tu pūrvāhne mucyate sarvapātakaiḥ // GarP_1,52.18 //
brahmacaryamadhaḥ śayyāmupavāsaṃ dvijārcanam /
vrateṣveteṣu kurvīta śāntaḥ saṃyatamānasaḥ // GarP_1,52.19 //
paṣṭhyāmupoṣito devaṃ śuklapakṣe samāhitaḥ /
saptamyāmarcayedbhānuṃ mucyate sarvapātakaiḥ // GarP_1,52.20 //
ekādaśyāṃ nirāhāraḥ samabhyarcya janārdanam /
dvādaśyāṃ śuklapakṣasya mahāpāpaiḥ pramucyate // GarP_1,52.21 //
tapo japastīrthasevā devabrāhmaṇapūjanam /
grahaṇādiṣu kāleṣu mahāpātakanāśanam // GarP_1,52.22 //
yaḥ sarvapāpayukto 'pi puṇyatīrtheṣu mānavaḥ /
niyamena tyajetprāṇānmucyate sarvapātakaiḥ // GarP_1,52.23 //
brahmaghnaṃ vā kṛtaghnaṃ vā mahāpātakadūṣitam /
bhartāramuddharennārī praviṣṭā saha pāvakam // GarP_1,52.24 //
pativratā tu yā nārī bhartuḥ śuśrūṣaṇotsukā /
na tasyā vidyate pāpamiha loke paratra ca // GarP_1,52.25 //
tathā rāmasya subhagā sītā trailokyaviśrutā /
patnī dāśaratherdevī vijigye rākṣaseśvaram // GarP_1,52.26 //
phalgutīrthādiṣu snātaḥ sarvācāraphalaṃ labhet /
ityāha bhagavānviṣṇuḥ purā mama yatavratāḥ // GarP_1,52.27 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe prāyaścittanirūpaṇaṃ nāma dvipañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 53
sūta uvāca /
evaṃ brahmābravīcchrutvā hareraṣṭanidhīṃstathā /
tatra padmamahāpadmau tathā makarakacchapau // GarP_1,53.1 //
mukundaku(na) ndau nīlaśca śaṅkhaścaivāparo nidhiḥ /
satyāmṛddhau bhavantyete svarūpaṃ kathayāmyaham // GarP_1,53.2 //
padmena lakṣitaścaiva sāttviko jāyate naraḥ /
dākṣiṇyasāraḥ puruṣaḥ suvarṇādikasaṃgraham // GarP_1,53.3 //
rupyādi kuryāddadyāttu yatidaivādiyajvanām /
mahāpadmāṅkito dadyāddhanādyaṃ dhārmikāya ca // GarP_1,53.4 //
nīdhī padmamahāpadmau sāttvikau puruṣau smṛtī /
makareṇāṅkitaḥ khaḍgabāṇakuntādisaṃgrahī // GarP_1,53.5 //
dadyācchrutāya maitrīṃ ca yāti nityaṃ ca rājabhiḥ /
dravyārthaṃ śatruṇā nāśaṃ saṃgrāme cāpi saṃvrajet // GarP_1,53.6 //
makaraḥ kacchapaścaiva tāmasau tu nidhī smṛtau /
kacchapī viśvasennaiva na bhuṅkena (nā) dadāti ca // GarP_1,53.7 //
nidhānamurvyāṃ kurute nidhiḥ sopyekapūruṣaḥ /
rājasenamukundena lakṣitā rājyasaṃgrahī // GarP_1,53.8 //
bhuktabhogo gāyanebhyo dadyādveśyādikāsu ca /
rajastamomayo nandī ādhāraḥ syātkulasya ca // GarP_1,53.9 //
stutaḥ prīto bhavati vai bahubhāryā bhavanti ca /
pūrvamitreṣu śaithilyaṃ prītimanyaiḥ karoti ca // GarP_1,53.10 //
nīlana cāṅkitaḥ sattvatejasā saṃyuto bhavet /
vastradhānyādisaṃgrāhī taḍāgādi karoti ca // GarP_1,53.11 //
tripū(pau) ruṣo nidhiścaiva āmrārāmādi kārayet /
ekasya syānnidhiḥ śaṅkhaḥ svayaṃ bhuṅkte dhanādi(nta)kam // GarP_1,53.12 //
kadannabhukparijano na ca śobhanavastradhṛk /
svapoṣaṇaparaḥ śaṅkhī dadyātparanare vṛthā // GarP_1,53.13 //
miśrāvalokanānmiśrasvabhāvaphaladāyinaḥ /
nidhīnāṃ rūpamuktaṃ tu hariṇāpi harādike /
harirbhuvanakośādi yathovāca tathā vade // GarP_1,53.14 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe navanidhivarṇanaṃ nāma tripañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 54
hariruvāca /
agnīdhraścāgnibāhuśca bapuṣmāndhyutimāṃstathā /
medhāmedhātithirbhavyaḥ śabalaḥ putra eva ca // GarP_1,54.1 //
jyotiṣmāndaśamo jātaḥ putrā hyete priyavratāt /
medhāgnibāhuputrāstu trayo yogaparāyaṇāḥ // GarP_1,54.2 //
jātismarā mahābhāgā nairājyāya mamo daṣuḥ /
vibhajya sapta dvīpāni saptānāṃ pradadau nṛpaḥ // GarP_1,54.3 //
yojanānāṃ pramāṇena pañcāśatkoṭirāplutā /
jalopari mahī yātā maurivāste sarijjale // GarP_1,54.4 //
jambūplakṣāhvayau dvīpau śālmalaścāparo hara /
kuśaḥ krauñcastathā śākaḥ puṣkaraścaiva saptamaḥ // GarP_1,54.5 //
ete dvīpāḥ samudraistu sapta saptabhirāvṛtāḥ /
lavaṇekṣusurāsarpirdādhidugdhajalaiḥ samam // GarP_1,54.6 //
dvīpāttu dviguṇo dvīpaḥ samudraśca vṛṣadhvaja /
jambūdvīpe sthito merurlakṣayojanavistṛtaḥ // GarP_1,54.7 //
caturaśītisāhasrairyojanairasya cocchrayaḥ /
praviṣṭaḥ ṣoḍaśādhastāddvatriṃśanmūrdhni vistṛtaḥ // GarP_1,54.8 //
adhaḥ ṣoḍaśasāhasraḥ karṇikākārasaṃsyitaḥ /
himavānhemakūṭaśca niṣadhaścāsya dakṣiṇe // GarP_1,54.9 //
nīlaḥ śvetaśca śṛṅgī ca uttare varṣaparvatāḥ /
plakṣādiṣu narā rudra ye vasanti sanātanāḥ // GarP_1,54.10 //
śaṅkarātha na teṣvasti yugāvasthā kathañcana /
jambūdvīpeśvarātputrā hyagrīdhnādabhavannava // GarP_1,54.11 //
nābhiḥ kiṃpuruṣaścaiva harivarṣamilā vṛtaḥ /
ramyo hiraṇmayākhyaśca kururbhadrāśva eva ca // GarP_1,54.12 //
ketumālo nṛpastebhyastatsaṃjñān khaṇḍakāndadau /
nābhestu merudevyāṃ tu putro 'bhūdṛṣabho hara // GarP_1,54.13 //
tatputro bharato nāma śālagrāme sthito vratī /
sumatirbharatasyābhūttatputrastaijaso 'bhavat // GarP_1,54.14 //
indradyumnaśca tatputraḥ parameṣṭhī tataḥ smṛtaḥ /
pratīhāraścatatputraḥ pratihartā tadātmajaḥ // GarP_1,54.15 //
sutastasmādathai jātaḥ prastārastatsuto vibhuḥ /
pṛthuśca tatsuto nakto naktasyāpi gayaḥ smṛtaḥ // GarP_1,54.16 //
naro gayasya tanayastatputrobhudvirāḍagataḥ /
tato dhīmānmahātejā bhauvanastasya cātmajaḥ // GarP_1,54.17 //
tvaṣṭā tvaṣṭuśca virajā rajastasyāpyabhūtsutaḥ /
śatajidrajasastasya viṣvagjyotiḥ sutaḥ smṛtaḥ // GarP_1,54.18 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhuvanakośavarṇanopayogipriyavratavaṃśanirūpaṇaṃ nāma catuḥ pañcaśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 55
hariruvāca /
madhye tvilāvṛto varṣo bhadrāśvaḥ pūrvato 'dbhutaḥ /
pūrvadakṣaiṇato varṣo hiraṇvānvṛṣabhadhvaja // GarP_1,55.1 //
tataḥ kimpuruṣo varṣo merordakṣiṇataḥ smṛtaḥ /
bhārato dakṣiṇe prokto harirdakṣiṇapāścime // GarP_1,55.2 //
paścime ketumālaśca ramyakaḥ paścimottare /
uttare ca kurorvarṣaḥ kalpavṛkṣasamāvṛtaḥ // GarP_1,55.3 //
siddhiḥ svābhāvikī rudra ! varjayitvā tu bhāratam /
indradvīpaḥ kaśerumāṃstāmravarṇo gabhastitamān // GarP_1,55.4 //
nāgadvīpaḥ kaṭāhaśca siṃhalo vāruṇastathā /
ayaṃ tunavamasteṣāṃ dvīpaḥ sāgarasaṃvṛtaḥ // GarP_1,55.5 //
pūrve kirātāstasyāste paścime yavanāḥ sthitāḥ /
andhrā dakṣiṇato rudra ! turaṣkāstvapi cottare // GarP_1,55.6 //
brāhmaṇāḥ kṣattriyā vaiśyāḥ sūdrāścāntaravāsinaḥ /
mahendro malayaḥ sahyaḥ śuktimānṛkṣaparvataḥ // GarP_1,55.7 //
vindhyaśca pāriyātraśca saptātra kulaparvatāḥ /
vedasmṛtir narmadā ca varadā surasā śivā // GarP_1,55.8 //
tāpī payoṣṇī sarayūḥ kāverī gomatī tathā /
godāvarī bhīmarathī kṛṣṇaveṇī mahānadī // GarP_1,55.9 //
ketumālā tāmraparṇo candrabhāgā sarasvatī /
ṛṣikulyā ca kāverī mattagaṅgā payasvinī // GarP_1,55.10 //
vidarbhā ca śatadrūśca nadyaḥ pāpaharāḥ śubhāḥ /
āsāṃ pibanti salilaṃ madhyadeśādayo janāḥ // GarP_1,55.11 //
pāñcālāḥ kuravo matsyā yaudheyāḥ sapaṭaccarāḥ /
kuntayaḥ śūrasenāśca madhyadeśajanāḥ smṛtāḥ // GarP_1,55.12 //
vṛṣadhvaja ! janāḥ pādmāḥ sūtamāgadhacedayaḥ /
kāśaya (ṣāyā) śca videhāśca pūrvasyāṃ kosalāstathā // GarP_1,55.13 //
kaliṅgavaṅgapuṇḍrāṅgā vaidarbhā mūlakāstathā /
vindhyāntarnilayā deśāḥ pūrvadakṣiṇataḥ smṛtāḥ // GarP_1,55.14 //
pulandāśmakajīmūtanayarāṣṭranivāsinaḥ /
karṇār(nā)ṭakambojaghaṇā dakṣiṇāpathavāsinaḥ // GarP_1,55.15 //
ambaṣṭhadraviḍā lāṭāḥ kāmbhojā strīmukhāḥ śakāḥ /
ānartavāsinaścaiva jñeyā yakṣiṇapaścime // GarP_1,55.16 //
strīrājyāḥ saindhavā mlecchā nāsti kā yavanāstathā /
paścimena ca vijñeyā māthurā naiṣadhaiḥ saha // GarP_1,55.17 //
māṇḍavyāśca tuṣārāśca mūlikāśvamukhāḥ khaśāḥ /
mahākeśā mahānāsā deśāstūttarapaścime // GarP_1,55.18 //
lamba (mpā) kā stananāgāśca mādragāndhārabāhlikāḥ /
himācalālayā mlecchā udīcīṃ diśamāśritāḥ // GarP_1,55.19 //
trigartanīlakolāta (bha) brahmaputrāḥ saṭaṅkaṇāḥ /
abhīṣāhāḥ sakāśmīrā udakparveṇa kīrtitāḥ // GarP_1,55.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhuvanakośavarṇanaṃ nāma pañcapañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 56
hariruvāca /
sapta medhātitheḥ putrāḥ plakṣadvīpeśvarasya ca /
jyeṣṭhaḥ śāntabhavo nāma śiśirastadantaraḥ // GarP_1,56.1 //
sukhodayastathā nandaḥ śivaḥ kṣemaka eva ca /
dhruvaśca saptamasteṣāṃ plakṣadvīpeśvarā hi te // GarP_1,56.2 //
gomedaścaiva candraśca nārado dundubhistathā /
somakaḥ sumanāḥ śailo baibhrājaścātra saptamaḥ // GarP_1,56.3 //
anutaptā śikhī caiva vipāśā tridivā kramuḥ /
amṛtā sukṛtā caiva saptaitāstatra nimnagāḥ // GarP_1,56.4 //
vapuṣmāñchālmalasyeśastatsutā varṣanāmakāḥ /
śveto 'tha haritaścaiva jīmūto rohitastathā // GarP_1,56.5 //
vaidyuto mānasaścaiva saprabhaśācapi saptamaḥ /
kumudaśconnato droṇo mahiṣo 'tha balāhakaḥ // GarP_1,56.6 //
krauñcaḥ kakudmānhyete vai girayaḥ saritastvimāḥ /
yonitoyā vitṛṣṇā ca candrā śukla vimocanī // GarP_1,56.7 //
vidhṛtiḥ saptamī tāsāṃ smṛtāḥ pāpapraśāntidāḥ /
jyotiṣmataḥ kuśadvīpe sapta putrāḥ śṛṇuṣvatān // GarP_1,56.8 //
udbhido veṇumāṃścaiva dvairatho lambano dhṛtiḥ /
prabhākaro 'tha kapilastannāmā varṣapaddhatiḥ // GarP_1,56.9 //
vidrumo hemaśailaśca dyutimānpuṣpavāṃstathā /
kuśeśayo hariścaiva saptamo mandarācalaḥ // GarP_1,56.10 //
dhūtapāpā śivā caiva pavitrā sanmatistathā /
vidyudabhrā mahī cānyā sarvapāpaharāstvimāḥ // GarP_1,56.11 //
krauñcadvīpe dyutimataḥ putrāḥ sapta mahātmanaḥ /
kuśalo mandagaścoṣṇaḥ pīvaro 'thondhakārakaḥ // GarP_1,56.12 //
muniśca dundubhiścaiva saptaite tatsutā hara /
krauñcaśca vāmanaścaiva tṛtīyaścāndha (tha) kārakaḥ // GarP_1,56.13 //
divāvṛtpañcamaścānyo dundubhiḥ puṇḍarīkavān /
gaurī kumudvatī caiva sandhyā rātrirmanojavā // GarP_1,56.14 //
khyātiśca puṇḍarīkā ca saptaitā varṣanimnagāḥ /
śākadvīpeśvarādbhavyātsapta putrāḥ prajajñire // GarP_1,56.15 //
jaladśca kumāraśca sukumāroruṇī bakaḥ /
kusumodaḥ samodārkiḥ saptamaśca mahādrumaḥ // GarP_1,56.16 //
sukumārī kumārī ca nalinī dhenukā ca yā /
ikṣuśca veṇukā caiva gabhastī saptamī tathā // GarP_1,56.17 //
śabalātpuṣkareśācca mahāvīraśca dhātakiḥ /
abhūdvarṣadvayaṃ caiva mānasottaraparvataḥ // GarP_1,56.18 //
yojanānāṃ sahasrāṇi ūrdhvaṃ pañcāśaducchritaḥ /
tāvaccaiva ca vistīrṇaḥ sarvataḥ parimaṇḍalaḥ // GarP_1,56.19 //
svādūdakenodadhinā puṣkaraḥ pariveṣṭitaḥ /
svādūdakasya purato dṛśyate lokasaṃsthitiḥ // GarP_1,56.20 //
dviguṇā kāñcanī bhūmiḥ sarvajantuvivarjitā /
lokālokastataḥ śailo yojanāyutāvistṛtaḥ /
tamasā parvato vyāptastamo 'pyaṇḍakaṭāhataḥ // GarP_1,56.21 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhuvanakośavarṇanaṃ nāma ṣaṭpañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 57
hariruvāca /
saptatistu sahasrāṇi bhūmyucchrāyo 'pi kathyate /
daśasāhasramekaikaṃ pātālaṃ vṛṣabhadhvaja // GarP_1,57.1 //
atalaṃ vitalaṃ caiva nitalaṃ ca gabhastimat /
mahākhyaṃ sutalaṃ cāgryaṃ pātālaṃ cāpi saptamam // GarP_1,57.2 //
kṛṣṇā śuklāruṇā pītā śarkarā śailakāñcanā /
bhūyastatra daiteyā vasanti ca bhujaṅgamāḥ // GarP_1,57.3 //
raudre tu puṣkaradvīpe narakāḥ santi tāñchṛṇu /
rauravaḥ sūkaro rodhastālo vinaśanastathā // GarP_1,57.4 //
mahājvālastaptakumbho lavaṇo 'thi vimohitaḥ /
rudhirākhyo vaitaraṇī kṛmiśaḥ kṛmibho janaḥ // GarP_1,57.5 //
asipatravanaḥ kṛṣṇo nānābhakṣaśca dāruṇaḥ /
tathā pūyavahaḥ pāpo vahnijvālastvadhaḥ śirāḥ // GarP_1,57.6 //
saṃdaṃśaḥ kṛṣṇasūtraśca tamaścāvīcireva ca /
śvabhojano 'thāpratiṣṭhoṣṇavīcirnarakāḥ smṛtāḥ // GarP_1,57.7 //
pāpinasteṣu pacyante viṣaśastrāgnidāyinaḥ /
uparyupari vai lokā rudra ! bhūtādayaḥ sthitāḥ // GarP_1,57.8 //
vārivahnyanilākāśairvṛtaṃ bhūtādinā ca tat /
tadaṇḍaṃ mahatā rudra ! pradhānena ca veṣṭitam // GarP_1,57.9 //
aṇḍaṃ daśaguṇaṃ vyāptaṃ nārāyaṇaḥ sthitaḥ // GarP_1,57.10 //

iti gāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhuvanakośagatāpātalanarakādinirūpaṇaṃ nāma saptapañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 58
hariruvāca /
vakṣye pramāṇasaṃsthāne sūryādīnāṃ śṛṇuṣva me /
yojānānāṃ sahasrāṇi bhāskarasya ratho nava // GarP_1,58.1 //
īṣādaṇḍastathaivāsya dviguṇo vṛṣabhadhvaja /
sārdhakoṭistathā sapta niyutānyadhikāni ca // GarP_1,58.2 //
yojanānāṃ tu tasyākṣastatra cakraṃ pratiṣṭhitam /
trinābhimati pañcāre ṣaṇneminyakṣayātmake // GarP_1,58.3 //
saṃvatsaramaye kṛtsnaṃ kālacakraṃ pratiṣṭhitam /
catvāriṃśatsahasrāṇi dvitīyo 'kṣo vivasvataḥ // GarP_1,58.4 //
pañcānyāni tu sārdhāni syandanasya vṛṣadhvaja /
akṣapramāṇamubhayoḥ pramāṇaṃ tu yugārdhayoḥ // GarP_1,58.5 //
hrasvo 'kṣastadyugārdhena dhruvādhāre rathasya vai /
dvitīye 'kṣe tu taccakraṃ saṃsthitaṃ mānasācale // GarP_1,58.6 //
gāyattrī sabṛhatyuṣṇigjagatītriṣṭubeva ca /
anuṣṭuppaṅktirityuktāśchandāṃsi harayo raveḥ // GarP_1,58.7 //
dhātā kratusthalā caiva pulastyo vāsukistathā /
rathakṛdgrāmaṇīrhetistumburuścaitramāsake // GarP_1,58.8 //
aryamā pulahaścaiva rathojāḥ puñjikasthalā /
prahetiḥ kacchanīraśca nāradaścaiva mādhave // GarP_1,58.9 //
mitro 'tristakṣako rakṣaḥ pauruṣeyo 'tha menakā /
hāhā rathasvanaścaiva jyeṣṭhe bhāno rathe sthitāḥ // GarP_1,58.10 //
varuṇo vasiṣṭho rambhā sahajanyā kuhūrbudhaḥ /
rathacitrastathā śukro vasantyāṣāḍhasaṃjñite / // GarP_1,58.11 //
indro viśvāvasuḥ srota(śrotra) elāpatrastathāṅgirāḥ /
pramlocā ca nabhasyete sarpāścārke tu santi vai // GarP_1,58.12 //
vivasvānugrasenaśca bhṛgurāpūraṇastathā /
anumlocāśaṅkhapālau vyāghro bhādrapade tatā // GarP_1,58.13 //
pūṣā ca surucirdhātā gautamo 'tha dhanañjayaḥ /
suṣeṇo 'nyo dhṛtācī ca vasantyāśvayuje ravau // GarP_1,58.14 //
viśvāvasurbharadvājaḥ parjanyairāvatau tadā /
viśvācī senajiccāpaḥ (pi) kārtike cādhikāriṇaḥ // GarP_1,58.15 //
aṃśuśca kāśyapastārkṣyo mahāpadmastathorvaśī /
citrasenastathā vidyunmārgaśīrṣādhikāriṇaḥ // GarP_1,58.16 //
kraturbhargastathorṇāyuḥ sphūrjaḥ karkoṭakastathā /
ariṣṭanemiścaivānyā pūrvacittivarrātsarāḥ /
pauṣamāse vasantyete sapta bhāskaramaṇḍale // GarP_1,58.17 //
tvaṣṭātha jamadagniśca kambalo 'tha tilottamā /
brahmāpeto 'tha ṛtajiddhṛtarāṣṭraśca saptamaḥ /
māghamāse vasantyete sapta bhāskaramaṇḍale // GarP_1,58.18 //
viṣṇuraśvataro rambhā sūryavarcāśca satyajit /
viśvāmitrastathā rakṣo yajñāpeto hi phālgune // GarP_1,58.19 //
saviturmaṇḍale brahmanviṣṇuśaktyupabṛṃhitāḥ /
stuvanti munayaḥ sūryaṃ gandharvairgoyate puraḥ // GarP_1,58.20 //
nṛtyantyo 'psaraso yānti sūryasyānuniśācarāḥ /
vahanti pannagā yakṣaiḥ kriyate 'bhīṣusaṃgrahaḥ // GarP_1,58.21 //
bālakhilyāstathaivainaṃ parivārya samāsate /
rathastricakraḥ somasya kundābhāstasya vājinaḥ // GarP_1,58.22 //
vāmadakṣiṇato yuktā daśa tena caratyasau /
vārya (yva) granidravyasambhūto rathaścandrasutasyaca // GarP_1,58.23 //
piśaṅgesturagairyuktaḥ so 'ṣṭābhirvāyuvegibhiḥ /
savarūthaḥ sānukarṣo yukto bhūmibhavairhayaiḥ // GarP_1,58.24 //
sopāsaṃgapatākastu śukrasyāpi ratho mahān /
ratho bhūmisutasyāpi taptakāñcanasannibhaḥ // GarP_1,58.25 //
aṣṭāśvaḥ kāñcanaḥ śrīmān bhaumasyāpi ratho mahān // GarP_1,58.26 //
padmarāgāruṇairaśvaiḥ saṃyukto vahnisaṃbhavaiḥ /
aṣṭābhiḥ pāṇḍarairyuktairvājibhiḥ kāñcane rathe // GarP_1,58.27 //
tiṣṭhaṃstiṣṭhati varṣaṃ vai rāśaurāśau bṛhaspatiḥ /
ākāśasambhavairaśvaiḥ śavalaiḥ syandanaṃ yutam // GarP_1,58.28 //
samāruhya śanairyāti mandagāmī śanaiścaraḥ /
svarbhānosturagā hyaṣṭau bhṛṅgābhā dhūsaraṃ ratham // GarP_1,58.29 //
sakṛdyaktāstu bhūteśabahantyavirataṃ śiva /
tathā keturathasyāśvā aṣṭau te vātaraṃhasaḥ // GarP_1,58.30 //
palāladhūmavarṇābhā lākṣārasanibhāruṇāḥ /
dvīpanadyadrayudanvanto bhuvanāniharestanuḥ // GarP_1,58.31 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhuvanakośanirūpaṇaṃ nāmāṣṭapañcāśattamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 59
(atha jyotiḥ śāstram)

sūta uvāca /
jyotiścakraṃ bhuvo mānamuktvā provāca keśavaḥ /
caturlakṣaṃ jyotiṣasya sāraṃ rudrāya sarvadaḥ // GarP_1,59.1 //
hariruvāca /
kṛttikāstvagnidevatyā rohiṇyo brahmaṇaḥ smṛtāḥ /
ilvalāḥ somadevatyā raudraṃ cārdramudāhṛtam // GarP_1,59.2 //
punarvasustathādityastiṣyaśca gurudaivataḥ /
aśleṣāḥ sarpadevatyā maghāśca pitṛdevatāḥ // GarP_1,59.3 //
bhāgyāśca pūrvaphalgunya aryamā ca tathottaraḥ /
sāvitraśca tathā hastā citrā tvaṣṭā prakīrtitaḥ // GarP_1,59.4 //
svātī ca vāyudevatyā nakṣatraṃ parikīrtitam /
indrāgnidevatā proktā viśākhā vṛṣabhadhvaja // GarP_1,59.5 //
maitramṛkṣamanūrādhā jyeṣṭhā śākraṃ prakīrtitam /
tathā nirṛtidevatyo mūlastajjñairudāhṛtaḥ // GarP_1,59.6 //
āpyāstvāṣāṭhapūrvāstu uttarā vaiśvadevatāḥ /
brāhmaścaivābhijitproktaḥ śravaṇā vaiṣṇavaḥ smṛtaḥ // GarP_1,59.7 //
vāsavastu tathā ṛkṣaṃ dhaniṣṭhā procyate budhaiḥ /
tathā śatabhiṣā proktaṃ nakṣatraṃ vāruṇaṃ śiva // GarP_1,59.8 //
ājaṃ bhādrapadā pūrvā ahirbrudhnyastathottarā /
pauṣṇaṃ ca revatī ṛkṣamaśvayukcāśvadaivatam // GarP_1,59.9 //
bharaṇyṛkṣaṃ tathā yāmyaṃ proktāste ṛkṣadevatāḥ /
brahmāṇī saṃsthitā pūrve pritapannavamītithau // GarP_1,59.10 //
māheśvarī cottare ca dvitīyā daśāmītithau /
pañcamyāṃ ca trayodaśyāṃ vārāhī dakṣiṇe sthitā // GarP_1,59.11 //
ṣaṣṭhyāṃ caiva caturdaśyāmindrāṇī paścime sthitā /
saptamyāṃ paurṇamāsyāṃ ca cāmuṇḍā vāyugocare // GarP_1,59.12 //
aṣṭamyamāvāsyayoge mahālakṣmīśagocare /
ekādaśyāṃ tṛtīyāyāmagnikoṇe tu vaiṣṇavī // GarP_1,59.13 //
dvādaśyāṃ ca caturthyāṃ tu kaumārī nairṛte tathā /
yoginīsuṃmukhenaiva gamanādi na kārayet // GarP_1,59.14 //
aśvinīmaitrarevatyo mṛgamūlapunarvasu /
puṣyā hastā tathā jyeṣṭhā prasthāne śreṣṭhamucyate // GarP_1,59.15 //
hastādipañcaṛkṣāṇi uttarātrayameva ca /
aśvinī rohiṇī puṣyā dhaniṣṭhā ca punarvasū // GarP_1,59.16 //
vastraprāvaraṇe śreṣṭho nakṣatrāṇāṃ gaṇaḥ smṛtaḥ /
kṛttikā bharaṇyaśleṣā maghā mūlaviśākhayoḥ // GarP_1,59.17 //
trīṇi,pūrvā tathā caiva adhovakrāḥ prakīrtitāḥ? /
eṣu vāpītaḍāgādikūpabhūmitṛṇāni ca // GarP_1,59.18 //
devāgārasya khananaṃ nidhānakhananaṃ tathā /
gaṇitaṃ jyotiṣārambhaṃ khanibilapraveśanam // GarP_1,59.19 //
kuryādadhogatānyeva anyāni ca vṛṣadhvaja /
revatī cāśvinī citrā svātī hastā punarvasū // GarP_1,59.20 //
anurādhā mṛgo jyeṣṭhā ete pārśvamukhāḥ smṛtāḥ /
gajoṣṭrāśvabalīvardadamanaṃ mahiṣasya ca // GarP_1,59.21 //
bījānāṃ vapanaṃ kuryādgamanāgamanādikam /
cakrayantrarathānāṃ ca nāvādīnāṃ pravāhaṇam // GarP_1,59.22 //
pārśveṣu yāni karmāṇi kuryādeteṣu tānyapi /
rohiṇyārdrāṃ tathā puṣyā dhaniṣṭhā cottarātrayam // GarP_1,59.23 //
vāruṇaṃ śravaṇaṃ caiva nava cordhvamukhāḥ smṛtāḥ /
eṣu rājyābhiṣekaṃ ca paṭṭabandhaṃ ca kārayet // GarP_1,59.24 //
ūrdhvamukhyānyucchritāni sarvāṇyeteṣu kārayet /
caturtho cāśubhā ṣaṣṭhī aṣṭamī navamī tathā // GarP_1,59.25 //
amāvāsyā pūrṇimā ca tadvādaśī ca caturdaśī /
aśuklā pratipacchreṣṭhā dvitīyā candra sūnunā // GarP_1,59.26 //
tṛtīyā bhūmiputreṇa caturtho ca śanaiścare /
gurau śubhā pañcamī syātṣaṣṭīmaṅgalaśukrayoḥ // GarP_1,59.27 //
saptamī somaputreṇa aṣṭamī kujabhāskarau /
navamī candravā(sau) reṇa daśamī tu gurau śubhā // GarP_1,59.28 //
ekādaśyā guruśukrau dvādaśyāṃ ca punarbudhaḥ /
trayodaśī śukrabhaumau śanau śreṣṭhā caturdaśī // GarP_1,59.29 //
paurṇamāsyapyamāvāsyā śreṣṭhā syācca bṛhaspatau /
dvādaśīṃ dahate bhānuḥ śaśī caikādaśīṃ dahet // GarP_1,59.30 //
kujo dahecca daśāmīṃ navamīṃ ca budho dahet /
aṣṭamīṃ dahate jīvaḥ saptamīṃ bhārgavo dahet // GarP_1,59.31 //
sūryaputro dahetṣaṣṭhīṃ gamanādyāsu nāsti vai /
pratipannavamīṣveva caturdaśyaṣṭamīṣu ca // GarP_1,59.32 //
budhavāreṇa prasthānaṃ dūrataḥ parivarjayet /
meṣe karkaṭake ṣaṣṭhī kanyāyāṃ mithune 'ṣṭamī // GarP_1,59.33 //
vṛṣe kumbhe caturtho ca dvādaśī makare tule /
daśamī vṛścike siṃhe dhanurmone caturdaśī // GarP_1,59.34 //
etā dagdhā na gantavyaṃ pīḍādiḥ kila mānavaiḥ /
viśākhātrayamāditye pūrvāṣāḍhātraye śaśī // GarP_1,59.35 //
dhaniṣṭhātritayaṃ bhaume budhe vai revatītrayam /
rohiṇyāditrayaṃ jīve śukre puṣyātrayaṃ śiva // GarP_1,59.36 //
śanivāre varjayecca uttarāphalgunītrayam /
eṣu yogeṣu cotpātamṛtyurogādikaṃ bhavet // GarP_1,59.37 //
mūler'kaḥ śravaṇe candraḥ proṣṭhapadyuttare kujaḥ /
kṛttikāsu budhaścaiva gurau rudra punarvasuḥ // GarP_1,59.38 //
pūrvaphalgunī śukre ca svātiścaiva śanaiśvare /
etai cāmṛtayogāḥ syuḥ sarvakāryaprasādhakāḥ // GarP_1,59.39 //
kālaṃ pravadhyanni?śaktidā? neṣṭamanda? /
parvādistu jñeyaḥ kālaḥ kālaviśāradaiḥ // GarP_1,59.40 //
ekīkṛtyākṣarānmātraṃ nāmnoḥ strīpuṃsayostribhiḥ /
bhāge dviśeṣe strīnāśaḥ pusaḥ syādekaśūnyayoḥ // GarP_1,59.41 //
viṣkambhe ghaṭikāḥ pañca śūle sapta prakīrtitāḥ /
ṣaḍgaṇḍe cātigaṇḍe ca nava vyāghātavajrayoḥ // GarP_1,59.42 //
vyatīpāte ca parighe vaidhṛte ca dinedine /
etai mṛtyuyutā hyeṣu sarvakarmāṇi varjayet // GarP_1,59.43 //
haster'kaśca guruḥ puṣye anurādhā budhe śubhā /
rohiṇī ca śanau śreṣṭhā saumaṃ somena vai śubham // GarP_1,59.44 //
śukre ca revatī śreṣṭhā aśvinī maṅgale śubhā /
eteṣu siddhiyogā vai sarvadoṣavināśanāḥ // GarP_1,59.45 //
bhārgave bhaparaṇī caiva some citrā vṛṣadhvaja ! /
bhaume cai vottarāṣāḍhā dhaniṣṭhā ca budhe hara ! // GarP_1,59.46 //
garau śatabhiṣā rudra ! śukre vai rohiṇī tathā /
śanau ca revatī śambho ! viṣayogāḥ prakīrtitāḥ // GarP_1,59.47 //
puṣyaḥ punarvasuścaiva revatī citrayā saha /
śravaṇaṃ ca dhaniṣṭhā ca hastāśvanīmṛgāstathā // GarP_1,59.48 //
kuryācchatabhiṣāyāṃ ca jātakarmādi mānavaḥ /
viśākhā cottarātrīṇi maghārdrā bharaṇī tathā /
āśleṣā kṛttikā rudra ! prasthāne maraṇapradāḥ // GarP_1,59.49 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre nakṣatrataddevatādagdhayogādinirūpaṇaṃ nāmaikonaṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 60
hariruvāca /
ṣaḍāditye daśā jñeyā some pañcadaśa smṛtāḥ /
aṣṭāvaṅgārake cava budhai spatadaśa smṛtāḥ // GarP_1,60.1 //
śanaiścare daśa jñeyā gurorekonaviṃśatiḥ /
rāhordvādaśavarṣāṇi ekaviṃśatirbhārgave // GarP_1,60.2 //
raverdaśā duḥ khadā syādudveganṛpanāśakṛt /
vibhūtidā somadaśā sukhamiṣṭānnadā tathā // GarP_1,60.3 //
duḥ khapradā kujadaśā rājyādeḥ syādvināśinī /
divyastrīdā budhadaśā rājyadā kośavṛddhidā // GarP_1,60.4 //
śanerdaśā rājyanāśabandhuduḥ khakarī bhavet /
gurordaśā rājyadā syātsukhadharmādidāyinī // GarP_1,60.5 //
rāhordaśā rājyanāśavyādhidā duḥ khadā bhavet /
hastyaśvadā śukradaśā rājyastrīlābhadā bhavet // GarP_1,60.6 //
meṣa aṅgārakakṣetraṃ vṛṣaḥ śukrasya kīrtitaḥ /
mithunasya budho jñeyaḥ somaḥ karkaṭakasya ca // GarP_1,60.7 //
sūryakṣetraṃ bhavetsiṃhaḥ kanyā kṣetraṃ budhasya ca /
bhārgavasya tulā kṣetraṃ vṛścikoṅgārakasya ca // GarP_1,60.8 //
dhanuḥ sura guroścaiva śanermakarakumbhakau /
mīnaḥ suraguroścaiva grahakṣetraṃ prakīrtitam // GarP_1,60.9 //
paurṇamāsyādvayaṃ tatra pūrvāṣāḍhādvayaṃ bhavet /
dvirāṣāḍhaḥ sa vijñeyo viṣṇuḥ svapiti karkaṭe // GarP_1,60.10 //
aśvinī revatī citrā dhaniṣṭhā syādalaṅkṛtau /
mṛgāhikapimārjāraśvānaḥ sūkarapakṣiṇaḥ // GarP_1,60.11 //
nakulo mūṣakaścaiva yātrāyāṃ dakṣiṇe śubhaḥ /
viprakanyā śivā eṣāṃ śaṅkhabherīvasundharāḥ // GarP_1,60.12 //
veṇustrīpūrṇakumbhāśca yātrāyāṃ darśanaṃ śubham /
jambūkoṣṭrakharādyāśca yātrāyāṃ vāmake śubhāḥ // GarP_1,60.13 //
kārpāsauṣadhitailaṃ ca pakrāṅgārabhujaṅgamāḥ /
muktakeśī raktamālyanagnādyaśubhamīkṣitam // GarP_1,60.14 //
hakrāya lakṣaṇaṃ vakṣye labhatpūrve mahāphalam /
āgneye śokasantāpau dakṣiṇe hānimāpnuyāt // GarP_1,60.15 //
nairṛtya śokasantāpau miṣṭānnaṃ caiva paścime /
artha prāpnoti vāyavye uttare kalahobhavet // GarP_1,60.16 //
īśāne maraṇaṃ proktaṃ hikkāyāścaphalāphalam /
vilikhya ravicakraṃ tu bhāskaro narasannibhaḥ // GarP_1,60.17 //
yasminnṛkṣe vasadbhānustadāndi trīṇi mastake /
trayaṃ vakre pradātavyamekaikaṃ skandhayornyaset // GarP_1,60.18 //
ekaikaṃ bāhuyugme tu ekaika hastayordvayoḥ /
hṛdaye pañca ṛkṣāṇi ekaṃ nābhau pradāpayet // GarP_1,60.19 //
ṛkṣamekaṃ nyasedguhye ekaikaṃ jānuke nyaset /
nakṣatrāṇi ca śeṣāṇi ravipāde niyojayet // GarP_1,60.20 //
caraṇasyena ṛkṣeṇa alpāyurjāyate naraḥ /
vidaśagamanaṃ jānau guhyasthe paradāravān // GarP_1,60.21 //
nābhisthenālpasantuṣṭo hṛtsthena syānmaheśvaraḥ /
pāṇisthena bhaveccauraḥ sthānabhraṣṭo bhaveddhaja // GarP_1,60.22 //
skandhasthite dhanapatirmukhe miṣṭānnamāpnuyāt /
mastake padṛvastraṃ syānnakṣatraṃ yadi sthitam // GarP_1,60.23 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍaṃ prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre grahadaśādinirūpaṇaṃ nāma ṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 61
hariruvāca /
saptamopacayādyasthaścandraḥ sarvatra śobhanaḥ /
śuklapakṣe dvitīyastu pañcamo navamastathā // GarP_1,61.1 //
saṃpūjyamāno lokaistu guruvaddṛśyate śaśī /
candrasya dvādaśāvasthā bhavanti śṛṇu tā api // GarP_1,61.2 //
triṣutriṣu ca ṛkṣeṣu aśvinyādi vadāmyaham /
pravāsasthaṃ punardṛṣṭaṃ mṛtāvasthaṃ jayāvaham // GarP_1,61.3 //
hāsyāvasthaṃ natā(krīḍā) vasthaṃ pramodāvasthameva ca /
viṣādāvasthabhogasthe jvarāvasthaṃ vyavasthitam // GarP_1,61.4 //
kampā(nyā) vasthaṃ sukhāvasthaṃ dvādaśāvasthagaṃ bhavet /
pravāso hānimṛnyṛ ca jayo hāseratiḥ sukham // GarP_1,61.5 //
śoko bhogo jvaraḥ kampaḥ sukhaṃ ceti kramātphalam /
janmasthaḥ kurute tuṣṭiṃ dvitīye nāsti nirvṛtiḥ // GarP_1,61.6 //
tṛtīye rājasanmānaṃ caturthe kalahāgamaḥ /
pañcamena mṛgāṅkena strīlābho vai tathā bhavet // GarP_1,61.7 //
ghanadhānyāgamaḥ ṣaṣṭhe ratiḥ pūjā ca saptame /
aṣṭame prāṇasandeho navame kośasañcayaḥ // GarP_1,61.8 //
daśame kāryaniṣpattidhruvamekādaśe jayaḥ /
dvādaśena śaśāṅkena mṛtyureva na saṃkhayaḥ // GarP_1,61.9 //
kṛttikādau ca pūrveṇa saptarkṣāṇi ca vai vrajet /
maghādau dakṣiṇe gacchedanurādhādi paścime // GarP_1,61.10 //
praśastā cottara yātrā dhaniṣṭhādiṣu saptasu /
aśvinī revatī citrā dhaniṣṭhā samalaṅkṛtau // GarP_1,61.11 //
mṛgāśvicitrāpuṣyāśca mūlā hastā śubhāḥ sadā /
kanyāpradāne yātrāyāṃ pratiṣṭhādiṣu karmasu // GarP_1,61.12 //
śukracandrau hi janmasthau śubhadau ca dvitīyake /
śaśijñaśukrajīvāśca rāśau rāśau cātha tṛtīyake // GarP_1,61.13 //
bhaumamandaśaśāṅkārkā budhaḥ śreṣṭhaścaturthake /
śukrajīvau pañcame ca candraketusamāhitau // GarP_1,61.14 //
mandākārai ca kujaḥ ṣaṣṭhe gurucandrau ca saptame /
jñaśukrāvaṣṭame śreṣṭhau navamastho guruḥ śubhaḥ // GarP_1,61.15 //
arkārkicandrā daśame grahā ekādaśe khilāḥ /
budho 'tha dvādaśe caiva bhārgavaḥ sukhado bhavet // GarP_1,61.16 //
siṃhena makaraḥ śreṣṭhaḥ kanyayā meṣa uttamaḥ /
tulayā saha mīnastu kumbhena sahakarkaṭaḥ // GarP_1,61.17 //
dhanuṣā vṛṣabhaḥ śreṣṭho mithunena ca vṛścikaḥ /
etatṣaḍaṣṭakaṃ?prītyai bhavatyeva na saṃśayaḥ // GarP_1,61.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre grahāṇāṃ śubhāśubhasthānādinirūpaṇaṃ nāmaikapaṣṭitamo 'dhyāyaḥ


_____________________________________________________________


iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre lagnaghaṭikā pramāṇādinirūpaṇaṃ nāma dviṣaṣṭitamo 'dhyāyaḥ
śrīgaruḍamahāpurāṇam- 63


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 63
hariruvāca /
narastrīlakṣaṇaṃ vakṣye saṃkṣapācchṛṇu śaṅkara /
asvedinau mṛdutalau kamalodarasannibhau // GarP_1,63.1 //
śliṣṭāṅgulī tāmranakhau sugulphau śirayojjhitau /
kūrmonnatau ca caraṇau syātāṃ nṛpavarasya hi // GarP_1,63.2 //
virūkṣapāṇḍuranakhau vakrau caiva śirānatau /
sūrpākārau ca caraṇau saṃkhuṣkau viralāṅgulī // GarP_1,63.3 //
duḥ khadāridyadau syātā nātra kāryāṃ vicāraṇā /
alparomayutā śreṣṭhā jaṅghā hastikaropamā // GarP_1,63.4 //
romaikaikaṃ kūpake syādbhūpānāṃ tu mahātmanām /
dvedve romṇī paṇḍitānāṃ śrotriyāṇāṃ tathaiva ca // GarP_1,63.5 //
romatrayaṃ daridrāṇāṃ rogī nirmāṃsajānukaḥ /
alpaliṅgī ca dhanavānsyācca putrādivarjitaḥ // GarP_1,63.6 //
sthūlaliṅgo daridraḥ syāddukhyekavṛṣṇī bhavet /
viṣamestrīcañcalo vai nṛpaḥ syādvṛṣaṇe same // GarP_1,63.7 //
pralambavṛṣaṇo 'lpāyurnirdravyaḥ kumaṇirbhavet /
pāṇḍurairmalinaiścaiva maṇibhiśca sukhī naraḥ // GarP_1,63.8 //
niḥ svāḥ saśabdamūtrāḥ syurnṛpā niḥśabdadhārayā /
bhogāḍhyāḥ samajaṭharā niḥ svāḥ syurghaṭasannibhāḥ // GarP_1,63.9 //
sarpodarā daridrāḥ syū rekhābhiścāyurucyate /
lalāṭe yasya dṛśyante tisro rekhāḥ samāhitāḥ // GarP_1,63.10 //
sukhī putrasamāyuktaḥ sa ṣaṣṭiṃ jīvate naraḥ /
catvāriṃśacca varṣāṇi dvirekhādarśanānnaraḥ // GarP_1,63.11 //
viṃśatyabdaṃ tvekarekhā ākarṇāntāḥ śatāyuṣaḥ // GarP_1,63.12 //
saptatyāyurdvirekhā tu ṣaṣṭyāyustisṛbhirbhavet /
vyaktāvyaktābhī rekhābhirviṃśatyāyurbhavennaraḥ // GarP_1,63.13 //
catvāriṃśacca varṣāṇi hīnarekhastu jīvati /
bhinnābhiścaiva rekhābhirapamṛtyurnarasya hi // GarP_1,63.14 //
triśūlaṃ paṭṭiśaṃ vāpi lalāṭe yasya dṛśyate /
dhanaputra samāyuktaḥ sa jīveccharadaḥ śatam // GarP_1,63.15 //
tarjanyā madhyamāṅgulyā āyūrekhā tu madhyataḥ /
saṃprāptā yā bhavedrudra ! sa jīveccharadaḥ śatam // GarP_1,63.16 //
prathamā jñānarekhā tu hyaṅguṣṭhādanuvartate /
madhyamāmūlagā rekhā āyūrekhā ataḥ param // GarP_1,63.17 //
kaniṣṭhikāṃ samāśritya āyūrekhā samāviśet /
acchinnā vā vibhaktā vā sa jīveccharadaḥ śatam // GarP_1,63.18 //
yasya pāṇitale rekhā āyustasya prakāśayet /
śatavarṣāṇi jīvecca bhogī rudra ! na saṃśayaḥ // GarP_1,63.19 //
kaniṣṭhikāṃ samāśritya madhyamāyāmupāgatā /
ṣaṣṭhivarṣāyuṣaṃ kuryādāyūrekhā tu mānavam // GarP_1,63.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre sāmudrike puṃllakṣaṇanirūpaṇaṃ nāma triṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 64
hariruvāca /
yasyāstu kuñcitāḥ keśā mukhaṃ ca parimaṇḍalam /
nābhiśca dakṣiṇāvartā sā kanyā kulavardhinī // GarP_1,64.1 //
yā ca kāñcanavarṇābhā raktahastasaroruhā /
sahasrāṇāṃ tu nārīṇāṃ bhavetsāpi pativratā // GarP_1,64.2 //
vakrakeśā ca yā kanyā maṇḍalākṣī ca yā bhavet /
bhartā ca mriyate tasyā niyataṃ duḥ khabhāginī // GarP_1,64.3 //
pūrṇacandramukhī kanyā bālasūryasamaprabhā /
viśālanetrā bimboṣṭhī sā kanyā labhate sukham // GarP_1,64.4 //
rekhābhirbahubhiḥ kleśaṃ svalpābhirdhanahīnatā /
raktābhiḥ sukhamāpnoti kṛṣṇābhiḥ preṣyatāṃvrajet // GarP_1,64.5 //
kārye ca mantrī satstrī syātsatī (khī) syātkaraṇeṣu ca /
streheṣu bhāryā mātā syādveśyā ca śayane śubhā // GarP_1,64.6 //
aṅkuśaṃ kuṇḍalaṃ cakraṃ yasyāḥ pāṇitale bhavet /
putraṃ prasūyate nārī narendraṃ labhate patim // GarP_1,64.7 //
yasyāstu romaśau pārśvau romaśau ca payodharau /
annatau cādharoṣṭhau ca kṣipraṃ mārayate patim // GarP_1,64.8 //
yasyāḥ pāṇitale rekhā prākārastoraṇaṃ bhavet /
api dāsakule jātā rājñītvamupagacchati // GarP_1,64.9 //
udvṛttā kapilā yasya romarājī nirantaram /
api rājakule jātā dāsītvamupagacchati // GarP_1,64.10 //
yasyā anāmikāṅguṣṭhau pṛthivyāṃ naiva tiṣṭhataḥ /
patiṃ mārayate kṣipraṃ svecchācāreṇa vartate // GarP_1,64.11 //
yasyā gamanamātreṇa bhūmikampaḥ prajāyate /
patiṃ mārayate kṣipraṃ svecchācāreṇa vartate // GarP_1,64.12 //
cakṣuḥ snehena saubhāgyaṃ dantasnehena bhojanam /
tvacaḥ snehena śāyyāṃ ca pādasnehena vāhanam // GarP_1,64.13 //
snigdhonnatau tāmranakhau nāryāśca caraṇau śubhau /
matsyāṅkuśābjacihnau ca cakralāṅgalalakṣitau // GarP_1,64.14 //
asvedinau mūdutalau praśastau caraṇau striyāḥ /
śubhe jaṅghe virome ca ūrū hastikaropamau // GarP_1,64.15 //
aśvatthapatrasadṛśaṃ vipulaṃ guhyamuttamam /
nābhiḥ praśastā gambhīrā dakṣiṇāvartikā śubhā /
aromā trivalī nāryā hṛtstanau romavarjitau // GarP_1,64.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre sāmudrike strīlakṣaṇanirūpaṇaṃ nāma catuḥ ṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 65
hariruvāca /
samudroktaṃ pravakṣyāmi narastrīlakṣaṇaṃ śubham /
yena vijñātamātreṇa atītānāgatāpramā // GarP_1,65.1 //
asvedinau mṛdutalau kamalodarasannibhau /
śleṣṭāṅgulī tāmranakhau pādāviṣṇau śirojjhitau // GarP_1,65.2 //
kūrmonnatau gūḍhagulphau supārṣṇo nṛpateḥ smṛtau /
śū(sar) pākārau virūkṣau ca vakrau pādau śirālakau // GarP_1,65.3 //
saṃśuṣkau pāṇḍuranakhau niḥ svasya viralāṅgulī /
mārgāyotkaṇṭakau pādau kaṣāyasadṛśau tathā // GarP_1,65.4 //
vicchittidau ca vaṃśasya brahmanghau śaṅku (pakra) sannibhau /
agamyāgamane prītau jaṅghā viralaromikā // GarP_1,65.5 //
mṛduromā samā jaṅghā tathā karikaraprabhā /
ūravo jānavastulyā nṛpasyopacitāḥ smṛtāḥ // GarP_1,65.6 //
niḥ svasya sṛgālajaṅghā raumaikaikaṃ cakūpake /
nṛpāṇāṃ śrotriyāṇāṃ ca dvedve śriye ca dhīmatām // GarP_1,65.7 //
tryādyairniḥ svā mānavāḥ syurduḥ svabhājaśca ninditāḥ /
keśāśca vai kuñcitāśca pravāse mriyate naraḥ // GarP_1,65.8 //
nirmāṃsajānuḥ saubhāgyamalpairnimnai ratiḥ striyāḥ /
vikaṭaiśca daridrāḥ syuḥ samāṃsai rājyameva ca // GarP_1,65.9 //
mahadbhirāyurākhyātaṃ hyalpaliṅgo dhanī naraḥ /
apatyarahitaścaiva sthūlaliṅgo ghanojjhitaḥ // GarP_1,65.10 //
meḍhe vāmanate caiva sutārtharahito bhavet /
vakre 'nyathā putravāntsyāddāridrayaṃ vinatetvadhaḥ // GarP_1,65.11 //
alpe tvatanayo liṅgeśirāle 'tha sukhī naraḥ /
sthūlagranthiyute liṅge bhavetputrādisaṃyutaḥ // GarP_1,65.12 //
kośagūḍhe dīrghairbhugnaiśca dhanavarjitaḥ /
balavānyuddhaśīlaśca laghuśektaḥ sa eva ca // GarP_1,65.13 //
durbalastvekavṛṣaṇo viṣamābhyāñcalaḥ striyām /
samābhyāṃ kṣitipaḥ proktaḥ pralambena śatābdavān // GarP_1,65.14 //
udvṛṃ (ddha) tābhyāṃ ca bahvāyū rūkṣairmaṇibhirīśvaraḥ /
pāṇḍarairmaṇibhirniḥ svā malinaiḥ sukhabhāginaḥ // GarP_1,65.15 //
saśabdaniḥ śabdamūtrāḥ syudaṃridrāśca mānavāḥ /
ekadvitricatuḥ pañcaṣaḍbhirdhārābhireva ca // GarP_1,65.16 //
dakṣiṇāvartacalitamūtrā bhiśca nṛpāḥ smṛtāḥ /
vikīrṇamūtrā niḥ svāśca pradhānasukhadāyikāḥ // GarP_1,65.17 //
ekadhārāśca vanitāḥ snigdhairmaṇibhirunnataiḥ /
samaiḥ strīratnadhanino madhye nimnaiśca kanyakāḥ // GarP_1,65.18 //
śuṣkairniśvā viśuṣkaiśca durbhagāḥ parikīrtitāḥ /
puṣpagandhe nṛpāḥ śukre madhugandhe dhanaṃ bahuḥ // GarP_1,65.19 //
putrāḥ śukre matsyagandhe tanuśukre ca kanyakāḥ /
mahābhogī māṃsagandhe yajvā syānmadagandhini // GarP_1,65.20 //
daridraḥ kṣāragandhe ca dīrghāyuḥ śīghramaithunī /
aśīghramaithunyalpāyuḥ sthūlasphik syāddhanojjhitaḥ // GarP_1,65.21 //
māṃsalasphik sukhī syācca siṃhasphik bhūpatiḥ smṛtaḥ /
bhavetsiṃhakaṭī rājā niḥ svaḥ kapikaṭirnaraḥ // GarP_1,65.22 //
sarpodarā daridrāḥ syuḥ piṭharaiśca ghaṭaiḥ samaiḥ /
dhanino vipulaiḥ pārśvairniḥ svā raktaiśca nimnagaiḥ // GarP_1,65.23 //
samakakṣāśca bhogāḍhyā nimnakakṣā dhanojjhitāḥ /
nṛpāśconnatakakṣāḥ syurjihnā viṣamakakṣakāḥ // GarP_1,65.24 //
matsyodarā bahudhanā nābhibhiḥ sukhinaḥ smṛtāḥ /
vistīrṇābhirbahulābhirnimnābhiḥ kleśabhāginaḥ // GarP_1,65.25 //
balimadhyagatā nābhiḥ śūlabādhāṃ karoti hi /
vāmāvartaśca sādhyaṃ vai medhāṃ dakṣiṇatastathā // GarP_1,65.26 //
pārśvāyatā cirāyurdā tūpaviṣṭā dhaneśvaram /
adho gavāḍhyaṃ kuryācca nṛpatvaṃ padmakarṇikā // GarP_1,65.27 //
ekabaliḥ śatāyuḥ syācchrībhogī dvivaliḥ smṛtaḥ /
trivaliḥ kṣmāpa ācārya ṛjubhirvālibhiḥ sukhī // GarP_1,65.28 //
agamyāgāmī jihmabalirbhūpāḥ pārśvaiśca māṃsalaiḥ /
mṛdubhiḥ susamaiścaiva dakṣiṇāvartaromabhiḥ // GarP_1,65.29 //
viparītaiḥ parapreṣyā nirdravyāḥ sukhavarjitāḥ /
anuddhataiścūcukaiśca bhavanti subhagā narāḥ // GarP_1,65.30 //
nirdhanā viṣamairderghaiḥ pītopacitakairnṛpāḥ /
samonnataṃ ca hṛdayamakampaṃ māṃsalaṃ pṛthu // GarP_1,65.31 //
nṛpāṇāmadhamānāṃ ca khararomaśirālakam /
arthavānsamavakṣāḥ syātpīnairvakṣobhirūrjitaḥ // GarP_1,65.32 //
vakṣobhirviṣamairniḥ svaḥ śastreṇanidhanāstathā /
viṣamairjatrubhirniḥ svā asthinaddhaiśca mānavāḥ // GarP_1,65.33 //
unnatairbhogino nimnairniḥ svāḥ pīnairdhanānvitāḥ /
niḥ svaścipiṭakaṇṭhaḥ syācchirāśuṣkagalaḥ sukhī // GarP_1,65.34 //
śūraḥ syānmahiṣagrīvaḥ śāstrātto mṛgakaṇṭhakaḥ /
kambugrīvaśca nṛpatirlambakaṇṭho 'tibhakṣakaḥ // GarP_1,65.35 //
aromaśā bhugnapṛṣṭhaṃ śubhaṃ cāśubhamanyathā /
kakṣāśvatthadalā śreṣṭhā sugandhirmṛgaromikā // GarP_1,65.36 //
anyathā tvarthahīnānāṃ dāridrayasya ca kāraṇam /
saṃmāsau caiva bhugnālpau śliṣṭau ca vipulau śubhau // GarP_1,65.37 //
ājānulambitau bāhū vṛttau pīnau nṛpeśvare /
niḥ svānāṃ romaśau hrasvau śreṣṭhau karikara prabhau // GarP_1,65.38 //
hastāṅgulaya eva syuvāyudvārayutāḥ śubhāḥ /
medhāvināṃ ca sūkṣmāḥ syurbhṛtyānāṃ cipiṭāḥ smṛtāḥ // GarP_1,65.39 //
sthūlāṅgulībhirniḥ svāḥ syurnatāḥ syuḥ sukṛśaistadā /
kapitulyakarāḥ niḥ svā vyāghratulyakarairbalam // GarP_1,65.40 //
pitṛvittavināśaśca nimnātkaratalānnarāḥ /
maṇibandhairnigūḍhaiśca suśliṣṭaiḥ śubhagandhibhiḥ // GarP_1,65.41 //
nṛpā hīnāḥ karacchaidaiḥ saśabdairdhanavarjitāḥ /
saṃvṛtaiścaiva nimnaiśca dhaninaḥ parikīrtitāḥ // GarP_1,65.42 //
prottānaka radātāro viṣamairviṣamā narāḥ /
karaiḥ karatalaiścaiva lākṣābhairīśvarāstalaiḥ // GarP_1,65.43 //
paradāraratāḥ pītairūkṣairniḥ svā narā matāḥ /
tuṣatulyanakhāḥ klībāḥ kuṭilaiḥ sphuṭitairnarāḥ // GarP_1,65.44 //
niḥ svāśca kunakhaistadvadvivarṇaiḥ paratarkakāḥ /
tāmrairbhūpā dhanāḍhyāśca aṅguṣṭhaiḥ sayavaistathā // GarP_1,65.45 //
aṅguṣṭhamūlajaiḥ putrī syāddīrghāṅguliparvakaḥ /
dīrghāyuḥ subhagaścaiva nirdhano viralāṅguliḥ // GarP_1,65.46 //
ghanāṅguliśca sadhanastisro rekhāścayasya vai /
nṛpateḥ karatalagā maṇibandhātsamutthitāḥ // GarP_1,65.47 //
yugamīnāṅkitanaro bhavetsatraprado naraḥ /
vajrākārāśca dhanināṃ matsyapucchanibhā budhe // GarP_1,65.48 //
śaṅkhātapatraśivikāgajapadmopamā nṛpe /
kumbhāṅkuśapatākābhā mṛṇālābhā nidhīśvare // GarP_1,65.49 //
dāmābhāśca gavāḍhyānāṃ svastikābhā nṛpeśvare /
cakrāsitomaradhanuḥ kuntābhā nṛpateḥ kare // GarP_1,65.50 //
alūkhalābhā yajñāḍhyā vedībhā cāgnihotriṇi /
vāpīdevakulyābhāstrikoṇābhāścadhārmike // GarP_1,65.51 //
aṅguṣṭhamūlagā rekhāḥ putrāḥ sūkṣmāśca dārikāḥ /
pradeśinīgatā rekhā kaniṣṭhāmūlagāminī // GarP_1,65.52 //
śatāyuṣaṃ ca kurute chinnayā taruto bhayam /
niḥ svāśca bahurekhāḥ syunirdravyāścibukaiḥ kṛśaiḥ // GarP_1,65.53 //
māṃsalaiśca dhanopetā āraktairadharairnṛpāḥ /
bimbopamaiśca sphuṭitairoṣṭhairūkṣaiścakaṇḍitaiḥ // GarP_1,65.54 //
viṣamairdhanahīnāśca dantāḥ snigdhā ghanāḥ śubhāḥ /
tīkṣṇā dantāḥ samāḥ śreṣṭhā jihvā raktā samā śubhā // GarP_1,65.55 //
ślakṣṇā dīrghā ca vijñeyā tālū śvete dhanakṣaye /
kṛṣṇe ca paruṣo vakraṃ samaṃ saumyaṃ ca saṃvṛtam // GarP_1,65.56 //
bhūpānāmamalaṃ ślakṣṇaṃ viparītaṃ ca duḥ khinām /
mahā duḥ khaṃ durbhagāṇāṃ strīmukhaṃ putramāpnuyāt // GarP_1,65.57 //
āḍhyānāṃ vartulaṃ vakraṃ nirdravyāṇāṃ ca dīrghakam /
bhīruvakraḥ pāpakarmā dhūrtānāṃ caturaśrakam // GarP_1,65.58 //
nimnaṃ vakramaputrāṇāṃ kṛpaṇānāṃ ca hrasvakam /
sampūrṇaṃ bhogināṃ kāntaṃ śmaśru snigdhaṃ śubhaṃ mṛdu // GarP_1,65.59 //
saṃhataṃ cāsphuṭitāgraṃ raktaśmaśruśca caurakaḥ /
raktālpaparuṣaśmaśrukarṇāḥ syuḥ pāpamṛtyavaḥ // GarP_1,65.60 //
nirmāṃsaiścipiṭairbhogāḥ kṛpaṇā hrasvakarṇakāḥ /
śaṅkukarṇāśca rājāno romakarṇā gatāyuṣaḥ // GarP_1,65.61 //
bṛhatkarṇāśca dhaninorājānaḥ parikīrtitāḥ /
karṇaiḥ snigdhāvanaddhaiśca vyālambairmāṃsalairnṛpāḥ // GarP_1,65.62 //
bhogī vai nimnagaṇḍaḥ syānmatrī sampūrṇagaṇḍakaḥ /
śukanāsaḥ sukhī syācca śuṣkanāso 'tijīvanaḥ // GarP_1,65.63 //
chinnāgrakūpanāsaḥ syādagamyāgamane rataḥ /
dīrghanāse ca saubhāgyaṃ cauraścākuñcitendriyaḥ // GarP_1,65.64 //
mṛtyuścipiṭanāse syāddhīno bhāgyavatāṃ bhavet /
svalpacchidrau supuṭau ca avakrau ca nṛpeśvare // GarP_1,65.65 //
krūre dakṣiṇavakrā syādvalināṃ ca kṣutaṃ sakṛt /
syādviniṣpiṇḍitaṃ hrādi sānunādaṃ ca jīvakṛt // GarP_1,65.66 //
vakrāntaiḥ padmapatrābhairlocanaiḥ sukhabhāginaḥ /
mārjāralocanaiḥ pāpmā durātmā madhupiṅgalaiḥ // GarP_1,65.67 //
krūrāḥ kekaranetrāśca haritākṣāḥ sakalmaṣāḥ /
jihyaiśca locanaiḥ śūrāḥ senānyo gajalocanāḥ // GarP_1,65.68 //
gambhīrākṣā īśvarāḥ syurmantriṇaḥ sthūlacakṣuṣaḥ /
nīlotpa lākṣā vidvāṃsaḥ saubhāgyaṃ śyāmacakṣuṣām // GarP_1,65.69 //
syātkṛṣṇatārakākṣāṇāmakṣṇāmutpāṭanaṃ kila /
maṇḍalākṣāśca pāpāḥ syurniḥ svāḥ syurdenalocanāḥ // GarP_1,65.70 //
dṛk snigdhā vipulā bhoge alpāyuradhikonnatā /
viśālonnatā sukhinī daridrā viṣamabhruvaḥ // GarP_1,65.71 //
ghanadīrghāsusaktabhrūrbālendūnnatasubhruvaḥ /
āḍhyo niḥ svaśca khaṇḍabhrṛrmadhye ca vinatabhruvaḥ // GarP_1,65.72 //
strīṣu gamyāsu saktāḥ syuḥ sutārthe parivarjitāḥ /
annatairvipulaiḥ śaṅkhairlalāṭairviṣamaistathā // GarP_1,65.73 //
nirdhanā dhanavantaśca ardhendusadṛśairnarāḥ /
ācāryāḥ śuktiviśālaiḥ śirālaiḥ pāpakāriṇaḥ // GarP_1,65.74 //
annatābhaiḥ śirābhiśca svastikābhirdhaneśvarāḥ /
nimnairlalāṭairbandhārhāḥ krūrakarmaratāstathā // GarP_1,65.75 //
saṃvṛtaiśca lalāṭaiśca kṛpaṇā unnatairnṛpāḥ /
anaśru snigdharuditamadīnaṃ śubhadaṃ nṛṇām // GarP_1,65.76 //
pracurāśrudīnaṃ rūkṣaṃ ca ruditaṃ ca sukhāvaham /
akampaṃ hasitaṃ śreṣṭhaṃ mīlitākṣamaghāvaham // GarP_1,65.77 //
asakṛddhasitaṃ duṣṭaṃ sonmādasya hyanekadhā /
lalāṭopasṛtāstisro rekhāḥ syuḥ śatavarṣiṇām // GarP_1,65.78 //
nṛpatvaṃ syāccatasṛbhirāyuḥ pañcanavatyatha /
arekheṇāyurnavatirvicchinnābhiśca puṃślalāḥ // GarP_1,65.79 //
keśāntopagatābhiśca aśītyāyurnaro bhavet /
pañcabhiḥ saptabhiḥ ṣaḍbhiḥ pañcāśadvahubhistathā // GarP_1,65.80 //
catvāriṃśacca vakrābhistriṃśadbhrūlagnagāmibhiḥ /
viṃśatirvāmavakrā bhirāyuḥ kṣudrābhiralpakam // GarP_1,65.81 //
chatrākāraiḥ śirobhistu nṛpā nimnaśirā dhanī /
cipiṭaiśca piturmṛtyurgavādyāḥ parimaṇḍalaiḥ // GarP_1,65.82 //
ghaṭamūrdhā pāparucirdhanādyaiḥ parivarjitaḥ /
kṛṣṇairākuñcitaiḥ keśaiḥ snigdhairekaikasambhavaiḥ // GarP_1,65.83 //
abhinnāgraiśca mṛdubhirna cātibahubhirnṛpāḥ /
bahumūlaiśca viṣamaiḥ sthūlāgraiḥ kapilaistathā // GarP_1,65.84 //
niḥ svāścaivātikucilairghanairasita (dhika) mūrdhajaiḥ /
yadyadgātraṃ mahārūkṣaṃ śirālaṃ māṃsavarjitam // GarP_1,65.85 //
tattatsyā daśubhaṃ sarvaṃ tato 'nyathā /
vipulastriṣu gambhīro dīrghaḥ sūkṣmaśca pañcasu // GarP_1,65.86 //
ṣaḍunnataścaturhrasvo raktaḥ saptasvasau nṛpaḥ /
nābhiḥ svaraśca sasattvaṃ ca trayaṃ gambhīramīritam // GarP_1,65.87 //
puṃsaḥ syādativistīrṇaṃ lalāṭaṃ vadanaṃ hyuraḥ /
cakṣuḥ kakṣā nāsikā ca ṣaṭ syur nṛpakṛkāṭikāḥ // GarP_1,65.88 //
unnatāni ca hrasvani jaṅghā grīvā ca liṅgakam /
pṛṣṭhaṃ catvāri raktāni karatālvadharā nakhāḥ // GarP_1,65.89 //
netrāntapādajihvauṣṭhāḥ pañca sūkṣmāṇi santi vai /
daśanāṅguliparvāṇi nakhakeśatvacaḥ śubhāḥ // GarP_1,65.90 //
dīrghāḥ stanāntaraṃ bāhudantalocananāsikāḥ /
narāṇāṃ lakṣaṇaṃ proktaṃ vadāmi strīṣu lakṣaṇam // GarP_1,65.91 //
rājñyāḥ snigdhau samau pādau talau tāmrau nakhau tathā /
śliṣṭāṅgulī connatāgrau tāṃ pāpya nṛpatirbhavet // GarP_1,65.92 //
nigūḍhagulphopacitau padmakāntitalau śubhau /
asvedinau mṛdutalau matsyāṅkuśaghvajāñcitau // GarP_1,65.93 //
vajrābjahalacihnau ca dāsyāḥ pādau tato 'nyathā /
jaṅghe ca romarahite suvṛtte viśire śubhe // GarP_1,65.94 //
anulbaṇaṃ sandhideśaṃ samaṃ jānudvayaṃ śubham /
ūrū karikarākārāvaromau ca samau śubhau // GarP_1,65.95 //
aśvatthapatrasadṛśaṃ vipulaṃ guhyamuttamam /
śroṇīlalāṭakaṃ strīṇāmūru kūrmonnataṃ śubham // GarP_1,65.96 //
gūḍho maṇiśca śubhado nitambaśca guruḥ śubhaḥ /
vistīrṇamāṃsopacitā gambhīrā vipulā śubhā // GarP_1,65.97 //
nābhiḥ pradakṣiṇāvartā madhyaṃ tribaliśobhitam /
aromaśau stanau pīnau ghanāvaviṣamau śubhau // GarP_1,65.98 //
kaṭhinau romaśā śastā mṛdugrīvā ca kambubhā /
āraktāvadharau śreṣṭhau māṃsalaṃ vartulaṃ mukham // GarP_1,65.99 //
kundapuṣpasamā dantā bhāṣitaṃ kokilāsamam /
dākṣiṇyayuktamaśaṭhaṃ haṃsaśabdasukhāvaham // GarP_1,65.100 //
nāsā samā samapuṭā strīṇāṃ tu rucirā śubhā /
nīlotpalanibhaṃ cakṣurnāsālagnaṃ na lambakam // GarP_1,65.101 //
na pṛthū bālendunibhe bhruvau cātha lalāṭakam /
śubhamardhendusaṃsthānamatuṅgaṃ syādalomaśam // GarP_1,65.102 //
sumāṃsalaṃ karṇayugmaṃ samaṃ mṛdu samāhitam /
snigdhā nīlāśca mṛdavo mūrdhajāḥ kuñcitāḥ kacāḥ // GarP_1,65.103 //
strīṇāṃ samaṃ śiraḥ śreṣṭhaṃ pāde pāṇitale 'tha vā /
vājikuñjaraśrīvṛkṣayūpeṣuyavatomaraiḥ // GarP_1,65.104 //
dhvajacāmaramālābhiḥ śailakuṇḍalavedibhiḥ /
śaṅkhātapatrapadmaiśca matsyasvastikasadrathaiḥ // GarP_1,65.105 //
lakṣaṇairaṅkuśādyaiśca striyaḥ syū rājavallabhāḥ /
nigūḍhamaṇibandhau ca padmagarbhopamau karau // GarP_1,65.106 //
na nimnaṃ nonnataṃ strīṇāṃ bhavetkaratalaṃ śubham /
rekhānvitaṃ tvavidhavāṃ kuryātsaṃbhoginīṃ striyam /
rekhā yā maṇibandhotthā gatā madhyāṅguliṃ kare // GarP_1,65.107 //
gatā pāṇitale yā ca yordhvapādatale sthitā /
strīṇāṃ puṃsāṃ tathā sā syādrājyāya ca sukhāya ca // GarP_1,65.108 //
kaniṣṭhikāmūlabhavā rekhā kuryācchatāyuṣam /
pradeśinīmadhyamābhyāmantarālagatā satī // GarP_1,65.109 //
ūnā ūnāyuṣaṃ kuryādrekhāścāṅguṣṭhamūlagāḥ /
bṛhatyaḥ putrāstanvyastu pramadāḥ parikīrtitāḥ // GarP_1,65.110 //
svalpāyuṣo bahu (laghu) cchinnā dīrghāchinnā mahāyuṣam /
śubhaṃ tu lakṣaṇaṃ strīṇāṃ proktaṃ tvaśubhamanyathā // GarP_1,65.111 //
kaniṣṭhikānāmikā vā yasyā na spṛśate mahīm /
aṅguṣṭhaṃ vā gatātītya tarjanī kulaṭā ca sā // GarP_1,65.112 //
ūrdhvaṃ dvābhyāṃ piṇḍikābhyāṃ jaṅghe cātiśirālake /
romaśecātimāṃse ca kumbhākāraṃ tathodaram // GarP_1,65.113 //
vāmāvartaṃ nimnamalpaṃ duḥ khitānāṃ ca guhyakam /
grīvayā hrasvayā niḥ svā dīrghayā ca kulakṣayaḥ // GarP_1,65.114 //
pṛthulayā pracaṇḍāśca striyaḥ syurnātra saṃśayaḥ /
kekare piṅgale netre śyāme lolekṣaṇā satī // GarP_1,65.115 //
smite kūpe gaṇḍayośca sā dhruvaṃ vyabhicāriṇī /
pralambinī lalāṭe tu devaraṃ hanti cāṅganā // GarP_1,65.116 //
udare śvaśuraṃ hanti patiṃ hanti sphicordvayoḥ /
yā tu romottarauṣṭhī syānna śubhā bhartureva hi // GarP_1,65.117 //
stanau saromāvaśubhau karṇau ca viṣamau tathā /
karālā viṣamā dantāḥ kleśāya ca bhavanti te // GarP_1,65.118 //
cauryāya kṛṣṇamāṃsāśca dīrghā bhurtuśca mṛtyave /
kravyādarūpairhastaiśca vṛkakākādisannibhaiḥ // GarP_1,65.119 //
śirālairviṣamaiḥ śuṣkairvittahīnā bhavanti hi /
samunnatottareṣṭhī yā kalahe rūkṣabhāṣiṇī // GarP_1,65.120 //
strīṣu doṣā virūpāsu patrākāro guṇāstataḥ /
narastrīlakṣaṇaṃ proktaṃ vakṣye tajjñānadāyakam // GarP_1,65.121 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre sāmudrike strīnaralakṣaṇaṃ nāma pañcaṣaṣṭitamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 66
hariruvāca /
nirlakṣaṇā śubhā syācca cakrāṅkitaśilārcanāt /
ādau sudarśano mūrtirlakṣmīnārāyaṇaḥ paraḥ // GarP_1,66.1 //
tricakro 'sāvacyutaḥ syāccatuścakraścaturbhujaḥ /
vāsudevaśca pradyumnastataḥ saṅkarṣaṇaḥ smṛtaḥ // GarP_1,66.2 //
puruṣottamaścāṣṭamaḥ syānnavyūho daśātmakaḥ /
ekādaśo 'niruddhaḥ syāddvādaśo dvādaśātmakaḥ // GarP_1,66.3 //
ata ūrdhvamanantaḥ syācchakre rekādikaiḥ kramāt /
sudarśanā lakṣitāśca pūjitāḥ sarvakāmadāḥ // GarP_1,66.4 //
śālagrāmaśilā yatra devo dvāravatībhavaḥ /
ubhayoḥ saṃgamo yatra tatra muktirna saṃśayaḥ // GarP_1,66.5 //
śālagrāmo dvārakā ca naimiṣaṃ puṣkaraṃ gayā /
vārāṇasī prayāgaśca kurukṣetraṃ ca sūkaram // GarP_1,66.6 //
gaṅgā ca narmadā caiva candrabhāgā sarasvatī /
puruṣottamo mahākālastīrthānyetāni śaṅkara // GarP_1,66.7 //
sarvapāpaharāṇyeva bhuktamuktipradāni vai /
prabhavo vibhavaḥ śuklaḥ pramodo 'tha prajāpatiḥ // GarP_1,66.8 //
aṅgirāḥ śrīmukho bhāvaḥ yuvā dhātā tathaiva ca /
īśvaro bahudhānyaśca pramāthī vikramo viṣuḥ // GarP_1,66.9 //
citrabhānuḥ svabānuśca tāraṇaḥ pārthivo vyayaḥ /
sarvajitsarvadhārī ca virodhī vikṛtiḥ kharaḥ // GarP_1,66.10 //
nandano vijayaścaiva jayo manmathadurmukhau /
hemalambo vilaṃbaśca vikāraḥ śarvarī plavaḥ // GarP_1,66.11 //
śubhakṛcchobhanaḥ krodhī viśvāvamuparābhavau /
plavaṅgaḥ kīlakaḥ saumyaḥ sādhāraṇavirodhakṛt // GarP_1,66.12 //
paridhāvī pramādī ca ānando rākṣaso nalaḥ /
piṅgalaḥ kālasiddhārthau raudrirvai durmatistathā // GarP_1,66.13 //
dundubhī rudhirodgārī raktākṣaḥ krodhano 'kṣayaḥ /
aśobhanāḥ śobhanāśca nāmnaivaite hi vatsarāḥ // GarP_1,66.14 //
kālaṃ vakṣyāmi saṃsiddhyai rudra pañcasvarodayāt /
rājā sā(mā) jā udāsā ca pīḍā mṛtyustathaiva ca // GarP_1,66.15 //
ā ī ū ai au svarāṃśca likhetpañcāgnikoṣṭhake /
ūrdhvatiryaggatai rekhaiḥ ṣaḍvahnikramamāgataiḥ // GarP_1,66.16 //
tithī ekā gnikoṣṭheṣu trayo rājātha sā (mā) jayāḥ /
udāsāmṛtyupīḍāśca kujaḥ somasutaḥ kramāt // GarP_1,66.17 //
guruśukrau ca mandaśca ravicandrau yathoditam /
revatyādimṛgāntāśca ṛkṣāṇi prathamā kalā // GarP_1,66.18 //
pañcapañcānyatra bhāni caitrādya udayastathā /
dvādaśāhairdvayormāsanāmnorādyakṣaraṃ tathā // GarP_1,66.19 //
kalāliṅgā ca yā tiṣṭhetpañcamastasya vai mṛtiḥ /
kalā tithistathā vāro nakṣatraṃ māsameva ca // GarP_1,66.20 //
nāmodayasya pūrvaṃ ca tathā bhavati nānyathā /
oṃ kṣaiṃ (kṣauḥ) śivāya namaḥ // GarP_1,66.21 //
kṣāmādyaṅgaśivāmīkṣā viṣagrahamatirhara /
trailokyamohanaṃ bījaṃ nṛsiṃhasya tu padma(nna)gam // GarP_1,66.22 //
mṛtyuñjayo gaṇo lakṣmī rocanādyaistu lekhitaḥ /
bhūrje tu dhāritāḥ kaṇṭhe bāhau ceti jayādidāḥ // GarP_1,66.23 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jyotiḥ śāstre śālagrāmaṣaṣṭyūbdasvarodayānāṃ nirūpaṇaṃ nāma ṣaṭṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 67
(iti jyotiḥ śāstraṃ samāptam) /
sūta uvāca /
hareḥ śrutvā haro gaurīṃ dehasthaṃ jñānamabravīt // GarP_1,67.1 //
kujo vahnī raviḥ pṛthvī saurirāpaḥ prakīrtitaḥ /
vāyusaṃsthāsthito rāhurdakṣarandhrāvabhāsakaḥ // GarP_1,67.2 //
guruḥ śukrastathā saumyaścandraścaiva caturthakaḥ /
vāmanāḍīṃ tu madhyasthāṃ kārayedātmanastathā // GarP_1,67.3 //
yadācara ilāyuktastadā karmasamācaret /
sthānasevāṃ tathā dhyānaṃ vāṇijyaṃ rājadarśanam // GarP_1,67.4 //
anyāni śubhakarmāṇi kārayeta prayatnataḥ /
dakṣanāḍīpravāhe tu śanirbhaumaśca saihikaḥ // GarP_1,67.5 //
inaścaiva tathāpye pāpānāmudayo bhavet /
śubhāśubhaviveko hi jñāyate tu svarodayāt // GarP_1,67.6 //
dehamadhye sthitā nāḍyo bahurūpāḥ suvistarāḥ /
nābheradhastādyaḥ kandastvaṅkurāstatra nirgatāḥ // GarP_1,67.7 //
dvisaptatisahasrāṇi nābhimadhye vyavasthite /
cakravacca sthitāstāstu sarvāḥ prāṇaharāḥ smṛtāḥ // GarP_1,67.8 //
tāsāṃ madhye trayaḥ śreṣṭhā vāmadakṣaiṇamadhyamāḥ /
vāmā somātmikā proktā dakṣiṇā ravisannibhā // GarP_1,67.9 //
madhyamā ca bhavedagniḥ phalantī kālapūriṇī /
vāmā hyamṛtarūpā ca jagadāpyāyane sthitā // GarP_1,67.10 //
dakṣiṇā raudrabhāgena jagacchoṣayate sadā /
dvayorvāhe tu mṛtyuḥ syātsarvakāryavināśinī // GarP_1,67.11 //
nirgame tu bhavedvāmā praveśe dakṣaiṇā smṛtā /
iḍācāre tathā saumyaṃ candrasūryagatastathā // GarP_1,67.12 //
kārayetkrūra karmāṇi prāṇe piṅgalasaṃsthite /
yātrāyāṃ sarvakāryeṣu viṣāpahāraṇe iḍā // GarP_1,67.13 //
bhojane maithune yuddhe piṅgalā siddhidāyikā /
uccāṭamāraṇādyeṣu karmasveteṣu piṅgalā // GarP_1,67.14 //
maithune caiva saṃgrāme bhojane siddhidāyikā /
śobhaneṣu ca kāryeṣu yātrāyāṃ viṣakarmaṇi // GarP_1,67.15 //
śāntimuktyarthasiddhyai ca iḍā yojyā narādhipaiḥ /
dvābhyāṃ caiva pravāhe ca krūrasaumyavivarjane // GarP_1,67.16 //
viṣavattaṃ tu jānīyātsaṃsmarettu vicakṣaṇaḥ /
saumyādiśubhakāryeṣu lābhādijayajīvite // GarP_1,67.17 //
gamanāgamane caiva vāmā sarvatra pūjitā /
yuddhādibhojane ghāte strīṇāṃ caiva tu saṃgame // GarP_1,67.18 //
praśastā dakṣiṇā nāḍī praveśe kṣudrakarmaṇi /
śubhāśubhāni kāryāṇi lābhālābhau jayājayau // GarP_1,67.19 //
jīvājīvāya yatpṛcchenna sidhyati ca madhyamā /
vāmācāre 'thavā dakṣe pratyaye yatra nāyakaḥ // GarP_1,67.20 //
tanusthaḥ pṛcchate yastu tatra siddhirna saṃśayaḥ /
vaicchando vāmadevastu yadā vahati cātmani // GarP_1,67.21 //
tatra bhāge sthitaḥ pṛcchetsiddhirbhavati niṣphalā /
vāme vā dakṣiṇe vāpi yatra saṃkramate śivā // GarP_1,67.22 //
ghore ghorāṇi kāryāṇi saumye vai madhyamāni ca /
prasthite bhāgato haṃse dvābhyāṃ vai sarvavāhinī // GarP_1,67.23 //
tadā mṛtyuṃ vijānīyādyogī yogaviśāradaḥ /
yatrayatra sthitaḥ pṛcchedvāmadakṣiṇasaṃmukhaḥ // GarP_1,67.24 //
tatratatra samaṃ diśyādvātasyodayanaṃ sadā /
agrato vāmikā śreṣṭhā pṛṣṭhato dakṣiṇā śubhā // GarP_1,67.25 //
vāmena vāmikā proktā dakṣiṇe dakṣiṇā śubhā /
vāme vāmā śubhe caiva dakṣiṇe dakṣiṇā śubhā // GarP_1,67.26 //
jīvo jīvati jīvena yacchūnyaṃ tastvaro bhavet /
yatkiñcitkāryamuddiṣṭaṃ jayādiśubhalakṣaṇam // GarP_1,67.27 //
tatsarvaṃ pūrṇanāḍyāṃ tu jāyate nirvikalpataḥ /
anyanāḍyādiparyantaṃ pakṣatrayamudāhṛtam // GarP_1,67.28 //
yāvatṣaṣṭhī tu pṛcchāyāṃ pūrṇāyāṃ prathamo jayet /
riktāyāṃ tu dvitīyastu kathayettadaśaṅkitaḥ // GarP_1,67.29 //
vāmācārasamo vāyurjāyate karmasiddhidaḥ /
pravṛtte dakṣiṇe mārge viṣame viṣamākṣaram // GarP_1,67.30 //
anyatra vāmavāhe tu nāma vai viṣamākṣaram /
tadāsau jayamāpnoti yodhaḥ saṃgrāmamadhyataḥ // GarP_1,67.31 //
dakṣavātapravāhe tu yadi nāma samākṣaram /
jā(ja) yate nātra sandeho nāḍīmaghye tu lakṣayet // GarP_1,67.32 //
piṅgalāntargate prāṇe śamanīyāhavaṃ jayet /
yāvannāḍyudayaṃ cārastāṃ diśaṃ yāvadāpayet // GarP_1,67.33 //
na dātuṃ jāyate so 'pi nātra kāryā vicāraṇā /
atha saṃgrāmamadhye tu yatra nāḍī sadā vahet // GarP_1,67.34 //
sā diśā jayamāpnoti śūnye bhaṅgaṃ vinirdiśet /
jātacāre jayaṃ vidyānmṛtake mṛtamādiśet // GarP_1,67.35 //
jayaṃ parājayaṃ caiva yo jānāti sa paṇḍitaḥ /
vāme vā dakṣiṇe vāpi yatra sañcarate śivam // GarP_1,67.36 //
kṛtvā tatpadamāpnoti yātrā santataśobhanā /
śaśisūryapravāhe tu sati yuddhaṃ samācaret // GarP_1,67.37 //
yastu pṛcchati tatrasthaḥ sa sādhurjayatidhruvam /
yāṃ diśaṃ vahate vāyustāṃ diśaṃ yāvadājayaḥ // GarP_1,67.38 //
jāyate nātra sandeha handro yadyagrataḥ sthitaḥ /
meṣyādyā daśa yā nāḍyo dakṣiṇā vāma saṃsthitāḥ // GarP_1,67.39 //
caresthire tadvimārge tādṛśetādṛśe kramāt /
nirgame nirgamaṃ yāti saṃgrahe saṃgrahaṃ viduḥ // GarP_1,67.40 //
pṛcchakasya vacaḥ śrutvā ghaṇṭākāreṇa lakṣayet /
vāme vā dakṣiṇe vāpi pañcatattvasthitaḥ śive // GarP_1,67.41 //
ūrdhve 'gniradha āpaśca tiryaksaṃsthaḥ prabhañjanaḥ /
madhye tu pṛthivī jñeyā nabhaḥ sarvatra sarvadā // GarP_1,67.42 //
ūrdhve mṛtyuradhaḥ śāntistiryak coccāṭayetsudhīḥ /
madhye stambhaṃ vijānīyānmokṣaḥ sarvatra sarvage // GarP_1,67.43 //

iti śrīgāruḍemahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe svarodaye śubhāśubhanirūpaṇaṃ nāma saptaṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 68
sūta uvāca /
parikṣāṃ vacmiratnānāṃ balo nāmāsuro 'bhavat /
indrādyā nirjitāstena vijetuṃ tairna śakyate // GarP_1,68.1 //
varavyājena paśutāṃ yācitaḥ sa surairmakhe /
balo dadau sa (sva) paśutāmatisattva surairhataḥ // GarP_1,68.2 //
paśuvatsa viśastastaiḥ svavākyāśaniyantritaḥ /
balo lokoparāya devānāṃ hitakāmyayā // GarP_1,68.3 //
tasya sattvaviśuddhasya viśuddhena ca karmaṇā /
kāyasyāvayavāḥ sarve ratnabījatvamāyayuḥ // GarP_1,68.4 //
devānāmatha yakṣāṇāṃ siddhānāṃ pavanāśinām /
ratnabījaṃsva(jama)yaṃ grāhaḥ sumahānabhavattadā // GarP_1,68.5 //
teṣāṃ tu patatāṃ vegādvimānena vihāyasā /
yadyatpapāta ratnānāṃ bījaṃ kracana kiñcana // GarP_1,68.6 //
mahodadhau sariti vā pavarta kānane 'pi vā /
tattadākaratāṃ yātaṃ sthānamādheyagauravāt // GarP_1,68.7 //
teṣu rakṣoviṣavyālavyādhighnānyaghahāni ca /
prādurbhavanti ratnāni tathaiva viguṇāni ca // GarP_1,68.8 //
vajraṃ muktāmaṇayaḥ sapadmarāgāḥ samarakatāḥ proktāḥ /
api cendranīlamaṇivaravaidūryāḥ puṣparāgāśca // GarP_1,68.9 //
karketanaṃ sapulakaṃ rudhirākhyasamanvitaṃ tathā sphaṭikam /
vidrumamaṇiśca yatnāduddiṣṭaṃ saṃgrahe tajjñaiḥ // GarP_1,68.10 //
ākāravarṇau prathamaṃ guṇadoṣau tatphalaṃ parīkṣā ca /
mūlyaṃ ca ratnakuśalairvijñeyaṃ sarvaśāstrāṇām // GarP_1,68.11 //
kulagneṣūpajāyante yāni copahate 'hani /
dauṣaistānyapiyujyante hīyante guṇasampadā // GarP_1,68.12 //
parīkṣāpariśuddhānāṃ ratnānāṃ pṛthivībhujā /
dhāraṇaṃ saṃgraho vāpi kāryaḥ śriyamabhīpsatā // GarP_1,68.13 //
śāstrajñaḥ kuśalāścāpi ratnabhājaḥ parīkṣakāḥ /
ta eva mūlyamātrāyā vettāraḥ parikīrtitāḥ // GarP_1,68.14 //
mahā prabhāvaṃ vibudhairyasyamādvajramudāhṛtam /
vajrapūrvā parīkṣeyaṃ tato 'smābhiḥ prakīrtyate // GarP_1,68.15 //
tasyāsthileśo nipapāta yeṣu bhuvaḥ pradeśeṣu kathañcideva /
vajrāṇi vajrāyudhanirjigīṣorbhavanti nānākṛtimanti teṣu // GarP_1,68.16 //
haimamātaṅgasaurāṣṭrāḥ pauṇḍrakāliṅgakosalāḥ /
veṇvātaṭāḥ sasauvīrā vajrasyāṣṭa vihārakāḥ // GarP_1,68.17 //
ātāmrā himaśailajāśca śaśibhā veṇvātaṭīyāḥ smṛtāḥ sauvīre tvasitābjameghasadṛśāstābhrāśca saurāṣṭrajāḥ /
kāliṅgāḥ kana kāvadātarucirāḥ pītaprabhāḥ kosale śyāmāḥ puṇḍrabhavā mataṅgaviṣaye nātyantapītaprabhāḥ // GarP_1,68.18 //
atyarthaṃ laghu varṇataśca guṇavatpārśveṣu samyak samaṃrekhābindukalaṅkakākapadakatrāsādibhirvarjitam /
loke 'sminparāmāṇumātramapi yadvajraṃ kraciddṛśyate tasmindevasamāśrayo hyavitathastīkṣṇāgradhāraṃ yadi // GarP_1,68.19 //
vajreṣu varṇayuktyā devānāmapi vigrahaḥ proktaḥ /
varṇebhyaśca vibhāgaḥ kāryo varṇāśrayādeva // GarP_1,68.20 //
haritasitapītapiṅgaśyāmāstāmrāḥ svabhāvato rucirāḥ /
harivaruṇaśakrahutavahapitṛpatimarutāṃ svakā varṇāḥ // GarP_1,68.21 //
viprasya śaṅkhakumudasphaṭikāvadātaḥ syātkṣattriyasya śaśababhruvilocanābhaḥ /
vaiśyasya kāntakadalīdalasannikāśaḥ śūdrasya dhautakaravālasamānadīptiḥ // GarP_1,68.22 //
dvau vajravarṇau pṛthivīpatīnāṃ sadbhiḥ pradiṣṭau na tu sārvajanyau /
yaḥ syājjavāvidrumabhaṅgaśoṇo yo vā haridrārasannikāśaḥ // GarP_1,68.23 //
īśatvātsarvavarṇānāṃ guṇavatsārbavarṇikam /
kāmato dhārayedrājā na tvanyo 'nyatkathañcana // GarP_1,68.24 //
adharottaravṛttayā hi yādṛk syādvarṇasaṅkaraḥ /
tataḥ kaṣṭataro vajravarṇānāṃ saṅkaro mataḥ // GarP_1,68.25 //
na ca mārgavibhāgamātravṛttyā viduṣā vajraparigraho vidheyaḥ /
guṇavadguṇasampadāṃ vibhūtirviparīto vyasanodayasya hetuḥ // GarP_1,68.26 //
ekamapi yasya śṛṅgaṃ vidalitamavalokyate viśīrṇaṃ vā /
guṇavadapi tanna dhāryaṃ vajraṃ śreyo 'rthibhirbhavane // GarP_1,68.27 //
sphuṭitāgnivi śīrṇaśṛṅgadeśaṃ malavarṇaiḥ pṛṣatairupetamadhyam /
na hi vajrabhṛto 'pi vajramāśu śriyamapyāśrayalālasāṃ na kuryāt // GarP_1,68.28 //
yasyaikadeśaḥ kṣatajāvabhāso yadvā bhavellohitavarṇacitram /
na tanna kuryāddhriyamāṇamāśu svacchandamṛtyorapi jīvitāntam // GarP_1,68.29 //
koṭyaḥ pārśvani dhārāśca ṣaḍaṣṭau dvādaśeti ca /
uttuṅgasamatīkṣṇāgrāḥ vajrasyākarajā guṇāḥ // GarP_1,68.30 //
ṣaṭkoṭi śudvamamalaṃ sphuṭatīkṣṇadhāraṃ varṇānvitaṃ laghu supārśvamapetadoṣam /
indrāyudhāṃśuvisṛticchuritāntarikṣamevaṃvidhaṃ bhuvi bhavetsulabhaṃ na vajram // GarP_1,68.31 //
tīkṣṇāgraṃ vimalamapetasarvadoṣaṃ dhatte yaḥ prayatatanuḥ sadaiva vajram /
vṛddhistaṃ pratidinameti yāvadāyuḥ strīsampatsutadhanadhānyagodaśūnām // GarP_1,68.32 //
vyālavahniviṣavyāghrataskarāmbubhayāni ca /
dūrāttasya nivartante karmāṇyātharvaṇāni ca // GarP_1,68.33 //
yadi vajramapetasarvadoṣaṃ bibhṛyāttaṇḍulaviṃśatiṃ gurutve /
maṇiśāstravido vadanti tasya dviguṇaṃ rūpakalakṣamagramūlyam // GarP_1,68.34 //
tribhāgahīnārdhatadardhaśeṣaṃ trayodaśaṃ triṃśadator'ddhabhāgāḥ /
aśītibhāgo 'tha śatāṃśabhāgaḥ sahasrabhāgo 'lpasamānayogaḥ // GarP_1,68.35 //
yattaṇḍulairdvādaśabhiḥ kṛtasya vajrasya mūlyaṃ prathamaṃ pradiṣṭam /
dvābhyāṃ kramādvānimupāgatasya tvekāvamānasya viniścayo 'yam // GarP_1,68.36 //
na cāpi taṇḍulaireva vajrāṇāṃ dharaṇakramaḥ /
aṣṭābhiḥ sarṣapairgairaistaṃṇḍulaṃ parikalpayet // GarP_1,68.37 //
yattu sarvaguṇairyuktaṃ vajraṃ tarati vāriṇi /
ratnavarge samaste 'pi tasya dhāraṇamiṣyate // GarP_1,68.38 //
alpenāpi hi doṣeṇa lakṣyālakṣyeṇa dvaṣitam /
sva (sa) mūlyāddaśamaṃ bhāgaṃ vajraṃ labhati mānavaḥ // GarP_1,68.39 //
prakaṭānekadoṣasya svalpasya mahato 'pi vā /
sva (su) mūlyācchataśo bhāgo vajrasya na vidhīyate // GarP_1,68.40 //
spaṣṭadoṣamalaṅkāre vajraṃ yadyapi dṛśyate /
ratnānāṃ parikarmārthaṃ mūlyaṃ tasya bhavellaghu // GarP_1,68.41 //
prathamaṃ guṇasampadābhyupetaṃ pratibaddhaṃ samupaiti yacca doṣam /
alamābharaṇena tasya rājño guṇahīno 'pi maṇirna bhūṣaṇāya // GarP_1,68.42 //
nāryā vajramadhāryaṃ guṇavadapi sutaprasūtimicchantyā /
anyatra dīrghācipiṭatryaśrādyaguṇairviyuktācca // GarP_1,68.43 //
ayasā puṣparāgeṇa tathā gomedakena ca /
vaidūryasphaṭikābhyāṃ ca kācaiścāpi pṛthagvidhaiḥ // GarP_1,68.44 //
pratirūpāṇi kurvanti vajrasya kuśalā janāḥ /
parīkṣā teṣu kartavyā vidvadbhiḥ suparīkṣakaiḥ // GarP_1,68.45 //
kṣārollekhanaśāṇābhisteṣāṃ kāryaṃ parīkṣaṇam /
pṛthivyāṃ yāni ratnāni ye cānye lohadhātavaḥ // GarP_1,68.46 //
sarvāṇi vilikhedvajraṃ tacca tairna vilikhyate /
gurutā sarvaratnānāṃ gauravādhārakāraṇam // GarP_1,68.47 //
vajre tāṃ vaiparītyena sūrayaḥ paricakṣate /
jātirajātiṃ vilikhati jātiṃ vilikhanti vajrakuruvindāḥ // GarP_1,68.48 //
vajrairvajraṃ vilikhati nānyena vilikhyate vajram /
vajrāṇi muktāmaṇayo ye ca kecana jātayaḥ // GarP_1,68.49 //
na teṣāṃ pratibaddhānāṃ bhā bhavatyūrdhvagāminī /
tiryak kṣatatvātkeṣāñcitkathañcidyadi jāyate /
tiryagvilikhyamānānāṃ sā (sa) pārśveṣu vihanyate // GarP_1,68.50 //
yadyapi viśīrṇakoṭiḥ sabindurekhānvito vivarṇo vā /
tadapi dhanadhānyaputrānkaroti sendrāyudho vajraḥ // GarP_1,68.51 //
saudā minīvisphuritābhirāmaṃ rājā yathoktaṃ kaliśaṃ dadhānaḥ /
parākramākrāntaparapratāpaḥ samastasāmantabhuvaṃ bhunakti // GarP_1,68.52 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ratnatadviśeṣavajraparīkṣaṇādivarṇanaṃ nāmāṣṭaṣaṣṭitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 69
sūta uvāca /
dvipendrajīmūtavarāhaśaṅkhamatsyāhiśuktyudbhavaveṇujāni /
muktāphalāni prathitāni loke teṣāṃ ca śuktyudbhavameva bhūri // GarP_1,69.1 //
tatraiva caikasya hi mūlamātra niviśyate ratnapadasya jātu /
vedhyaṃ tu śuktayudbhavameva teṣāṃ śeṣāṇyavedhyāni vadanti tajjñāḥ // GarP_1,69.2 //
tvaksāranāgendratimiprasūtaṃ yacchaṅkhajaṃ yacca varā hajātam /
prāyo vimuktāni bhavanti bhāsā śastāni māṅgalyatayā tathāpi // GarP_1,69.3 //
yā mauktikānāmiha jātaye 'ṣṭau prakīrtitā ratnaviniścayajñaiḥ /
kambūdbhavaṃ teṣvadhamaṃ pradiṣṭamutpadyate yacca gajendrakumbhāt // GarP_1,69.4 //
svayonimadyacchavitulyavarṇaṃ śāṅkhaṃ bṛhallolaphalapramāṇam /
utpadyate vāraṇakumbhamadhyādāpītavarṇaṃ prabhayā vihīnam // GarP_1,69.5 //
ye kambavaḥ śārṅgamukhāvamarśapītasya śaṅkhapravarasya gotre /
mataṅgajāścāpi viśuddhavaṃśyāste mauktikānāṃ prabhavāḥ pradiṣṭāḥ // GarP_1,69.6 //
utpadyate mauktikameṣu vṛttamāpītavarṇaṃ prabhayā vihīnam /
pāṭhīnapṛṣṭhasya samānavarṇaṃ mīnātsuvṛttaṃ laghu cātisūkṣmam // GarP_1,69.7 //
utpadyate vāricarānaneṣu matsyāśce te madhyacarāḥ payodheḥ /
varāhadaṃṣṭrāprabhavaṃ pradiṣṭaṃ tasyaiva daṃṣṭrāṅkuratulyavarṇam // GarP_1,69.8 //
kracitkathañcitsa bhuvaḥ pradeśe prajāyate sūkararāḍviśiṣṭaḥ /
varṣopalānāṃ samavarṇaśobhaṃ tvaksāraparvaprabhavaṃ pradiṣṭam // GarP_1,69.9 //
te veṇavo divyajanopabhogye sthāne prarohanti na sārvajanye /
bhaujaṃ gamaṃ mīnaviśuddhavṛttaṃ saṃsthānato 'tyujjvalavarṇaśobham // GarP_1,69.10 //
nitāntadhautapravikalpamānanistriṃśadhārāsamavarṇakānti /
prāpyātiratnāni mahāprabhāṇi rājyaṃ śriyaṃ vā mahatīṃ durāpām // GarP_1,69.11 //
tejo 'nvitāḥ puṇyakṛto bhavanti muktāphalasyāhiśirobhavasya /
jijñāsayā ratnadhanaṃ vidhijñaiḥ śubhemuhūrte prayataiḥ prayatnāt // GarP_1,69.12 //
rakṣāvidhānaṃ sumahadvidhāya harmyopariṣṭhaṃ kriyate yadā tat /
tadā mahādundubhimandraghoṣairvidyullatāvisphuritāntarālaiḥ // GarP_1,69.13 //
payodharākrāntivilambinamrairghanairnavairāvriyate 'ntarikṣam /
na taṃ bhujaṅgā na tu yātudhānā na vyādhayo nāpyupasargadoṣāḥ // GarP_1,69.14 //
hiṃsanti yasyāhiśiraḥ samutthaṃ muktāphalaṃ tiṣṭhati kośamadhye /
nābhyeti meghaprabhavaṃ dharitrīṃ vipradgataṃ tadvibudhā haranti // GarP_1,69.15 //
arciḥ prabhānāvṛtadigvibhāgamādityavahuḥ khavibhāvyabimbam /
tejastiraskṛtya hutāśanendunakṣatratārāprabhavaṃ samagram // GarP_1,69.16 //
divā yathā dīrptiṅkaraṃ tathaiva tamo 'vagāḍhāsvapi tanniśāsu /
vicitraratnadyuticārutoyā catuḥ samudrābharaṇopapannā // GarP_1,69.17 //
mūlyaṃ na vā syāditi niścayo me kṛtsnā mahī tasya muvarṇapūrṇā /
hīno 'piyastallabhate kadācidvipākayogānmahataḥ śubhasya // GarP_1,69.18 //
sāpatnyahīnāṃ sa mahīṃ samagrāṃ bhunakti tattiṣṭhati yāvadeva /
na kevalaṃ tacchubhakṛnnṛpasya bhāgyaiḥ prajānāmapi tasya janma // GarP_1,69.19 //
tadyojanānāṃ paritaḥ sahasraṃ sarvānanarthānvimukhī karoti /
nakṣatramāleva divo viśīrṇā dantāvalistasya mahāmurasya // GarP_1,69.20 //
vicitravarṇeṣu viśuddhavarṇā payaḥ su patyuḥ payasāṃ papāta /
sampūrṇacandrāṃśukalāpakāntermāṇipravekasya mahāguṇasya // GarP_1,69.21 //
tacchuktimatsu sthitimāpa bījamāsanpurāpyanyabhavāni yāni /
yasminpradeśe 'mbunidhau papāta sucārumuktāmaṇiratnabījam /
tasminpayastoyadharāvakīrṇaṃ śuktau sthitaṃ mauktikatāmavāpa // GarP_1,69.22 //
saiṃhalikapāralaukikasaurāṣṭrikatāmraparṇapāraśavāḥ /
kauverapāṇḍyahāṭakahemakamityākarāstvaṣṭau // GarP_1,69.23 //
śuktyudbhavaṃ nātinikṛṣṭavarṇaṃ pramāṇasaṃsthānaguṇaprabhābhiḥ /
utpadyate vardhanapārasīkapātālalokāntarasiṃhaleṣu // GarP_1,69.24 //
cintyā na tasyākarajā viśeṣā rūpe pramāṇe ca yateta vidvān /
na ca vyavasthāsti guṇāguṇeṣu sarvatra sarvākṛtayo bhavanti // GarP_1,69.25 //
etasya śuktiprabhasya muktāphalasya cānyena samunmitasya /
mūlyaṃ sahasrāṇi tu rūpakāṇāṃ tribhiḥ śatairapyādhikāni pañca // GarP_1,69.26 //
yanmāṣakārdhena tato vihīnaṃ tatpañcabhāgadvayahīnamūlyam /
yanmāṣakāṃstrīnbibhṛyātsahasre dve tasya mūlyaṃ paramaṃ pradiṣṭam // GarP_1,69.27 //
ardhādhikau dvau vahato 'sya mūlyaṃ tribhiḥ śatairapyadhikaṃ sahasram /
dvimāṣa konmānitagauravasya śatāni cāṣṭau kathitāni mūlyam // GarP_1,69.28 //
ardhādhikaṃ māṣakamunmitasya samaṃ ca viṃśatritayaṃ śatānām /
guñjāśca ṣaḍ dhārayataḥ śate dve mūlyaṃ paraṃ tasya vadanti tajjñāḥ /
adhyardhamunmāna(pa) kṛtaṃ śataṃ syānmūlyaṃ guṇaistasya samanvitasya // GarP_1,69.29 //
yadi ṣoḍaśabhirbhavedanūnandharaṇaṃ tatpravadanti dārvikākhyam /
adhikaṃ daśabhiḥ śataṃ ca mūlyaṃ samavāpnotyapi bāliśasya hastāt // GarP_1,69.30 //
dviguṇairdaśabhirbhavedanūnaṃ dharaṇaṃ tadbhavakaṃ vadanti tajjñāḥ /
navasaptatimāpnuyātsvamūlyaṃ yadi na syādguṇasampadā vihīnam // GarP_1,69.31 //
triṃśatā dharaṇaṃ pūrṇaṃ śikyaṃ tasyeti kīrtyate /
catvāriṃśadbhavettasyāḥ paraṃ mūlyaṃ viniścayaḥ // GarP_1,69.32 //
catvāriṃśadra bhavettasyāstriṃśanmūlyaṃ labhet sā /
pañcāśattu bhavetsomastasya mūlyaṃ tu viṃśatiḥ // GarP_1,69.33 //
ṣaṣṭirnikaraśīrṣaṃ syāttasyā mūlyaṃ caturdaśa /
aśītirnavatiścaiva kūpyeti parikīrtitā /
ekādaśa syānnava ca tayormūlyamanukramāt // GarP_1,69.34 //
ādāya tatsakalameva tato 'nnabhāṇḍaṃ jambīrajātarasayojanayā vipakram /
ghṛṣṭaṃ tato mṛdutanūkṛtapiṇḍamūlaiḥ kuryādyatheṣṭamanu mauktikamāśu viddham // GarP_1,69.35 //
mṛlliptamatsyapuṭamadhyagataṃ tu kṛtvā paścātpacettanu tataśca biḍālapuṭyā /
dugdhe tataḥ payasi taṃ vipacetsudhāyāṃ pakraṃ tato 'pi payasā śucicikraṇena // GarP_1,69.36 //
śuddhaṃ tato vimalavastranigharṣaṇena syānmauktikaṃ vipulasadguṇakāntiyuktam /
vyāḍirjagāda jagatāṃ hi mahāprabhāvaḥ siddho vidagdhahitatatparayā dayāluḥ // GarP_1,69.37 //
śvetakācasamaṃ tāraṃ hemāṃśaśatayojitam /
rasamadhye pradhāryeta mauktikaṃ dehabhūṣaṇam // GarP_1,69.38 //
evaṃ hi siṃhale deśe kurvanti kuśalā janāḥ /
yasminkṛtraimasandehaḥ kracidbhavati mauktike // GarP_1,69.39 //
uṣṇe salavaṇe snehe niśāṃ tadvāsayejjale /
vrīhibhirmardanīyaṃ vā śuṣkavastropaveṣṭitam // GarP_1,69.40 //
yattu nāyāti vaivarṇyaṃ vijñeyaṃ tadakṛtrimam /
sitaṃ pramāṇavatsnigdhaṃ guru svacchaṃ sunirmalam // GarP_1,69.41 //
tejo 'dhikaṃ suvṛttaṃ ca mauktikaṃ guṇavatsmṛtam // GarP_1,69.42 //
pramāṇavadgauravaraśmiyuktaṃ sitaṃ suvṛttaṃ samasūkṣmavedham /
akreturapyāvahati pramodaṃ yanmauktikaṃ tadguṇavatpradiṣṭam // GarP_1,69.43 //
evaṃ samastena guṇodayena yanmauktikaṃ yogamupāgataṃ syāt /
na tasya bhartāramanarthajāta eko 'pi kaścit samupaiti doṣaḥ // GarP_1,69.44 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe muktāphalapramāṇādivarṇanaṃ nāma muktāphalaparīkṣā nāmaikonasaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 70
sūta uvāca /
divākarastasya mahāmahimno mahāsurasyottamaratnabījam /
asṛggṛhītvā carituṃ pratasthe nistriṃśanīlena nabhaḥ sthalena // GarP_1,70.1 //
jettrā surāṇāṃ samareṣvajastraṃ vīryāvalepoddhatamānasena /
laṅkādhipenārdhapathe sametya svarbhānuneva prasabhaṃ niruddhaḥ // GarP_1,70.2 //
tatsiṃhalīcārunitambabimbavikṣo bhitāgādhamahāhradāyām /
pūgadrumābaddhataṭadvayāyāṃ mumoca sūryaḥ sariduttamāyām // GarP_1,70.3 //
tataḥ prabhṛti sā gaṅgā tulyapuṇyaphalodayā /
nāmnā rāvaṇagaṅgeti prathimānamupāgatā // GarP_1,70.4 //
tataḥ prabhṛtyeva ca śarvarīṣu kūlāni ratnairnicitāni tasyāḥ /
suvarṇanārācaśatairivāntarbahiḥ pradīptairniśitāni bhānti // GarP_1,70.5 //
tasyāstaṭepūjjvacārurāgā bhavanti toyeṣu ca padmarāgāḥ /
saugandhikotthāḥ kuruvindajāśca mahāguṇāḥ sphāṭikasaṃprasūtāḥ // GarP_1,70.6 //
bandhū kaguñjāsakalendragopajavāsamāsṛksamavarṇaśobhāḥ /
bhrājiṣṇavo dāḍimabījavarṇāstathāpare kiśukapuṣpabhāsaḥ // GarP_1,70.7 //
khindurapadmotpalakuṅkumānāṃ lākṣārasasyāpi samānavarṇaḥ /
sāṃdre 'pi rāge prabhayā svayaiva bhānti svalakṣyāḥ sphuṭamadhyaśobhāḥ // GarP_1,70.8 //
bhānośca bhāsāmanuvedhayogāmāsādya raśami prakareṇa dūram /
pārśvāni sarvāṇyanurañjayanti guṇāpapannāḥ sphaṭikaprasūtāḥ // GarP_1,70.9 //
kusuṃbhanīlavyatimiśrarāgapratyugraraktābujatulyabhāsaḥ /
tathāpare 'ruṣkarakaṇṭakāripuṣpatviṣo hiṅgulavattviṣo 'nye // GarP_1,70.10 //
cakorapuṃskokilasārasānāṃ netrāvabhāsaśca bhavanti kecit /
anye punaḥ santi ca puṣpitānāṃ tulyatviṣā kokanadottamānām // GarP_1,70.11 //
prabhāvakāṭhinyagurutvayogaiḥ prāyaḥ samānāḥ sphaṭikodbhavānām /
ānīlaraktotpalacārubhāsaḥ saugandhikotthā maṇayo bhavanti // GarP_1,70.12 //
kāmaṃ tu rāgaḥ kuruvindajeṣu sa naiva yādṛk sphaṭikodbhaveṣu /
nirarciṣo 'ntarbahulā bhavanti prabhāvavanto 'pi nataiḥ samastaiḥ // GarP_1,70.13 //
ye tu rāvaṇagaṅgāyāṃ jāyante kuruvindakāḥ /
padmarāgaghanaṃ rāgaṃ bibhrāṇāḥ sphaṭikārciṣaḥ // GarP_1,70.14 //
varṇānuyāyinasteṣā māndhradeśe tathā pare /
na jāyante hi ye kecinmūlyaleśamavāpnuyuḥ // GarP_1,70.15 //
tathaiva sphāṭikotthānāṃ deśe tumburusaṃjñake /
sadharmāṇaḥ prajāyante svalpamūlyā hi te smṛtāḥ // GarP_1,70.16 //
varṇādhikyaṃ gurutvaṃ ca snigdhatā samatācchatā /
arciṣmattā mahattā ca maṇīnāṃ guṇasaṃgrahaḥ // GarP_1,70.17 //
ye karkaracchidramalopadigdhāḥ prabhāvimuktāḥ paruṣā vivarṇāḥ /
na te praśastā maṇayo bhavanti samānato jātiguṇaiḥ samastaiḥ // GarP_1,70.18 //
doṣopasṛṣṭaṃ maṇimaprabodhādvibharti yaḥ kaścana kañcideva /
taṃ śokacintāmayamṛtyuvittanāśādayo doṣagaṇā bhajante // GarP_1,70.19 //
kāmaṃ cārutarāḥ pañca jātīnā pratirūpakāḥ /
vijā tayaḥ prayatnena vidvāṃstanupalakṣayet // GarP_1,70.20 //
kalaśapurodbhavasiṃhalatumburudeśotthamuktapāṇīyāḥ /
śrīpūrṇakāśca sadṛśā vijātayaḥ padmarāgāṇām // GarP_1,70.21 //
tuṣopasargātkalaśābhidhānamātāmrabhāvādapi tumburūttham /
kārṣṇyāttathā siṃhaladeśajātaṃ muktābhidhānaṃ nabhasaḥ svabhāvāt // GarP_1,70.22 //
śrīpūrṇakaṃ dīptivinākṛtatvādvijātiliṅgāśraya eva bhedaḥ /
yastāmrikāṃ puṣyati padmarāgo yogāttuṣāṇāmiva pūrṇamadhyaḥ // GarP_1,70.23 //
strehapradigdhaḥ pratibhāti yaśca yo vā praghṛṣṭaḥ prajahāti dīptim /
ākrāntamūrdhā ca tathāṅgulibhyāṃ yaḥ kālikāṃ pārśvagatāṃ bibharti // GarP_1,70.24 //
saṃprāpya cotkṣipya yathānuvṛttiṃ vibhartiyaḥ sarvaguṇānatīva /
tulyapramāṇasya ca tulyajāteryo vā gurutvena bhavettu tulyaḥ /
prāpyāpi ratnākarajā svajātiṃ lakṣedgurutvena guṇena vidvān // GarP_1,70.25 //
apraṇaśyati sandehe śāṇe tu parilekhayet /
su(sva) jātakasamutthena likhitvāpi parasparam // GarP_1,70.26 //
vajraṃ vā kuruvindaṃ vā vimucyānena kenacit /
nāśakyaṃ lekhanaṃ kartuṃ padmarāgendranīlayoḥ // GarP_1,70.27 //
jātyasya sarve 'pi maṇerna jātu vijātayaḥ santi samānavarṇāḥ /
tathāpi nānākaraṇārthameva bhedaprakāraḥ paramaḥ pradiṣṭaḥ // GarP_1,70.28 //
guṇopapannena sahāvabaddhomeṇirna dhāryo viguṇo hi jātyā /
na kaustubhenāpi sahāvabaddhaṃ vidvānvijātiṃ bibhṛyātkadācit // GarP_1,70.29 //
cāṇḍāla eko 'pi yathā dvijātīnsametya bhūrīnapi hantyayatnāt /
atho maṇīnbhūriguṇopapannāñchakroti viplāvayituṃ vijātyaḥ // GarP_1,70.30 //
sapatnamadhye 'pi kṛtādhivāsaṃ pramādavṛttāvapi vartamānam /
na padmarāgasya mahāguṇasya bhartāramāpatspṛśatīha kācit // GarP_1,70.31 //
doṣopasargaprabhavāśca ye te nopadravāstaṃ samabhidravanti /
guṇaiḥ samuttejitacārurāgaṃ yaḥ padmarāgaṃ prayato bibharti // GarP_1,70.32 //
vajrasya yattaṇḍulasaṃkhyayoktaṃ mūlyaṃ samutpāditagauravasya /
tatpadmarāgasya mahāguṇasya tanmāṣakalpākalitasya mūlyam // GarP_1,70.33 //
varṇadāptyapapannaṃ hi maṇiratnaṃ praśasyate /
tābhyāmīṣadapi bhraṣṭaṃ maṇimūlyātprahīyate // GarP_1,70.34 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe padmarāgaparīkṣaṇaṃ nāma saptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 71
sūta uvāca /
dānavādhipateḥ pittamādāya bhujagādhipaḥ /
dvidhā kurvanniva vyoma satvaraṃ vāsukiryayau // GarP_1,71.1 //
sa tadā svaśiroratnaprabhādīpte nabho 'mbudhau /
rājataḥ samahānekaḥ khaṇḍaseturivābabhau // GarP_1,71.2 //
tataḥ pakṣanipātena saṃharanniva rodasī /
garutmānpannagendrasya prahartumupacakrame // GarP_1,71.3 //
sahasaiva mumoca tatphaṇīndraḥ surasābhyaktaturuṣka (raṣka) pādapāyām /
kalikāghanagandhavāsitā yāṃ varamāṇikyagirerupatyakāyām // GarP_1,71.4 //
tasya prapātasamanantarakālameva tadvadvarālayamatītya ramāsamīpe /
sthānaṃ kṣiterupapayonidhitīralekhaṃyāṃ varamāṇikyagirerupatyakāyām // GarP_1,71.5 //
tatraiva kiñcitpatatastu pittādupetya jagrāha tato garutmān /
mūrchāparītaḥ sahasaiva ghoṇārandhradvayena pramumoca sarvam // GarP_1,71.6 //
tatrākaṭhoraśukakaṇṭhaśirīṣapuṣpakhadyotapṛṣṭhacaraśādvalaśaivalānām /
kalhāraśaṣpakabhujaṅgabhujāñca patraprāptatviṣo marakatāḥ śubhadā bhavanti // GarP_1,71.7 //
tadyatra bhogīndrabhujābhiyuktaṃ papāta pittaṃ ditijādhipasya /
tasyākarasyātitarāṃ sa deśo duḥ khopalabhyaśca guṇaiśca yuktaḥ // GarP_1,71.8 //
tasminmarakatasthāne yatkiñcidupajāyate /
tatsarvaṃ viṣarogāṇāṃ praśamāya prakīrtyate // GarP_1,71.9 //
sarvamantrau ṣadhigaṇairyanna śakyaṃ cikitsitum /
mahāhidaṃṣṭrāprabhavaṃ viṣaṃ tattena śāmyati // GarP_1,71.10 //
anyadapyākare tatra yaddoṣairupavarjitam /
jāyate tatpavitrāṇāmuttamaṃ parikīrtitam // GarP_1,71.11 //
atyantaharitavarṇaṃ komalamarcirvibhedajaṭilaṃ ca /
kāñcanacūrṇasyāntaḥ pūrṇamiva lakṣyate yacca // GarP_1,71.12 //
yuktaṃ saṃsthānaguṇaiḥ samarāgaṃ gauraveṇa na vihīnam /
savituḥ karasaṃsparśācchurayati sarvāśramaṃ dīptyā // GarP_1,71.13 //
hitvā ca haritabhāvaṃ yasyāntarvinihitā bhaveddīptiḥ /
aciraprabhāprabhāhatanavaśādvalasannibhā bhāti // GarP_1,71.14 //
yacca manasaḥ prasādaṃ vidadhāti nirīkṣyamatimātram /
nanmarakataṃ mahāgaṇamiti ratnavidāṃ manovṛttiḥ // GarP_1,71.15 //
varṇasyāti vibhutvādyasyāntaḥ svacchakiraṇaparidhānam /
sāndrasnigdhaviśuddhaṃ komalabarhiprabhādisamakānti // GarP_1,71.16 //
varṇojjvalayā kāntyā sāndrākāro vibhāsayā bhāti /
tadapi guṇavatsaṃjñāmāpnoti hi yādṛśī pūrvam // GarP_1,71.17 //
śabalakaṭhoramalinaṃ rūkṣaṃ pāṣāṇakarkaropetam /
digdhaṃ śilājatunā marakatamevaṃvidhaṃ viguṇam // GarP_1,71.18 //
yatsandhiśoṣitaṃ ratnamanyanmarakatādbhavet /
śreyaskāmairna taddhāryaṃ kretavyaṃ vā katañcana // GarP_1,71.19 //
bhallātakī putrikā ca tadvarṇasamayogataḥ /
maṇermarakatasyaite lakṣaṇīyā vijātayaḥ // GarP_1,71.20 //
kṣaumeṇa vāsasā mṛṣṭā dīptiṃ tyajati putrikā /
lāghavenaiva kācasya śakyā kartuṃ vibhāvanā // GarP_1,71.21 //
kasyacidanekarūpairmarakatamanugacchato 'pi guṇavarṇaiḥ /
bhallātakasyasvanāttu vaiṣamyamupaiti varṇasya // GarP_1,71.22 //
vajrāṇi muktāḥ santyanye ye ca keciddvijātayaḥ /
teṣāṃ nāpratibaddhānāṃ bhā bhavatyūrdhvagāminī // GarP_1,71.23 //
ṛjutvāccaiva keṣāñcitkathañcidupajāyate /
tiryagālocyamānānāṃ sadyaścaiva praṇaśyati // GarP_1,71.24 //
snānācamanajapyeṣu rakṣāmantrakriyāvidhau /
dadadbhirgohiraṇyāni kurvadbhiḥ sādhanāni ca // GarP_1,71.25 //
daivapitryātitheyeṣu gurusaṃpūjaneṣu ca /
bādhyamāneṣu vividhairdeṣajātairviṣodbhavaiḥ // GarP_1,71.26 //
dauṣairhenaṃ guṇairyuktaṃ kāñcanapratiyojitam /
saṃgrāme vicaradbhiśca dhāryaṃ marakataṃ budhaiḥ // GarP_1,71.27 //
tulayā padmarāgasya yanmūlyamupajāyate /
labhate 'bhyadhikaṃ tasmādguṇairmarakataṃ yutam // GarP_1,71.28 //
tathā ca padmarāgāṇāṃ doṣairmūlyaṃ prahīyate /
tato 'syāpyadhikā hānirdeṣairmarakate bhavet // GarP_1,71.29 //

iti śrīgāruḍe mahāpurāṇe purvakhaṇḍe prathamāṃśākhye ācārakāṇḍa marakataparīkṣaṇaṃ nāmaikasaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 72
sūta uvāca /
tatraiva siṃhalavadhūkarapallavāgravyālūnabālalavalīkusumapravāle /
deśe papāta ditijasya nitāntakāntaṃ protphullanīrajasamadyuti netrayugmam // GarP_1,72.1 //
tatpratyayādubhayaśobhanavīcibhāsā vistāriṇī jalanidherupakacchabhūmiḥ /
prodbhinnaketakavanapratibaddhalekhāsāndrendranīlamaṇiratnavatī vibhāti // GarP_1,72.2 //
tatrāsitābjahalabhṛdvasanāsibhṛṅgaśārṅgāyudhāṅgaharakaṇṭhakaṣāyapuṣpaiḥ /
śuṣketaraiśca kusumairgirikarṇikāyāstasmādbhavanti maṇayaḥ sadṛśāvabhāsaḥ // GarP_1,72.3 //
anye prasannapayasaḥ payasāṃ nidhāturambutviṣaḥ śikhigaṇapratimāstathānye /
nīlīrasaprabhavabudvudabhāśca kecitkecittathā samadakokilakaṇṭhabhāsaḥ // GarP_1,72.4 //
ekaprakārā vispaṣṭavarṇaśobhāvabhāsinaḥ /
jāyante maṇayastasminnindranīlā mahāguṇāḥ // GarP_1,72.5 //
mṛtpāṣāṇaśilārandhrakarkarātrāsasaṃyutāḥ /
abhrikāpaṭalacchāyāvarṇadoṣaiśca dūṣitāḥ // GarP_1,72.6 //
tata eva hi jāyante maṇayastatra bhūrayaḥ /
sāstrasambodhitadhiyastānpraśaṃsanti sūrayaḥ // GarP_1,72.7 //
dhāryamāṇasya ye dṛṣṭā padmarāgamaṇerguṇāḥ /
dhāraṇādindranīlasya tānevāpnoti mānavaḥ // GarP_1,72.8 //
yathā ca padmarāgāṇāṃ jātakatritayaṃ bhavet /
indra nīleṣvapi tathā draṣṭavyamaviśeṣataḥ // GarP_1,72.9 //
parīkṣāpratyayairyaiśca padmarāgaḥ parīkṣyate /
ta eva pratyayā dṛṣṭā indranīlamaṇerapi // GarP_1,72.10 //
yāvantaṃ ca kramedagniṃ padmarāgopayogataḥ /
indranīlamaṇistasmātkrameta sumahattaram // GarP_1,72.11 //
tathāpi na parīkṣārthaṃ guṇānāmabhi (ti) vṛddhaye /
maṇiragnau samādheyaḥ kathañcidapi kaścana // GarP_1,72.12 //
agnimātrāparijñāne dāhadoṣaiśca dūpitaḥ /
so 'narthāya bhavedbhartuḥ kartuḥ kārayitustathā // GarP_1,72.13 //
kācotpalakaravīrasphaṭikādyā iha budhaiḥ savaidūryāḥ /
kathitā vijātaya ime sadṛśā maṇinendranīlena // GarP_1,72.14 //
gurubhāvakaṭhinabhāvāveteṣāṃ nityameva vijñeyau /
kācādyathāvaduttaravivardhamānau viśeṣeṇa // GarP_1,72.15 //
indranīlo yathā kaścidvibhartyātāmravarṇatām /
rakṣaṇayau tathā tāmrau karavīrotpalāvubhau // GarP_1,72.16 //
yasya madhyagatā bhāti nīlasyendrāyudhaprabhā /
tamindranīlamityāhurmahārhaṃ bhuvi durlabham // GarP_1,72.17 //
yasya varṇasya bhūyastvātkṣīre śataguṇe sthitaḥ /
nīlatāṃ tannayetsarvaṃ mahānīlaḥ sa ucyate // GarP_1,72.18 //
yatpadmarāgasya mahāguṇasya mūlyaṃ bhavenmāṣasamunmitasya /
tadindranīlasya mahāguṇasya suvarṇa saṃkhyātu litasya mūlyam // GarP_1,72.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe indranīlaparīkṣaṇaṃ nāma dvisaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 73
sūta uvāca /
vaidūryapuṣparāgāṇāṃ karkete bhīṣmake vade /
parīkṣāṃ brahmaṇā proktāṃ vyāsena kathitāṃ dvijā // GarP_1,73.1 //
kalpāntakālakṣubitāmburāśernirhrādakalpādditijasya nādāt /
vaidūryamutpannamanekavarṇaṃ śobhābhirāmadyutivarṇabījam // GarP_1,73.2 //
avidūre vidūrasya gireruttuṅgarodhasaḥ /
kāmabhūtikasīmānamanu tasyākarobhavat // GarP_1,73.3 //
tasya nādasamutthatvādākaraḥ sumahāguṇaḥ /
abhūduttarīto loke lokatrayavibhūṣaṇaḥ // GarP_1,73.4 //
tasyaiva dānavapaterninadānurūpāḥ pravṛṭpayodavaradarśita cārurūpāḥ /
vaidūryaratnamaṇayo vividhāvabhāsastasmātsphuliṅganivahā iva saṃbabhūvuḥ // GarP_1,73.5 //
padmarāgamupādāya maṇivarṇā hi ye kṣitau /
sarvāṃstānvarṇaśobhābhirvaidūryamanugacchati // GarP_1,73.6 //
teṣāṃ pradhānaṃ śikhikaṇṭhanīlaṃ yadvā bhavedveṇudalaprakāśam /
cāṣāgrapakṣapratimaśriyo ye na te praśastā maṇiśāstravidbhiḥ // GarP_1,73.7 //
guṇavānvaidūryamaṇiryojayati svāminaṃ paraṃbhā (bho) gyaiḥ /
doṣairyukto doṣaistasmādyatnātparīkṣeta // GarP_1,73.8 //
girikācaśiśupālau kāca sphaṭikāśca dhūmanirbhinnāḥ /
vaidūryamaṇerete vijātayaḥ sannibhāḥ santi // GarP_1,73.9 //
likhyābhāvātkācaṃ laghubhāvācchaisupālakaṃ vidyāt /
girikācasadīptitvātsphaṭikaṃ varṇojjvalatvena // GarP_1,73.10 //
yadindranīlasya mahāguṇasya suvarṇasaṃkhyākalitasya mūlyam /
tadeva vaidūryamaṇeḥ pradiṣṭaṃ paladvayonmāpi tagauravasya // GarP_1,73.11 //
jātyasya sarve 'pi maṇestu yādṛgvijātayaḥ santi samānavarṇāḥ /
tathāpi nānākaraṇānumeyabhedaprakāraḥ paramaḥ pradiṣṭaḥ // GarP_1,73.12 //
sukhopalakṣyaśca sadā vicāryo hyayaṃ prabhedo viduṣā nareṇa /
snehaprabhedo laghutā mṛdutvaṃ vijātiliṅgaṃ khalu sārvajanyam // GarP_1,73.13 //
kuśalākuśalaiḥ prapūryamāṇāḥ pratibaddhāḥ pratisatkriyāprayogaiḥ /
guṇadoṣasamudbhavaṃ labhante maṇayor'thontaramūlyameva bhinnāḥ // GarP_1,73.14 //
kramaśaḥ samatītavartamānāḥ pratibaddhā maṇibandhakena yatnāt /
yadi nāma bhavanti doṣahīnā maṇayaḥ ṣaḍguṇamāpnuvanti mūlyam // GarP_1,73.15 //
ākarānsamatītānāmudadhestīrasannidhau /
mūlyametanmaṇīnāṃ tu na sarvatra mahītale // GarP_1,73.16 //
suvarṇo manunā yastu proktaḥ ṣoḍaśamāṣakaḥ /
tasya saptatimo bhāgaḥ saṃjñārūpaṃ kariṣyati // GarP_1,73.17 //
śāṇaścaturmāṣamāno māṣakaḥ pañcakṛṣṇalaḥ /
palasya daśamo bhāgo dharaṇaḥ parikīrtitaḥ // GarP_1,73.18 //
itthaṃ maṇividhiḥ prokto ratnānāṃ mūlyaniścaye // GarP_1,73.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaidūryaparīkṣaṇaṃ nāma trisaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 74
sūta uvāca /
patitāyā himādrau tu tvacastasya suradviṣaḥ /
prādurbhavanti tābhyastu puṣpa (ṣya) rāgā mahāguṇāḥ // GarP_1,74.1 //
āpītapāṇḍuruciraḥ pāṣāṇaḥ padmarāgasaṃjñastu /
kaukaṇṭakanāmā syātsa eva yadi lohitāpītaḥ // GarP_1,74.2 //
ālohitastu pītaḥ svacchaḥ kāṣāyakaḥ sa ekoktaḥ /
ānīlaśuklavarṇaḥ snigdhaḥ somāla(na) kaḥ saguṇaḥ // GarP_1,74.3 //
atyantalohito yaḥ sa eva khalu padmarāgasaṃjñaḥ syāt /
api cendranīlasaṃjñaḥ sa eva kathitaḥ sunīlaḥ san // GarP_1,74.4 //
mūlyaṃ vaidūryamaṇeriva gāditaṃ hyasya ratnasāravidā /
dhāraṇaphalaṃ ca tadvatkiṃ tu strīṇāṃ sutaprado bhavati // GarP_1,74.5 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe puṣparāgaparīkṣaṇaṃ nāma catuḥ saptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 75
sūta uvāca /
vāyurnakhāndaityapatergṛhītvā cikṣepa satpadmavaneṣu hṛṣṭaḥ /
tataḥ prasūtaṃ pavanopapannaṃ karketanaṃ pūjayatamaṃ pṛthivyām // GarP_1,75.1 //
varṇena tadrudhirasomamadhuprakāśamātāmrapītadahanojjvalitaṃ vibhāti /
nīlaṃ punaḥ khalu sitaṃ paruṣaṃ vibhinnaṃ vyādhyādidoṣakaraṇena ca tadvibhāti // GarP_1,75.2 //
snigdhā viśuddhāḥ samarāgiṇaśca āpītavarṇā guravo vicitrāḥ /
trāsavraṇavyālavivarjitāśca karketanāste paramaṃ pavitrāḥ // GarP_1,75.3 //
patreṇa kāñcanamayena tu veṣṭayitvā taptaṃ yadā hutavahe bhavati prakāśam /
rogapraṇāśanakaraṃ kalināśanaṃ tadāyuṣkaraṃ kulakaraṃ ca sukhapradaṃ ca // GarP_1,75.4 //
evaṃvidhaṃ bahuguṇaṃ maṇimāvahanti karketanaṃ śubhalaṅkṛtaye narā ye /
te pūjitā bahudhanā bahubāndhavāśca nityojjvalāḥ pramuditā apite bhavanti // GarP_1,75.5 //
eke 'panahya vikṛtākulanīlabhāsaḥ pramlānarāgalulitāḥ kaluṣā virūpāḥ /
tejo 'tidīpti kulapuṣṭivihīnavarṇāḥ karketanasya sadṛśaṃ vapurudvahanti // GarP_1,75.6 //
karketanaṃ yadi parīkṣitavarṇarūpaṃ pratyagrabhāsvaradivākarasuprakāśam /
tasyottamasya maṇi śāstravidāṃ mahimnā tulyaṃ tu mūlyamuditaṃ tulitasya kāryam // GarP_1,75.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe karketanaparīkṣaṇaṃ nāma pañcasaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 76
sūta uvāca /
himavatyuttaradeśe vīryaṃ patitaṃ suradviṣastasya /
saṃprāptamuttamānāmākaratāṃ bhīṣmaratnānām // GarP_1,76.1 //
śuklāḥ śaṅkhābjanibhāḥ syonākasannibhā prabhāvantaḥ /
prabhavanti tatastaruṇā vajranibhā bhīṣmapāṣāṇāḥ // GarP_1,76.2 //
hemādipratibaddhāḥ śuddhamapi śraddhayā vidhatte yaḥ /
bhīṣmamaṇiṃ grīvādiṣu susampadaṃ sa sarvadā labhate // GarP_1,76.3 //
nirīkṣya palāyante yaṃ tamaraṇyanivāsinaḥ samīpa'pi /
dvīpivṛkaśarabhakuñjarasiṃhavyāghrādayo hiṃstrāḥ // GarP_1,76.4 //
tasoyatkalataṣṭatarorbhavati bhayaṃ na cāstīśamupahasanti /
bhīṣmamaṇirguṇayukto samyakprāptāṅgulīkalatratvaḥ // GarP_1,76.5 //
pitṝtarpaṇe pitṝṇāṃ tṛptirbahuvārṣikī bhavati /
śāmyantyadbhutānyapi sarpāṇḍajākhuvṛścikaviṣāṇi /
salilāgnivairitaskarabhayāni bhīmāni naśyanti // GarP_1,76.6 //
śaivalabalāhakābhaṃ puruṣaṃ pītaprabhaṃ prabhāhīnam /
malinadyuti ca vivarṇaṃ dūrātparivarjayetprājñaḥ // GarP_1,76.7 //
mūlyaṃ prakalpyameṣāṃ vibudhavarairdaiśakālavijñānāt /
dūre bhūtānāṃ bahu kiñcinnikaṭaprasūtānām // GarP_1,76.8 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaidūryaparīkṣaṇaṃ nāma ṣaṭsaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 77
sūta uvāca /
puṇyeṣu parvatavareṣu ca nimnagāsu sthānāntareṣu ca tathottaradeśagatvāt /
saṃsthāpitāḥ svanakhabāhugateḥ prakāśaṃ saṃpūjya dānavapatiṃ prathite pradeśe // GarP_1,77.1 //
dāśārṇavāgadara (va) mekalakālagādau guñjāñjanakṣaudramṛṇālavarṇāḥ /
gandharvavahnikadalīsadṛśāvabhāsā ete praśastāḥ pulakāḥ prasūtāḥ // GarP_1,77.2 //
śaṅkhābjabhṛṅgārkavicitrabhaṅgā sūtrairur (vya) petāḥ paramāḥ pavitrāḥ /
maṅgalyayuktā bahubhakticitrā vṛddhipradāste pulakā bhavanti // GarP_1,77.3 //
kākā (ka.)śvarāsabhasṛgālavṛkograrūpairgṛdhraiḥ samāṃsarudhirārdramukhairupetāḥ /
mṛtyupradāśca viduṣā parivarjanīyā mūlyaṃ palasya kathitaṃ ca śatāni pañca // GarP_1,77.4 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pulakaparīkṣaṇaṃ nāma saptasaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 78
sūta uvāca /
hutabhugrūpamādāya dānavasya yathepsitam /
narmadāyāṃ nicikṣepa kiñciddhīnādibhūmiṣu // GarP_1,78.1 //
tatrendragopakalitaṃ śukavakravarṇaṃ saṃsthānataḥ prakaṭapīlusamānamātram /
nānāprakāravihitaṃ rudhirākṣa(khya) ratnamuddhṛtya tasya khalu sarvasamānameva // GarP_1,78.2 //
madhyendupāṇḍuramatīva viśuddhavarṇaṃ taccendranīlasadṛśaṃ paṭalaṃ tule syāt /
saiśvaryabhṛtyajananaṃ kathitaṃ tadaiva pakrañca tatkila bhavetsuravajravarṇam // GarP_1,78.3 //
iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe rudhirākṣaratnaparīkṣaṇaṃ nāmāṣṭasaptatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 79
sūta uvāca /
kāveravindhyayavanacīnanepālabhūmiṣu /
lāṅgalī vyakiranmedo dānavasya prayatnataḥ // GarP_1,79.1 //
ākāśaśuddhaṃ tailākhyamutpannaṃ sphaṭikaṃ tataḥ /
mṛṇālaśaṅkhadhavalaṃ kiñcidvarṇāntaranvitam // GarP_1,79.2 //
na ttulyaṃ hi ratnānāmathavā pāpanāśanam /
saṃskṛtaṃ śilpinā sadyo mūlyaṃ kiñcillabhettataḥ (dā) // GarP_1,79.3 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sphaṭikaparīkṣaṇaṃ nāmaikonāśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 80
sūta uvāca /
ādāya śeṣastasyāntraṃ balasya kelādiṣu /
cikṣepa tatra jāyante vidrumāḥ subhahāguṇāḥ // GarP_1,80.1 //
tatra pradhānaṃ śaśalohitābhaṃ guñjājapāpuṣpanibhaṃ pradiṣṭam /
sunīlakaṃ devakaromakañca sthānāni teṣu prabhavaṃ surāgam // GarP_1,80.2 //
anyatra jātaṃ ca na tatpradhānaṃ mūlyaṃ bhavecchilpiviśeṣayogāt /
prasannaṃ komalaṃ snigdhaṃ surāgaṃ vidrumaṃ hi tat // GarP_1,80.3 //
dhanadhānyakaraṃ loke viṣārtibhayanāśanam /
parīkṣā pulakasyoktā rudhirākṣasya vai maṇeḥ /
sphaṭikasya vidrumasya ratnajñānāya śaunaka ! // GarP_1,80.4 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vidrumaparīkṣaṇaṃ nāmāśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 81
(iti ratnamuktādi parīkṣā samāptā ) /
(atha tīrthakṣetramāhātmyamārabhyate ) /
sūta uvāca /
sarvatīrthāni vakṣyāmi gaṅgā tīrthottamottamā /
sarvatra sulabhā gaṅgātriṣu sthāneṣu durlabhā // GarP_1,81.1 //
gaṅgādvāre prayāge ca gaṅgāsāgarasaṅgame /
prayāgaṃ paramaṃ tīrthaṃ mṛtānāṃ bhuktimuktidam // GarP_1,81.2 //
sevanātkṛtapiṇḍānāṃ pāpajitkāmadaṃ nṛṇām /
vārāṇasī paraṃ tīrthaṃ viśveśo yatra keśavaḥ // GarP_1,81.3 //
kurukṣetraṃ paraṃ tīrthaṃ dānādyairbhuktimuktidam /
prabhāsaṃ paraṃ tīrthaṃ somanātho hi tatra ca // GarP_1,81.4 //
dvārakā ca purī ramyā bhuktimuktipradāyikā /
prācī sarasvatī puṇyā saptasārasvataṃ param // GarP_1,81.5 //
kedāraṃ sarvapāpaghnaṃ sa (śa) mbhalagrāma uttamaḥ /
naranarāyaṇaṃ tīrthaṃ muktyai vadarikāśramaḥ // GarP_1,81.6 //
śvetadvīpaṃ purī māyā naimiṣaṃ puṣkaraṃ param /
ayodhyā cārghyatīrthaṃ tu citrakūṭaṃ ca gomatī // GarP_1,81.7 //
vaināyakaṃ mahītīrthaṃ rāmagiryāśramaṃ param /
kāñcīpurī tuṅgabhadrā śrīśailaṃ setubandhanam // GarP_1,81.8 //
rāmeśvaraṃ paraṃ tīrthaṃ kārtikeyaṃ tathottamam /
bhṛgutuṅgaṃ kāmatīrthaṃ tīrthaṃ cāmarakaṇṭakam // GarP_1,81.9 //
ujjayinyāṃ mahākālaḥ kubjake śrīdharo hariḥ /
kubjāmrakaṃ mahātīrthaṃ kālasarpiśca kāmadam // GarP_1,81.10 //
mahā keśī ca kāverī candrabhāgā vipāśayā /
ekāmraṃ ca tathā tīrthaṃ brahmeśaṃ devakoṭakam // GarP_1,81.11 //
mathurā ca purī ramyā śoṇaścaiva mahānadaḥ /
jambūsaro mahātīrthaṃ tāni tīrthāni viddhi ca // GarP_1,81.12 //
sūryaḥ śivo gaṇo devī hariryatra ca tiṣṭhati /
eteṣu ca yathānyeṣu snānaṃ dānaṃ japastapaḥ // GarP_1,81.13 //
pūjā śrāddhaṃ piṇḍadānaṃ sarvaṃ bhavati cākṣayam /
śālagrāmaṃ sarvadaṃ syāttīrthaṃ paśupateḥ param // GarP_1,81.14 //
kokāmukhaṃ ca vārāhaṃ bhā (bhu) ṇḍīraṃ svāmisaṃjñakam /
lo (mo) hadaṇḍe mahāviṣṇurmandāre madhusūdanaḥ // GarP_1,81.15 //
kāmarūpaṃ mahātīrthaṃ kāmākhyā (kṣā) yatra tiṣṭhati /
puṇḍravardhanakaṃ tīrthaṃ kārtikeyaśca yatra ca // GarP_1,81.16 //
virajastu mahātīrthaṃ tīrthaṃ śrīpuruṣottamam /
mahendraparvatastīrthaṃ kāverī ca nadī parā // GarP_1,81.17 //
godāvarī mahātīrthaṃ payoṣṇī varadā nadī /
vindhyaḥ pāpaharaṃ tīrthaṃ narmadābheda uttamaḥ // GarP_1,81.18 //
gokarṇaṃ paramaṃ tīrthaṃ tīrthaṃ māhiṣmatī purī /
kālañjaraṃ mahītīrthaṃ śuklatīrthamanuttamam // GarP_1,81.19 //
kṛte śauce muktidaṃ ca śārṅgadhārī tadantike /
virajaṃ sarvadaṃ tīrthaṃ svarṇākṣaṃ tīrthamuttamam // GarP_1,81.20 //
nanditīrthaṃ muktidaṃ ca koṭitīrthaphalapradam /
nāsikyaṃ ca mahātīrthaṃ govardhanamataḥ param // GarP_1,81.21 //
kṛṣṇaveṇī bhīmarathī gaṇḍakī yā tvirāvatī /
tīrthaṃ bindusaraḥ puṇyaṃ viṣṇupādodakaṃ param // GarP_1,81.22 //
brahmadhyānaṃ paraṃ tīrthaṃ tīrthamindriyanigrahaḥ /
damastīrthaṃ tu paramaṃ bhavaśuddhiḥ paraṃ tathā // GarP_1,81.23 //
jñānahrade dhyānajale rāgadveṣamalāpahe /
yaḥ snāti mānase tīrthe sa yāti paramāṃ gatim // GarP_1,81.24 //
idaṃ tīrthamidaṃ neti ye narā bhedadarśinaḥ /
teṣāṃ vidhīyate tīrthagamanaṃ tatphalaṃ ca yat // GarP_1,81.25 //
sarvaṃ brahmetiyo 'veti nātīrthaṃ tasya kiñcana /
eteṣu snānadānāni śrāddhaṃ piṇḍamathākṣayam // GarP_1,81.26 //
sarvā nadyaḥ sarvaśailāḥ tīrthaṃ devādisevitam /
śrīraṅgaṃ ca harestīrthaṃ tāpī śreṣṭhā mahānadī // GarP_1,81.27 //
saptagodāvaraṃ tīrthaṃ tīrthaṃ koṇagiriḥ param /
mahālakṣmīryatra devī praṇītā paramā nadī // GarP_1,81.28 //
sahyādrau devadeveśa ekavīraḥ sureśvarī /
gaṅgādvāre kuśāvarte vindhyake nīlaparvate // GarP_1,81.29 //
snātvā kanakhale tīrthe sa bhavenna punarbhave /
sū uvāca /
etānyanyāni tīrthāni snānādyaiḥ sarvadāni hi // GarP_1,81.30 //
śrutvābravīddharerbrahmā vyāsaṃ dakṣādisaṃyutam /
etānyuktvā ca tīrthāni puna stīrthottamottamam /
gayākhyaṃ prāha sarveṣāmakṣayaṃ brahmalokadam // GarP_1,81.31 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sarvatīrtha māhātmyaṃ nāmaikāśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 82
śrīgaṇeśāya namaḥ /
(atha gayāmāhātmyaṃ prārabhyate) /
brahmovāca /
sārātsārataraṃ vyāsa gayābhāhātmya muttamam /
pravakṣyāmi samāsena buktimuktipradaṃ śṛṇu // GarP_1,82.1 //
gayāsuro 'bhavatpūrvaṃ vīryavānparamaḥ sa ca /
tapastapyanmahāghoraṃ sarvabhūtopatāpanam // GarP_1,82.2 //
tattapastāpitā devāstadvadhārthaṃ hariṃ gatāḥ /
śaraṇaṃ harirūce tān bhavitavyaṃ śivātmabhaiḥ // GarP_1,82.3 //
pātyate 'sya mahādeho tathetyūcuḥ surā harim /
kadācicchivapūjārthaṃ kṣīrābdheḥ kamalāni ca // GarP_1,82.4 //
ānīya kīkaṭe deśe śayanaṃ cākarodvalī /
viṣṇumāyāvimūḍho 'sau gadayā viṣṇunā hataḥ // GarP_1,82.5 //
ato gadādharo viṣṇurgayāyāṃ muktidaḥ sthitaḥ /
tasya deho liṅgarūpī sthitaḥ śuddhe pitāmahaḥ // GarP_1,82.6 //
janārdanaśca kāleśastathānyaḥ prapitāmahaḥ /
viṣṇurāhātha maryādāṃ puṇyakṣetraṃ bhaviṣyati // GarP_1,82.7 //
yajñaṃ śrāddhaṃ piṇḍadānaṃ snānādi kurute naraḥ /
sa svargaṃ brahmalokaṃ ca gacchenna narakaṃ naraḥ // GarP_1,82.8 //
gayātīrthaṃ paraṃ jñātvā yāgaṃ cakre pitāmahaḥ /
brāhmaṇānpūjayāmāsa ṛtvigarthamupāgatān // GarP_1,82.9 //
mahānadīṃ rasavahāṃ sṛṣṭvā vāpyādikaṃ tathā /
bhakṣyabhojyaphalādīṃśca kāmadhenuṃ tathāsṛjat // GarP_1,82.10 //
pañcakrośaṃ gayokṣetraṃ brāhmaṇebhyo dadau prabhuḥ /
dharamayāgeṣu lobhāttu pratigṛhya dhanādikam // GarP_1,82.11 //
sthitā viprāstadā śaptā gayāyāṃ brāhmaṇāstataḥ /
mā bhūttraipuruṣī vidyā mā bhūttraipuruṣaṃ dhanam // GarP_1,82.12 //
yuṣmākaṃ syādvārivahā nadī pāṣāṇaparvataḥ /
śaptaistu prārthito brahmānugrahaṃ kṛtavānprabhuḥ // GarP_1,82.13 //
lokāḥ puṇyā gayāyāṃ hi śrāddhino brahmalokagāḥ /
yuṣmānye pūjayiṣyanti tairahaṃ pūjitaḥ sadā // GarP_1,82.14 //
brahmajñānaṃ gayāśrāddhaṃ gogṛhe maraṇaṃ tathā /
vāsaḥ puṃsāṃ kurukṣetre muktireṣā caturvidhā // GarP_1,82.15 //
samudrāḥ saritaḥ sarvā vāpīkūpahradāstathā /
snātukāmā gayātīrthaṃ vyāsa yāsa yānti na saṃśayaḥ // GarP_1,82.16 //
brahmahatyā surāpānaṃ steyaṃ gurvaṅganāgamaḥ /
pāpaṃ tatsaṃgajaṃ sarvaṃ gayāśrāddhādvinaśyati // GarP_1,82.17 //
asaṃskṛtā mṛtā ya ca paśucorahatāśca ye /
sarpadaṣṭā gayāśrāddhānmuktāḥ svargaṃ vrajanti te // GarP_1,82.18 //
gayāyāṃ piṇḍadānena yatphalaṃ labhate naraḥ /
na tacchakyaṃ mayā vaktuṃ varṣakoṭiśatairapi // GarP_1,82.19 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gayāmāhātmyaṃ nāma dvyaśītitamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 83
brahmovāca /
kīkaṭeṣu gayā puṇyā puṇyaṃ rājagṛhaṃ vanam /
viṣayaścāraṇaḥ puṇyo nadīnāṃ ca punaḥ punā // GarP_1,83.1 //
muṇḍapṛṣṭhaṃ tu pūrvasminpaścime dakṣiṇottare /
sārdhakrośadvayaṃ mānaṃ gayāyāṃ parikīrtitam // GarP_1,83.2 //
pañcakrośaṃ gayākṣetraṃ krośamekaṃ gayāśiraḥ /
tatra piṇḍapradānena tṛptirbhavati śāśvatī // GarP_1,83.3 //
nagājjanārdanāccaiva kūpāccottaramānasāt /
etadgayāśiraḥ proktaṃ phalgutīrthaṃ taducyate // GarP_1,83.4 //
tatra piṇḍapradānena pitṝṇā paramā gatiḥ /
gayāgamanamātreṇa pitṝṇāmanṛṇo bhavet // GarP_1,83.5 //
gayāyāṃ pitṛrūpeṇa devadevo janārdanaḥ /
taṃ dṛṣṭvā puṇḍarīkākṣaṃ mucyate vai ṛṇatrayāt // GarP_1,83.6 //
rathamārgaṃ gayatīrthe dṛṣṭvā rudrapadādike /
kāleśvaraṃ ca kedāraṃ pitṝṇāmanṛṇo bhavet // GarP_1,83.7 //
dṛṣṭvā pitāmahaṃ devaṃ sarvapāpaiḥ pramucyate /
lokaṃ tvanāmayaṃ yāti dṛṣṭvā ca prapitāmaham // GarP_1,83.8 //
tathā gadādharaṃ devaṃ mādhavaṃ puruṣottamam /
taṃ praṇamya prayatnena na bhūyo jāyate naraḥ // GarP_1,83.9 //
maunādityaṃ mahātmānaṃ kanakārkaṃ viśeṣataḥ /
dṛṣṭvā maunena viprarṣe pitṝṇāmanṛṇo bhavet // GarP_1,83.10 //
brahmāṇaṃ pūjayitvā ca brahmalokamavāpnuyāt /
gāyattrīṃ pratarutthāya yastu paśyati mānavaḥ // GarP_1,83.11 //
sandhyāṃ kṛtvā prayatnena sarvavedaphalaṃ labhet /
sāvitrīṃ caiva madhyāhne dṛṣṭvā yajñaphalaṃ labhet // GarP_1,83.12 //
sarasvatīṃ ca sāyāhne dṛṣṭvā dānaphalaṃ labhet /
nagasthamīśvaraṃ dṛṣṭvā pitṝṇāmanṛṇo bhavet // GarP_1,83.13 //
dharmāraṇyaṃ dharmamīśaṃ dṛṣṭvā syādṛṇanāśanam /
devaṃ gṛdhreśvaraṃ dṛṣṭvā ko na mucyeta bandhanāt // GarP_1,83.14 //
dhenuṃ dṛṣṭvā dhenuvane brahmalokaṃ nayetpitṝn /
prabhāseśaṃ prabhāse ca dṛṣṭvā yāti parāṃ gatim // GarP_1,83.15 //
koṭīśvaraṃ cāśvamedhaṃ dṛṣṭvā syādṛṇanāśanam /
svargadvāreśvaraṃ dṛṣṭvā mucyate bhavabandhanāt // GarP_1,83.16 //
rāmeśvaraṃ gadālolaṃ dṛṣṭvā svargamavāpnuyāt /
brahmeśvaraṃ tathā dṛṣṭvā mucyate brahmahatyayā // GarP_1,83.17 //
muṇḍapṛṣṭhe mahācaṇḍīṃ dṛṣṭvā kāmānavāpnuyāt /
phalgvīśaṃ phalgucaṇḍīṃ ca gaurīṃ dṛṣṭvā ca maṅgalām // GarP_1,83.18 //
gomakaṃ gopatiṃ devaṃ pitṝṇāmanṛṇo bhavet /
aṅgāreśaṃ ca siddheśaṃ gayādityaṃ gajaṃ tathā // GarP_1,83.19 //
mārkaṇḍeyeśvaraṃ dṛṣṭvā pitṝṇāmanṛṇo bhavet /
phalgutīrthe naraḥ snātvā dṛṣṭvā devaṃ gadādharam // GarP_1,83.20 //
etena kiṃ na paryāptaṃ nṝṇāṃ sukṛtakāriṇām /
brahmalokaṃ prayāntīha puruṣā ekaviṃśatiḥ // GarP_1,83.21 //
pṛthivyāṃ yāni tīrthānī ye samudrāḥ sarāṃsi ca /
phalgutīrthaṃ gamiṣyanti vāramekaṃ dinedine // GarP_1,83.22 //
pṛthivyāṃ ca gayā puṇyā gayāyāṃ ca gayāśiraḥ /
śreṣṭhaṃ tathā phalgutīrthaṃ tanmukhaṃ ca surasya hi // GarP_1,83.23 //
udīci kanakānadyo nābhitīrthaṃ tu madhyataḥ /
puṇyaṃ brahmasadastīrthaṃ snānātsyādbrahmalokadam // GarP_1,83.24 //
kūpe piṇḍādikaṃ kṛtvā pitṝṇāmanṛṇo bhavem /
tathākṣayavaṭe śrāddhī brahmalokaṃ nayetpitṝn // GarP_1,83.25 //
haṃsatīrthe naraḥ snātvā sarvapāpaiḥ pramucyate /
koṭitītha gayālole vaitaraṇyāṃ ca gomake // GarP_1,83.26 //
brahmalokaṃ nayecchrāddhī puruṣānekaviṃśatim /
brahmatīrthe rāmatīrthe āgneye somatīrthake // GarP_1,83.27 //
śrāddhī rāmahrade brahmalokaṃ pitṛkulaṃ nayet /
uttare mānase śrāddhī na bhūyo jāyate naraḥ // GarP_1,83.28 //
dakṣiṇe mānase śrāddhī brahmalokaṃ pitṝnnayet /
svagadvāre naraḥ śrāddhī brahmalokaṃ nayetpitṝn /
bhīṣmatarpaṇakṛttasya kūṭe tārayate pitṝn /
gṛdhreśvare tathā śrāddhī pitṝṇāmanṛṇo bhavet // GarP_1,83.29 //
śrāddhī ca dhenukāraṇye brihmalokaṃ pitṝnnayet /
tiladhenupradaḥ snātvā dṛṣṭvā dhenuṃ na saṃśayaḥ // GarP_1,83.30 //
aindre vā naratīrthe ca vāsave vaiṣṇave tathā /
mahānadyāṃ kṛtaśrāddho brahmalokaṃ nayetpitṝn // GarP_1,83.31 //
gāyattre caiva sāvitre tīrthe sārasvate tathā /
snānasa ndhyātarpaṇakṛcchrāddhī caikottaraṃ śatam // GarP_1,83.32 //
pitṝṇāṃ tu kulaṃ brahmalokaṃ nayati mānavaḥ /
brahmayoniṃ vinirgacchetprayataḥ pitṛmānasaḥ // GarP_1,83.33 //
tarpayitvā pitṝndevānna viśedyonisaṅkaṭe /
tarpaṇe kākajaṅghāryā pitṝṇāṃ tṛptirakṣayā // GarP_1,83.34 //
dharmāraṇye mataṅgasya vāpyāṃ śrāddhāddivaṃ vrajet /
dharmayūpe ca kūpe ta pitṝṇāmanṛṇo bhavet // GarP_1,83.35 //
pramāṇaṃ devatāḥ santu lokapālāśca sākṣiṇaḥ /
mayāgatya mataṅge 'sminpitṝṇāṃ niṣkṛtiḥ kṛtā // GarP_1,83.36 //
rāmatīrthe narāḥ snātvā śrāddhaṃ kṛtvā prabhāsake /
śilāyāṃ pretabhāvātsyurmuktāḥ pitṛgaṇāḥ kila // GarP_1,83.37 //
śrāddhakṛccha svapuṣṭāyāṃ triḥ saphtakuṃlamuddharet /
śrāddhakṛnmuṇḍapṛṣṭhādau brahmalokaṃ nayetpitṝn // GarP_1,83.38 //
gayāyāṃ na hi tatsthānaṃ yatra tīrthaṃ na vidyate /
pañcakrośe gayākṣetre yatra tatra tu piṇḍadaḥ // GarP_1,83.39 //
akṣayaṃ phalamāpnoti brahmalokaṃ nayetpitṝn /
janārdanasya haste tu piṇḍaṃ dadyātsvakaṃ naraḥ // GarP_1,83.40 //
eṣa piṇḍe mayā dattastava haste janārdana ! /
paralokaṃ gate mokṣamakṣayyamupatiṣṭhatām // GarP_1,83.41 //
brahmalokamavāpnoti pitṛbhiḥ saha niścitam /
gayāyāṃ dharmapṛṣṭhe ca sarasi brahmaṇastathā // GarP_1,83.42 //
gayāśīrṣe 'kṣayavaṭe pitṝṇāṃ dattamakṣayam /
dharmāraṇyaṃ dharmapṛṣṭhaṃ dhenukāraṇyameva ca // GarP_1,83.43 //
dṛṣṭvaitāni pitṝṃścāryavaṃśyānviṃśatimuddharet /
brahmāraṇyaṃ mahānadyāḥ paścimo bhāga ucyate // GarP_1,83.44 //
pūrvo brahmasado bhāgo nāgādrirbharatāśramaḥ /
bharatasyāśrame śrāddhī mataṅgasya pade bhavet // GarP_1,83.45 //
gayāśīrṣāddakṣiṇato mahānadyāśca paścime /
tatsmṛtaṃ campakavanaṃ tatra pāṇḍuśilāsti hi // GarP_1,83.46 //
śrāddhī tatra tṛtīyāyāṃ niścirāyāśca maṇḍale /
mahāhrade ca kauśikyāmakṣayaṃ phalamāpnuyāt // GarP_1,83.47 //
vaitaraṇyā ścottaratastṛtīyākhyo jalāśayaḥ /
padāni tatra krauñcasya śrāddhī svargaṃ nayetpitṝn // GarP_1,83.48 //
krauñcapādāduttarato niścirākhyo jalāśayaḥ /
sakṛdyatrābhigamanaṃ sakṛtpiṃṇḍaprapātanam // GarP_1,83.49 //
durlabhaṃ kiṃ punarnityamasminneva vyavasthitiḥ /
mahānadyāmupaspṛśya tarpayetpitṛdevatāḥ // GarP_1,83.50 //
akṣayānprāpnuyāllokānkulaṃ cāpi samuddharet /
sāvitre paṭhyate sandhyā kṛtā syāddvādaśābdikī // GarP_1,83.51 //
śuklakṛṣṇāvubhau pakṣau gayāyāṃ yo vasennaraḥ punātyāsaptamaṃ caiva kulaṃ nāstyatra saṃśayaḥ // GarP_1,83.52 //
gayāyāṃ muṇāḍapṛṣṭhaṃ ca aravindaṃ ca parvatam /
tṛtīyaṃ kraiñcapādaṃ ca dṛṣṭvā pāpaiḥ pramucyate // GarP_1,83.53 //
makare vartamāne ca grahaṇe candrasūryayoḥ /
durlabhaṃ triṣu lokeṣu gayāyāṃ piṇḍapātanam // GarP_1,83.54 //
mahāhrade ca kauśikyāṃ mūlakṣetre viśeṣataḥ /
guhāyāṃ gṛdhrakūṭasya śrāddhaṃ dattaṃ (sapta) mahāphalam // GarP_1,83.55 //
yatra māheśvarī dhārā śrāddhī tatrānṛṇo bhavet /
puṇyāṃ viśālāmāsādya nadīṃ trailokya viśrutām // GarP_1,83.56 //
agniṣṭomamavāpnoti śrāddhī prāyāddivaṃ naraḥ /
śrāddhī māsapade snātvā vājapeyaphalaṃ labhet // GarP_1,83.57 //
ravipāde piṇḍadānātpatitoddhāraṇaṃ bhavet /
gayāstho yo dadātyannaṃ pitarastena putriṇaḥ // GarP_1,83.58 //
kāṅkṣante pitaraḥ putrānnarakādbhayabhīravaḥ /
gayāṃ yāsyati yaḥ kaścitso 'smānsantarayiṣyati // GarP_1,83.59 //
gayāprāptaṃ sutaṃ dṛṣṭvā pitṝṇāmutsavo bhavet /
pabhdyāmapi jalaṃ spṛṣṭvā asmabhyaṃ kila dāsyati // GarP_1,83.60 //
ātmajo vā tathānyo vā gayākūpe yadā tadā /
yannāmnā pātayetpiṇḍaṃ taṃ nayedbrahma śāśvatam // GarP_1,83.61 //
puṇḍarīkaṃ viṣṇulokaṃ prāpnuyātkoṭitīrthagaḥ /
yā sā vaitaraṇī nāma triṣu lokeṣu viśrutā // GarP_1,83.62 //
sāvatīrṇā gayākṣetre pitṝṇāṃ tāraṇāya hi /
śrāddhadaḥ piṇḍadastatra gopradānaṃ karotiyaḥ // GarP_1,83.63 //
ekaviṃśativaṃśyānsa tārayennātra saṃśayaḥ /
yadi putro gayāṃ gacchetkadācitkālaparyaye // GarP_1,83.64 //
tāneva bhojayedviprānbrahmaṇā ye prakalpitāḥ /
teṣāṃ brahmasadaḥ sthānaṃ somapānaṃ tathaiva ca // GarP_1,83.65 //
brahmaprakalpitaṃ sthānaṃ viprā brahmaprakalpapitāḥ /
pūjitaiḥ pūjitāḥ sarve pitṛbhiḥ saha devatāḥ // GarP_1,83.66 //
tarpayettu gayāviprānhavyakavyairvidhānataḥ /
sthānaṃ dehaparityāge gayāyāṃ tu vidhīyate // GarP_1,83.67 //
yaḥ karoti vṛṣotsargaṃ gayākṣetre hyanuttame /
agniṣṭomaśataṃ puṇyaṃ labhate nātra saṃśayaḥ // GarP_1,83.68 //
ātmano 'pi mahābuddhirgayāyāṃ tu tilairvinā /
piṇḍanirvāpaṇaṃ kuryādanyeṣāmapi mānavaḥ // GarP_1,83.69 //
yāvanto jñātayaḥ pitryā bāndhavāḥ suhṛdastathā /
tebhyo vyāsagayābhūmau piṇḍo deyo vidhānataḥ // GarP_1,83.70 //
rāmatīrthe naraḥ snātvā gośatasyāpnuyātphalam /
mataṅgavāpyāṃ snātvā ca gosahasraphalaṃ labhet // GarP_1,83.71 //
niścirāsaṃgame snātvā brahmalokaṃ nayetpitṝn /
vasiṣṭhasyāśrame snātvā vājapeyaṃ ca vindati // GarP_1,83.72 //
mahākauśyāṃ samāvāsādaśvamedhaphalaṃ labhet /
pitāmahasya sarasaḥ prasṛtā lokapāvanī // GarP_1,83.73 //
samīpe tvagnidhāreti viśrutā kapilā hi sā /
agniṣṭomaphalaṃ śrāddhī snātvātra kṛtakṛtyatā // GarP_1,83.74 //
śrāddhī kumāradhārāyāmaśvamedhaphalaṃ labhet /
kumāramabhigamyātha natvā muktimavāpnuyāt // GarP_1,83.75 //
somakuṇḍe naraḥ snātvā somalokaṃ ca gacchati /
saṃvartasya naro vāpyāṃ subhagaḥ syāttu piṇḍadaḥ // GarP_1,83.76 //
dhautapāpo naro yāti pretakuṇḍe ca piṇḍadaḥ /
devanadyāṃ lelihāne mathane jānugartake // GarP_1,83.77 //
evamādiṣu tīrtheṣu piṇḍadastārayetpitṝn /
natvā devānvasiṣṭheśaprabhṛtīnṛṇasaṃkṣayam // GarP_1,83.78 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gayāmāhātmyaṃ nāma tryaśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 84
brahmovāca /
udyatastu gayāṃ gantuṃ śrāddhaṃ kṛtvā vidhānataḥ /
vidhāya kārpaṭīviṣaṃ grāmasyāpi pradakṣiṇam // GarP_1,84.1 //
tato grāmāntaraṃ gatvā śrāddhaśeṣasya bhojanam /
kṛtvā pradakṣiṇaṃ gacchetpratigrahavivarjitaḥ // GarP_1,84.2 //
gṛhāccalitamātrasya gayāyāṃ gamanaṃ prati /
svargārohaṇasopānaṃ pitṝṇāṃ tu padepade // GarP_1,84.3 //
muṇḍanaṃ copavāsaśca sarvatīrtheṣvayaṃ vidhiḥ /
varjayitvā kurukṣetraṃ viśālāṃ virajāṃ gayām // GarP_1,84.4 //
divā ca sarvadā rātrau gayāyāṃ śrāddhakṛdbhavet /
vārāṇasyāṃ kṛtaṃ śrāddhaṃ tīrthe śoṇanade tathā // GarP_1,84.5 //
punaḥ punāmahānadyāṃ śrāddhī svargaṃ pitṝnnayet /
uttaraṃ mānasaṃ gatvā siddhiṃ prāpnotyanuttamām // GarP_1,84.6 //
tasminnivartayecchrāddhaṃ snānaṃ caiva nivartayet /
kāmānsa labhate divyānmokṣopāyaṃ ca sarvaśaḥ // GarP_1,84.7 //
dakṣiṇaṃ mānasaṃ gatvā maunī piṇḍādi kārayet /
ṛṇatrayāpākaraṇaṃ labheddakṣiṇamānase // GarP_1,84.8 //
siddhānāṃ prītijananaiḥ pāpānāṃ ca bhayaṅkaraiḥ /
lelihānairmahāghorairakṣataiḥ pannagottamaiḥ // GarP_1,84.9 //
nāmnā kanakhalaṃ tīrthaṃ triṣu lokeṣu viśrutam /
udīcyāṃ muṇḍapṛṣṭhasya devarṣigaṇasevitam // GarP_1,84.10 //
tatra snātvā divaṃ yāti śrāddhaṃ dattamathākṣayam /
sūryaṃ natvā tvidaṃ kuryātkṛtapiṇḍādisatkriyaḥ // GarP_1,84.11 //
kavyavāhastathā somo yamaścaivāryamā tathā /
agniṣvāttā barhiṣadaḥ somapāḥ pidṛdevatāḥ // GarP_1,84.12 //
āgacchantu mahābhāgā yuṣamābhī rakṣitāstviha /
madīyāḥ pitaro ye ca kule jātāḥ sanābhayaḥ // GarP_1,84.13 //
teṣāṃ piṇḍapradānārthamāgato 'smi gayāmimām /
kṛtapiṇḍaḥ phalgutīrthe paśyaiddevaṃ pitāmaham // GarP_1,84.14 //
gadādharaṃ tataḥ paśyetpitṝṇāmanṛṇāmanṛṇo bhavet /
phalgutīrthe naraḥ snātvā dṛṣṭvā devaṃ gadādharam // GarP_1,84.15 //
ātmānaṃ tārayetsadyo daśa pūrvāndaśāparān /
prathamehnividhiḥ prokto dvitīyadivase vrajet // GarP_1,84.16 //
dharmāraṇyaṃ mataṅgasya vāpyāṃ piṇḍādikṛdbhavet /
dharmāraṇyaṃ samāsādya vājapeyaphalaṃ labhet // GarP_1,84.17 //
rājasūyāśvamedhābhyāṃ phalaṃ syādbrahmatīrthake /
śrāddhaṃ piṇḍodakaṃ kāryaṃ madhye vai kūpayūpayoḥ // GarP_1,84.18 //
kūpodakena tatkāryaṃ pitṝṇāṃ dattamakṣayam /
tṛtīye 'bahni brahmasado gatvā snātvātha tarpaṇam // GarP_1,84.19 //
kṛtvā śrāddhādikaṃ piṇḍaṃ madhye vai yūpakūpayoḥ /
gopracārasamīpasthā ābrahma brahmakalpitāḥ // GarP_1,84.20 //
teṣā sevanamātreṇa pitaro mokṣagāminaḥ /
yūpaṃ pradakṣiṇīkṛtya vājapeyaphalaṃ labhet // GarP_1,84.21 //
phalgutīrthe caturthe 'hini snātvā devāditarpaṇam /
kṛtvā śrāddhaṅgayāśīrṣe kuryādrudrapadādiṣu // GarP_1,84.22 //
piṇāḍāndehimukhe vyāse pañcāgnau ca padatraye /
sūryendukārtikeyeṣu kṛtaṃ śrāddhaṃ tathākṣayam // GarP_1,84.23 //
śrāddhaṃ tu navadevatyaṃ kuryāddvādaśadaivatam /
anvaṣṭakāsu vṛddhau ca gayāyāṃ mṛtavāsare // GarP_1,84.24 //
atra mātuḥ pṛthak śrāddhamanyatra patinā saha /
snātvā daśāśvamedhe tu dṛṣṭvā devaṃ pitāmaham // GarP_1,84.25 //
rudrapādaṃ naraḥ spṛṣṭvā na cehāvartate punaḥ /
trirvittapūrṇāṃ pṛthivīṃ dattvā yatphalamāpnuyāt // GarP_1,84.26 //
sa tatphalamavāpnoti kṛtvā śrāddhaṃ gayāśire /
śamīpatrapramāṇena piṇḍaṃ dadyādgayāśire // GarP_1,84.27 //
pitaro yānti devatvaṃ nātra kāryā vicāraṇā /
muṇḍapṛṣṭe padaṃ nyastaṃ mahādevena dhīmatā // GarP_1,84.28 //
alpena tapasā tatra mahāpuṇyamavāpnuyāt /
gayāśīrṣe tu yaḥ piṇḍānnāmnā yeṣāṃ tu nirvapet // GarP_1,84.29 //
narakasthā divaṃ yānti svargasthā mokṣamāpnuyuḥ /
pañcame 'hni gandālole snātvā vaṭatale tataḥ // GarP_1,84.30 //
piṇḍāndadyātpitṝṇāṃ ca sakalaṃ tārayetkulam /
vaṭamūlaṃ samāsādya śākenoṣṇodakena vā // GarP_1,84.31 //
ekasmin bhojite vipra koṭirbhavati bhojitāḥ /
kṛte śrāddhe 'kṣayavaṭe dṛṣṭvā ca prapitāmaham // GarP_1,84.32 //
akṣayāllaṃbhate lokānkulānāmuddharecchatam /
eṣṭavyā bahavaḥ puttrā yadyeko 'pi gayāṃ vrajet // GarP_1,84.33 //
yajeta vāśvamedhena nīlaṃ vā vṛṣamutsṛjet /
pretaḥ kaścitsamuddiśya vaṇijaṃ kañcidabravīt // GarP_1,84.34 //
mama nāmnā gayāśīrṣe piṇḍanirvapaṇaṃ kuru /
pretabhāvādvimuktaḥ syāṃsvargado dātureva ca // GarP_1,84.35 //
śrutvā vaṇiggayāśīrṣa pretarājāya piṇḍakam /
pradadāvanujaiḥ sārdhaṃ svapitṛbhyastato dadau // GarP_1,84.36 //
sarve muktā viśālo 'pi saputro 'bhucca piṇḍadaḥ /
viśālāyāṃ viśālo 'bhūdrājaputrobravīddvijān // GarP_1,84.37 //
kathaṃ putrādayaḥ syurme viprāścoturviśālakam /
gayāyāṃ piṇḍadānena tava sarvaṃ bhaviṣyati // GarP_1,84.38 //
viśālo 'tha gayāśīrṣa piṇḍado 'bhūcca putravān /
dṛṣṭvākāśe sitaṃ raktaṃ kṛṣṇaṃ puruṣamabravīt // GarP_1,84.39 //
ke yūyaṃ teṣu caivaikaḥ sitaḥ proce viśālakam /
ahaṃ sitaste janaka indralokaṃ gataḥ śabham // GarP_1,84.40 //
mama putra pitā rakto brahmahā pāpakṛtparam /
ayaṃ pitāmahaḥ kṛṣṇa ṛṣayo 'nena ghātitāḥ // GarP_1,84.41 //
avīciṃ narakaṃ prāptau muktau jātau ca piṇḍada /
muktīkṛtāstataḥ sarve vrajāmaḥ svargamuttamam // GarP_1,84.42 //
kṛtakṛtyo viśālo 'pi rājyaṃ kṛtvā divaṃ yayau /
ye 'smatkule tu pitaro luptapiṇḍodakakriyāḥ // GarP_1,84.43 //
ye cāpyakṛtacūḍāstu ye ca garbhādviniḥsṛtāḥ /
yeṣāṃ dāho na kriyāca ye 'gnidagdhāstathāpare // GarP_1,84.44 //
bhūmau dattena tṛpyantu tṛptā yāntu parāṃ gatim /
pitā pitāmahaścaiva tathaiva prapitāmahaḥ // GarP_1,84.45 //
mātā pitāmahī caiva tathaiva prapitāmahī /
tathā mātāmahaścaiva pramātāmaha eva ca // GarP_1,84.46 //
vṛddhapramātāmahaśca tathā mātāmahī param /
pramātāmahī tathā vṛddhapramātāmahīti vai // GarP_1,84.47 //
anyeṣāṃ caiva piṇḍo 'yamakṣayyamupatiṣṭhatām // GarP_1,84.48 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gayāmāhātmyaṃ nāma caturaśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 85
brahmovāca /
snātvā pretaśilādau tu varuṇāsthāmṛtena ca /
piṇḍaṃ dadyādimairmantrairāvāhya ca pitṝnparān // GarP_1,85.1 //
asmatkule mṛtā ye ca gatiryeṣāṃ na vidyate /
āvāhayiṣyetānsarvān darbhapṛṣṭhe tilodakaiḥ // GarP_1,85.2 //
pitavaṃśe mṛtā ye ca mātṛvaṃśe ca ye mṛtāḥ /
taṣāmuddharaṇārthāye imaṃ piṇḍe dadāmyaham // GarP_1,85.3 //
mātāmahakule ye ca gatiryeṣāṃ na vidyate /
teṣāmuddharaṇārthāya imaṃ piṇḍaṃ dadāmyaham // GarP_1,85.4 //
ajātadantā ye kecidye ca garbhe prapīḍitāḥ /
teṣāmuddharaṇārthāya ima piṇḍaṃ dadāmyaham // GarP_1,85.5 //
bandhuvargāśca ye kecinnāmagotravivarjitāḥ /
svagotre paragotre vā gatiryeṣāṃ na vidyate /
teṣāmuddharaṇārthāya ima piṇḍaṃ dadāmyaham // GarP_1,85.6 //
udbandhanamṛtā ye ca viṣaśastrahatāśca ye /
ātmopaghātino ye ca tebhyaḥ piṇḍaṃ dadāmyaham // GarP_1,85.7 //
agnidāhe mṛtā ye ca siṃhavyāghrahatāścaye /
daṃṣṭribhiḥ śṛṅgibhirvāpi teṣāṃ piṇḍaṃ dadāmyaham // GarP_1,85.8 //
agnidagdhāśca ye kecinnāgnidagdhāstathāpare /
vidyuccaurahatā ye ca tebhyaḥ piṇḍaṃ dadāmyaham // GarP_1,85.9 //
raurave cāndhatāmistre kālasūtre ca ye gatāḥ /
teṣāmuddharaṇārthāya imaṃ piṇḍaṃ dadāmyaham // GarP_1,85.10 //
asipatravane ghore kaṃbhīpāke ca ye gatāḥ /
teṣāmuddharaṇārthāya iṃ piṇḍaṃ dadāmyaham // GarP_1,85.11 //
anyeṣāṃ yātanā sthānāṃ pretalokanivāsinām /
teṣāmuddharaṇārthāya ima piṇḍaṃ dadāmyaham // GarP_1,85.12 //

puśuyoniṃ gatā ye ca pakṣikīṭasarīsṛpāḥ /
athavā vṛkṣayoni sthāstebhyaḥ piṇḍaṃ dadāmyaham // GarP_1,85.13 //
asaṃkhyayātanāsaṃsthā ye nītā yamaśāsanaiḥ /
teṣāmuddharaṇārthāya imaṃ piṇḍaṃ dadāmyaham // GarP_1,85.14 //
jātyantarasahasreṣu bhramanti svena karmaṇā /
mānuṣyaṃ durlabhaṃ yeṣāṃ tebhyaḥ piṇḍaṃ dadāmyaham // GarP_1,85.15 //
ye bāndhavābāndhavā vā ye 'nyajanmani bāndhavāḥ /
te sarvetṛptimāyāntu piṇḍadānena sarvadā // GarP_1,85.16 //
ye kecitpretarūpeṇa vartante pitaro mama /
te sarve tṛptimāyāntu piṇḍadānena sarvadā // GarP_1,85.17 //
ye me pitṛkule jātāḥ kule mātustathaiva ca /
guruśvaśurabandhūnāṃ ye cānye bāndhavā mṛtāḥ // GarP_1,85.18 //
ye me kule luptapiṇḍāḥ puttradāravivarjitāḥ /
kriyālo pahatā ye ca jātyandhāḥ paṅgavastathā // GarP_1,85.19 //
virūpā āmagarbhāśca jñātājñātāḥ kule mama /
teṣāṃ piṇḍaṃ mayā dattamakṣayyamupatiṣṭhatām // GarP_1,85.20 //
sākṣiṇaḥ santu me devā brahmeśānādayastathā /
maya gayāṃ samāsādya pitṝṇāṃ niṣkatiḥ kṛtā // GarP_1,85.21 //
āgato 'haṃ gayāṃ deva ! pitṛkārye gadādhara /
tanme sākṣī bhavatvadya anṛṇo 'hamṛṇatrayāt // GarP_1,85.22 //
mahānadī brahmasaro 'kṣayo vaṭaḥ prabhāsamudyantamaho? gayāśiraḥ /
sarasvatīdharmakadhenupṛṣṭhā ete kurukṣetragatā gayāyām // GarP_1,85.23 //

iti śrīgāruḍe mahāpurāṇe purvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gayāmāhātmyaṃ nāma pañcāśītitamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 86
brahmovāca /
yeyaṃ pretaśilā khyātā gayāyāṃ sā tridhā sthitā /
prabhāse pretakuṇḍe ca gayāsuraśirasyapi // GarP_1,86.1 //
dharmeṇa dhāritā bhūtyai sarvadevamayī śilā /
pretatvaṃ ye gatā nṝṇāṃ mitrādyā bāndhavādayaḥ // GarP_1,86.2 //
teṣāmuddharaṇārthāya yataḥ pretaśilā śubhā /
ato 'tra munayo bhūpā rājapatnyādayaḥ sadā // GarP_1,86.3 //
tasyāṃ śilāyāṃ śrāddhādikartāro brahmalokagāḥ /
gayāsurasya yanmuṇḍaṃ tasya pṛṣṭhe śilā yataḥ // GarP_1,86.4 //
muṇāḍapṛṣṭho giristasmātsarvadevamayo hyayam /
muṇḍapṛṣṭhasya pādeṣu yato brahmasaromukhāḥ // GarP_1,86.5 //
aravindavanaṃ teṣu tena caivopalakṣitaḥ /
aravindo girirnāma krauñcapādāṅkito yataḥ // GarP_1,86.6 //
tasmā dgiriḥ kraiñcapādaḥ pitṝṇāṃ brahmalokadaḥ /
gadādharādayo devā ādyā ādau vyavasthitāḥ // GarP_1,86.7 //
śilārūpeṇa cāvyaktāstasmāddevamayī śilā /
gayā śiraśchādayitvā gurutvādāsthitā śilā // GarP_1,86.8 //
kālāntareṇa vyaktaścasthita ādigadādharaḥ /
mahārudrādidevaistu ānādinidhano hariḥ // GarP_1,86.9 //
dharma saṃrakṣaṇārthāya adharmādivinaṣṭaye /
daityarākṣasanāśārthaṃ matsyaḥ pūrvaṃ yathābhavat // GarP_1,86.10 //
kūrmo varāho nṛharirvāmano rāma ūrjitaḥ /
yathā dāśarathī rāmaḥ kṛṣṇobuddho 'tha kalkyapi // GarP_1,86.11 //
tathā vyakto 'vyaktarūpī āsīdādirgadādharaḥ /
ādirādau pūjito 'tra devairbrahmādibhiryataḥ // GarP_1,86.12 //
pādyādyairgandhapuṣpādyairata ādigadādharaḥ /
gadādharaṃ suraiḥ sārdhamādyaṃ gatvā dadāti yaḥ // GarP_1,86.13 //
arghyaṃ pātraṃ ca pādyaṃ ca gandhapuṣpaṃ ca dhūpakam /
dīpaṃ naivaidyamutkaṣṭaṃ mālyāni vividhāni ca // GarP_1,86.14 //
vastrāṇi mukuṭaṃ ghaṇṭā cāmaraṃ prekṣaṇīyakam /
alaṅkārādikaṃ piṇḍamannadānādikaṃ tathā // GarP_1,86.15 //
teṣāṃ tāvaddhanaṃ dhānyamāyurāro gyasampadaḥ /
puttrādisantatiśreyovidyārthaṃ kāma īpsitaḥ // GarP_1,86.16 //
bhāryā svargādivāsaśca svargādāgatya rājyakam /
kulīnaḥ sattvasampanno raṇe marditaśātravanaḥ // GarP_1,86.17 //
vadhabandhavinirmuktaścānte mokṣamavāpnuyāt /
śrāddhapiṇḍādikartāraḥ pitṛbhirbrahmalokagāḥ // GarP_1,86.18 //
jagannāthaṃ ye 'pcayanti subhadrāṃ balabhadrakam /
jñānaṃ prāpya śriyaṃ putrānvrajanti puruṣottamam // GarP_1,86.19 //
puruṣottamarājasya sūryasya ca gaṇasya ca /
puratastatra piṇḍādi pitṝṇāṃ brihmalokadaḥ // GarP_1,86.20 //
natvā kapardivighneśaṃ sarvavighnaiḥ pramucyate /
kārtikeyaṃ pūjayitvā brahmalokamavāpnuyāt // GarP_1,86.21 //
dvādaśādityamabhyarcya sarvarogaiḥ pramucyate /
vaiśvānaraṃ samabhyarcya uttamāṃ dīptimāpnuyāt // GarP_1,86.22 //
revantaṃ pūjayitvātha aśvānāpnotyanuttamān /
abhyarcyendraṃ mahaiśvaryaṃ gaurīṃ saubhāgyamāpnuyāt // GarP_1,86.23 //
vidyāṃ sarasvatīṃ prārcya lakṣmīṃ saṃpūjya ca śriyam /
garuḍaṃ ca samabhyarcya vighnavṛndātpramucyate // GarP_1,86.24 //
kṣetrapālaṃ samabhyarcya grahavṛndaiḥ pramucyate /
muṇḍapṛṣṭhaṃ samabhyarcya sarvakāmamavāpnuyāt // GarP_1,86.25 //
nāgāṣṭakaṃ samabhyarcya nāgadaṣṭo vimucyate /
brahmāṇaṃ pūjayitvā ca brahmalokamavāpnuyāt // GarP_1,86.26 //
balabhadraṃ samabhyarcya balārogyamavāpnuyāt /
subhadrāṃ pūjayitvā tu saubhāgyaṃ paramāpnuyāt // GarP_1,86.27 //
sarvānkāmānavāpnoti saṃpūjya puruṣottamam /
nārāyaṇaṃ tu saṃpūjya narāṇāmadhipo bhavet // GarP_1,86.28 //
spṛṣṭvā natvā nārasiṃhaṃ saṃgrāme vijayī bhavet /
varāhaṃ pūjayitvā tu bhūmirājyamavāpnuyāt // GarP_1,86.29 //
mālāvidyādharau spaṣṭvā vidyādharapadaṃ labhet /
sarvānkāmānavāpnoti saṃpūjyādigadādharam // GarP_1,86.30 //
somanāthaṃ samabhyarcya śivalokamavāpnuyāt /
rudreśvaraṃ namaskṛtya rudraloke mahīyate // GarP_1,86.31 //
rāmeśvaraṃ naro natvā rāmavatsupriyo bhavet /
brahmeśvaraṃ naraḥ stutvā brahmalokāya kalpyate // GarP_1,86.32 //
kāleśvaraṃ samabhyarcya naraḥ kālañjayo bhavet /
kedāraṃ pūjayitvā tu śivaloke mahīyate // GarP_1,86.33 //
siddheśvaraṃ ca saṃpūjya siddho brahmapuraṃ vrajet /
ādyai rudrādibhiḥ sārdhaṃ dṛṣṭvā hyādigadādharam // GarP_1,86.34 //
kulānāṃ śatamuddhṛtya nayedbrahmapuraṃ naraḥ /
dharmārtho prāpnuyāddharmamarthārtho cārthamāpnuyāt // GarP_1,86.35 //
kāmānsaṃprāpnuyātkāmī mokṣārtho mokṣamāpnuyāt /
rājyārtho rājyamāpnoti śāntyartho śāntimāpnuyāt // GarP_1,86.36 //
sarvārtho sarvamāpnoti saṃpūjyādigadādharam /
putrānputrārthinī strī ca saubhāgyaṃ ca tadarthinī // GarP_1,86.37 //
vaṃśārthinī ca vaṃśānvai prāpyārcyādigadādharam /
śrāddhena piṇḍadānena annadānena vāridaḥ // GarP_1,86.38 //
brahmalokamavāpnoti saṃpūjyādigadādharam /
pṛthivyāṃ sarvatīrthebhyo yathā śreṣṭhā gayā purī // GarP_1,86.39 //
tathā śilādirūpaśca śreṣṭhaścaiva gadādharaḥ /
tasmindṛṣṭe śilā dṛṣṭā yataḥ sarvaṃ gadādharaḥ // GarP_1,86.40 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gayāmāhātmyaṃ nāma ṣaḍaśītitamo 'dhyāyaḥ
(iti gayāmāhātmyaṃ samāptam) /


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 87
hariruvāca /
caturdaśa manūnvakṣye tatsutāśca sukādikān /
manuḥ svāyambhuvaḥ pūrvamagnighrādyāśca tatsutāḥ // GarP_1,87.1 //
marīciratryaṅgirasau pulastyaḥ pulahaḥ kratuḥ /
vasiṣṭhaśca mahātejā ṛṣayaḥ saptakīrtitāḥ // GarP_1,87.2 //
jayākhyāśācamitākhyāśca śukrā yāmāstathaiva ca /
gaṇā dvādaśakāścaiti catvāraḥ somapāyinaḥ // GarP_1,87.3 //
viśvabhugvāmadevendro bāṣkalistadarirhyabhūt /
sa hato viṣṇunā daityaścakreṇa sumahātmanā // GarP_1,87.4 //
manuḥ svārociṣaścātha tatputro maṇḍaleśvaraḥ /
citrako vinataścaiva karṇānto vidyuto raviḥ // GarP_1,87.5 //
bṛhadguṇo nabhaścaiva mahābalaparākramaḥ /
ūrja stambastathā prāṇa ṛṣabho niścala (ra) stathā // GarP_1,87.6 //
datto (mbho) liścāvarīvāṃśca ṛṣyaḥ saptakīrtitāḥ /
tuṣitā dvādaśa proktāstathā pārāvatāśca ye // GarP_1,87.7 //
indro vipaściddevānāṃ tadripuḥ purukṛtsaraḥ /
jaghāna hastirūpeṇa bhagavānmadhusūdanaḥ // GarP_1,87.8 //
auttamasya manoḥ putrā ājaśca paraśustathā /
vinītaśca suketuśca sumitraḥ subalaḥ śuciḥ // GarP_1,87.9 //
devo devāvṛdho rudra ! mahotsāhojitastathā /
rathaujā ūrdhvabāhuśca śaraṇaścānagho muniḥ // GarP_1,87.10 //
sutapāḥ śaṅkurityete ṛṣayaḥ sapta kīrtitāḥ /
vaśavartisvadhāmānaḥ śivāḥ satyāḥ pratardanāḥ // GarP_1,87.11 //
pañca devagaṇāḥ proktā sarve dvādaśakāstu te /
indraḥ svaśāntistacchukraḥ pralambo nāma dānavaḥ // GarP_1,87.12 //
matsyarūpī harirviṣṇustaṃ jaghāna ca dānavam /
tāmasasya manoḥ putrā jānujaṅgho 'tha nirbhayaḥ // GarP_1,87.13 //
navakhyātirnayaścaiva priyabhṛtyo vivikṣipaḥ /
dṛḍheṣudhiḥ prastalākṣaḥ kṛbandhuḥ kṛtastathā // GarP_1,87.14 //
jyotirdhāmā pṛthuḥ (dhṛṣṭa) kāvyaścaitraścetāgnihemakāḥ (kau) /
munayaḥ kīrtitāḥ sapta surāgāḥ sudhiyastathā // GarP_1,87.15 //
harayo devatāmāṃ ca catvāraḥ pañca (sapta) viṃśakāḥ /
gaṇā indraḥ śivistasya śatrurbhomarathāḥ smṛtāḥ // GarP_1,87.16 //
hariṇā kūrmarūpeṇa hato bhīmaratho 'suraḥ /
raivatasya manoḥ putro mahā prāṇaśca sādhakaḥ // GarP_1,87.17 //
vana (la) bandhurniramitraḥ pratyaṅgaḥ parahā śuciḥ /
dṛḍhavrataḥ ketuśṛgaṃ ṛṣayastasya varṇyate // GarP_1,87.18 //
vedaśrīrvedabāhuśca ūrdhvabāhustathaiva ca /
hiraṇyaromā parjanyaḥ satyanetraḥ (nāmā) svadhāma ca // GarP_1,87.19 //
abhūtarajasaścaiva tathā devāśvamedhasaḥ /
vaikuṇṭha (ṇṭhāḥ ścāmṛta (tā) ścaiva catvāro devatāgaṇāḥ // GarP_1,87.20 //
gaṇe caturdaśa surā vibhuridraḥ pratāpavān /
śāntaḥ śatrurhato daityo haṃsarūpeṇa viṣṇunā // GarP_1,87.21 //
cākṣuṣasya manoḥ putrā uruḥ pururmahābalaḥ /
śatadyumnastapasvī ca satyabāhuḥ(kyo) kṛtistathā // GarP_1,87.22 //
agniṣṇuratirātraśca sudyumnaśca tathā naraḥ /
haviṣmānuttamaḥ śrīmānsva (su) dhāmā virajastathā // GarP_1,87.23 //
abhimānaḥ sahiṣṇuśca madhuśrīrṛṣayaḥ smṛtāḥ /
āryāḥ prabhūtā bhāvyāśca lekhāśca pṛthukāstathā // GarP_1,87.24 //
aṣṭakasya gaṇāḥ pañca tathā proktā divaukasām /
indro manojavaḥ śatrurmahākālo mahābhajaḥ // GarP_1,87.25 //
aśvarūpeṇa sa hato hariṇā lokadhāriṇā /
manorvaivasvatasyete putrā viṣṇuparāyaṇāḥ // GarP_1,87.26 //
ikṣvākuratha nābhāgo dhṛṣṭaḥ śaryātireva ca /
nariṣyantastathā pāṃsurnabho nediṣṭha eva ca // GarP_1,87.27 //
karūṣaśca pṛṣadhraśca sudyumnaśca manoḥ sutāḥ /
atrirvasiṣṭho bhagavāñjamadagniśca kaśyapaḥ // GarP_1,87.28 //
gautamaśca bharadvājo viśāmitro 'tha saptamaḥ /
tathā hyekonapañcāśanmarutaḥ parikīrtitāḥ // GarP_1,87.29 //
ādityā vasavaḥ sādhyāgaṇā dvādaśakāstrayaḥ /
ekādaśā tathā rudrā vasavo 'ṣṭau prakīrtitāḥ // GarP_1,87.30 //
dvāvaśvinau vinirdiṣṭau viśvedevāstathā daśā /
daśauvāṅgiraso devā nava devagaṇāstathā // GarP_1,87.31 //
tejasvī nāma vai śakro hiraṇyākṣo ripuḥ smṛtaḥ /
hato varāharūpeṇa hariṇyākhyo 'tha viṣṇunā // GarP_1,87.32 //
vakṣye manorbhaviṣyasya sāvarṇyākhyasya vai sutān /
vijayaścārvavīraśca nirmohaḥ satyavākrṛtī // GarP_1,87.33 //
variṣṭhaśca gariṣṭhaśca vācaḥ saṃgatireva ca /
aśvatthāmā kṛpo vyāso gālavo dīptimānatha // GarP_1,87.34 //
ṛṣyaśṛṅgastathā rāma ṛṣayaḥ sapta kīrtitāḥ /
sutapā amṛtābhāśca mukhyāścāpi tathā surāḥ // GarP_1,87.35 //
teṣāṃ gaṇastu devānā mekaiko viṃśakaḥ smṛtaḥ /
virocanasutasteṣāṃ balirindro bhaviṣyati // GarP_1,87.36 //
dattvemāṃ yācamānāya viṣṇave yaḥ padatrayam /
ṛddhimindrapadaṃ hitvā tataḥ siddhimavāpsyati // GarP_1,87.37 //
vāruṇerdakṣasāvarṇernavamasya sutāñchṛṇu /
dhṛtiketurdeptiketuḥ pañcahasto nirāmayaḥ /
pṛtuśravā bṛhadūdyumna ṛcīko bṛhato guṇaḥ // GarP_1,87.38 //
medhātithirdyutiścaiva savaso vasureva ca /
jyotiṣmānhavyakavyau ca ṛṣayo vibhurīśvaraḥ // GarP_1,87.39 //
paro marīcirgarbhaśca sva (su) dharmāṇaśca te trayaḥ /
deśaśatru) kālakākṣastaddhantā padmanābhakaḥ // GarP_1,87.40 //
bhaviṣyanti tadā devā ekaiko dvādaśo gaṇaḥ /
teṣāmindro mahāvīryo bhaviṣyatyadbhuto hara // GarP_1,87.40*1 //
dhamaputrasya putrāṃstu daśa masya manoḥ śṛṇu /
sukṣetraścottamaujāśca bhūriśreṇyaśca vīryavān // GarP_1,87.41 //
śatānīko niramitro vṛṣaseno jayadrathaḥ /
bhūridyumnaḥ suvarcāśca śāntirindraḥ pratāpavān // GarP_1,87.42 //
ayo (po) mūrtirhaviṣmāṃśca sukṛtiścāvyayastathā /
nābhāgo 'pratimaujāśca saurabha ṛṣayastathā // GarP_1,87.43 //
prāṇākhyāḥ śatasaṃkhyāstu devatānāṃ gaṇastadā /
teṣāmindraśca bhavitā śāntirnāma mahābalaḥ /
baliḥ śatrustaṃ hariśca gadayā ghātayiṣyati // GarP_1,87.44 //
rudra putrasya te putrānvakṣyāmyekādaśasya tu /
sarvatragaḥ suśarmā ca devānīkaḥ pururguruḥ // GarP_1,87.45 //
kṣetravarṇo dṛḍheṣuśca ārdrakaḥ putrakastathā /
haviṣmāṃśca haviṣyaśca varuṇo viśvavistarau // GarP_1,87.46 //
viṣṇuścaivāgnitejāśca ṛṣayaḥ sapta kīrtitāḥ /
vihaṅgamāḥ kāmagam nirmāṇarucayastathā // GarP_1,87.47 //
ekaikastriṃśakasteṣāṃ gaṇaścaindraśca vai vṛṣaḥ /
dhasagrīvo ripustasya śrīrūpī ghātayiṣyati // GarP_1,87.48 //
manostu dakṣaputrasya dvādaśasyātmajāñchṛṇu /
devavānu padevaśca devaśreṣṭho vidūrathaḥ // GarP_1,87.49 //
mitravānmitradevaśca mitrabinduśca vīryavān /
mitravāhaḥ pravāhaśca dakṣaputramanoḥ sutāḥ // GarP_1,87.50 //
tapasvī sutapāścaiva tapomūrtistaporatiḥ /
tapodhṛtirdyutiścānyaḥ saptamaśca tapodhanāḥ // GarP_1,87.51 //
svadharmāṇaḥ sutapaso harito hohitāstathā /
surārayo gaṇāścaite pratyekaṃ daśako gaṇaḥ // GarP_1,87.52 //
ṛtadhāmā ca bhadre (tatre) ndrastārako nāma tadripuḥ /
harirnapuṃsakaṃ bhūtvā ghātayiṣyati śaṅkara // GarP_1,87.53 //
trayodaśasya raucyasya manoḥ putrānnibodha me /
citraseno vicitraśca tapodharmarato dhṛtiḥ // GarP_1,87.54 //
sunetraḥ kṣetravṛttiśca sunayo dharmapo dṛḍhaḥ /
dhṛtimānavyayaścaiva niśārūpo nirutsukaḥ // GarP_1,87.55 //
nirmohastattvadarśo ca ṛṣayaḥ sapta kīrtitāḥ /
sva (su) romāṇaḥ sva (su) dharmāṇaḥ sva (su) karmāṇastathāmarāḥ // GarP_1,87.56 //
trayastriṃśadvibhedāste devānāṃ tatra vai gaṇāḥ /
indro divaspatiḥ śatrustviṣṭibho nāma dānavaḥ // GarP_1,87.57 //
māyūreṇa ca rūpeṇa ghātayiṣyati mādhavaḥ /
caturdaśasya bhautyasya śṛṇu putrānmanormama // GarP_1,87.58 //
ururgabhīro dhṛṣṭaśca tarasvīgrā (gra) ha eva ca /
abhimāni pravīraśca jiṣṇuḥ saṃkrandanastathā /
tejasvī durlabhaścaiva bhautyasyaite manoḥ sutāḥ // GarP_1,87.59 //
agnīdhraścāgnibāhuśca māgadhaśca tathā śuciḥ /
ajito muktaśukrau ca ṛṣayaḥ sapta kīrtitāḥ // GarP_1,87.60 //
cākṣuṣāḥ karmaniṣṭhāśca pavitrā bhrājinastathā /
vacovṛddhā devagaṇāḥ pañca proktāstu saptakāḥ // GarP_1,87.61 //
śucirindro mahādaityo ripuhantā hariḥ svayam /
eko devaścaturdhā tu vyāsarūpeṇa viṣṇunā // GarP_1,87.62 //
kṛtastataḥ purāṇāni vidyāścāṣṭādaśaiva tu /
aṅgāni caturo vedā mīmāṃsā nyāyavistaraḥ // GarP_1,87.63 //
purāṇaṃ dharmaśāstraṃ ca āyurvedārthaśāstrakam /
dhanurvedaśca gāndharvo vidyā hyaṣṭādaśaiva tāḥ // GarP_1,87.64 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe manutadvaṃśanirūpaṇaṃ nāma spatāśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 88
sūta uvāca /
harirmanvantarāṇyāha brahmādibhyo harāya ca /
mārkaṇḍeyaḥ pitṛsto traṃ krauñcukiṃ prāha tacchṛṇu // GarP_1,88.1 //
mārkaṇḍeya uvāca /
ruciḥ prajāpatiḥ pūrvaṃ nirmamo nirahaṅkṛtiḥ /
atrasto 'mitamāyī ca cacāra pṛthivīmimām // GarP_1,88.2 //
anagnimaniketaṃ tamekāhāramanāśramam /
nimuktasaṃgaṃ taṃ dṛṣṭvā procuḥ svapitaro munim // GarP_1,88.3 //
pitara ūcuḥ /
vatsa kasmāttvayā puṇyo na kṛto dāra saṃgrahaḥ /
svargāpavargahe (se)tutvādvandhastenāniśaṃ (nimiṣaṃ) vinā // GarP_1,88.4 //
gṛhī samastadevānāṃ pitṝṇāṃ ca tathārhaṇam /
ṛṣīṇāmarthināṃ caiva kurvallo kānavāpnuyāt // GarP_1,88.5 //
svāhoccāraṇato devānsvadhoccāraṇataḥ pitan /
vibhajatyannadānena bhṛtyādyānatithīnapi // GarP_1,88.6 //
sa ttvaṃ daivādṛṇādvandhamimamasmadṛṇādapi /
avāpto 'si manuṣyarṣe bhūtebhyaśca dinedine // GarP_1,88.7 //
anatpādya sutāndevānasantarpya pitṝstathā /
akṛtvā ca kathaṃ māṇḍyaṃ svargatiṃ prāptumicchasi // GarP_1,88.8 //
kleśabodhaikakaṃ putra anyāyena bhavettava /
mṛtasya narakaṃ tyaktvā kleśa evānyajanmani // GarP_1,88.9 //
ruciruvāca /
parigraho 'tiduḥ khāya pāpāyā dhogatestathā /
bhavatyato mayā pūrvaṃna kṛto dārasaṃgrahaḥ // GarP_1,88.10 //
ātmanaḥ saṃśayopāyaḥ kriyate kṣaṇamantraṇāt /
svamuktiheturna bhavatyasāvapi parigrahāt // GarP_1,88.11 //
prakṣālyate 'nudivasaṃ ya ātmā niṣparigrahaḥ /
mama tvapaṅkadigdho 'pi vidyāmbhobhirvaraṃ hi tat // GarP_1,88.12 //
anekabhavasaṃbhūtakarmapaṅkāṅkito budhaiḥ /
ātmā tattvajñānatoyaiḥ prakṣālyo niyatendriyaiḥ // GarP_1,88.13 //
pitara ūcuḥ /
yuktaṃ prakṣālanaṃ kartumātmano 'pi yatendriyaiḥ /
kiṃ tu nopāyamārgo 'yaṃ yatastvaṃ putra vartase // GarP_1,88.14 //
pañcayajñaistapodānairaśubhaṃ nudatastava /
phalābhisandhirahitaiḥ pūrvakama śubhāśubhaiḥ // GarP_1,88.15 //
evaṃ na bandho bhavati kurvataḥ kāraṇātmakam /
na ca bandhāya tatkarma bhavatyanatisannibham // GarP_1,88.16 //
pūrvakarma kṛtaṃ bogaiḥ kṣīyate hyaniśantathā /
sukhaduḥ khātmakairvatsa puṇyā puṇyātmakaṃ nṛṇām // GarP_1,88.17 //
evaṃ prakṣālyate prājñairātmā bandhācca rakṣyate /
rakṣyaśca svavivekairna pāpapaṅkena dahyate // GarP_1,88.18 //
ruciruvāca /
avidyā pacyate vede karmamārgātpitāmahāḥ /
tatkathaṃ karmaṇo mārge bhavanto yojayanti mām // GarP_1,88.19 //
pitara ucuḥ /
avidyā sarvamevaitatkarmaṇaitanmṛṣā vacaḥ /
kiṃ tu vidyāpariprāptau hetuḥ karma na saṃśayaḥ // GarP_1,88.20 //
vihitākaraṇānartho na sadbhiḥ kriyate tu yaḥ /
saṃyamo muktaye yo 'nyaḥ pratyutādhogatipradaḥ // GarP_1,88.21 //
prakṣālayāmīti bhavānyadetanmanyate varam /
vihitākaraṇodbhūtaiḥ pāpaistvamapi dahyase // GarP_1,88.22 //
avidyāpyupakārāya viṣavajjāyate nṛṇām /
anuṣṭhānā bhyupāyena bandhayogyāpi no hi sā // GarP_1,88.23 //
tasmādvatsa kuruṣva tvaṃ vidhivaddārasaṃgraham /
ājanma viphalante 'stu asamprāpyānyalaukikam // GarP_1,88.24 //
ruciruvāca /
vṛddho 'haṃ sāmprataṃ ko me pitaraḥ sampridāsyati /
bhāryāntathā daridrasya duṣkaro dārasaṃgrahaḥ // GarP_1,88.25 //
pitara ūcuḥ /
asmākaṃ patanaṃ vatsa bhavataścāpyadhogatiḥ /
nūnaṃ bhāvi bhavitrī ca nābhinandasi no vacaḥ // GarP_1,88.26 //
ityuktvā pitarastasya paśyato munisattama /
babhūvuḥ sahasādṛśyā dīpā vātahatā iva // GarP_1,88.27 //
muniḥ kraiñcukaye prāha mārkaṇḍeyo mahātapāḥ /
rucivṛttāntamakhilaṃ pitṛsaṃvādalakṣaṇam // GarP_1,88.28 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe karmajñānamā nāmāṣṭāśītitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 89
sūta uvāca /
pṛṣṭaḥ kraiñcukinovāca mārkaṇḍeyaḥ punaśca tam /
sa tena pitṛvākyane bhṛśamudvagnamānasaḥ // GarP_1,89.1 //
kanyābhilāṣī viprarṣiḥ paribabhrāma medinīm /
kanyāmalabhamāno 'sau pitṛvākyena dīpitaḥ /
cintāmavāpa mahītamatīvodvagnamānasaḥ // GarP_1,89.2 //
kiṃ karomi kra gacchāmi kathaṃ me dārasaṃgrahaḥ /
kṣipraṃ bhavenmatpitṝṇāṃ mamābhyudayakārakaḥ // GarP_1,89.3 //
iti cintayatastasyamatirjātā mahātmanaḥ /
tapasārādhayāmyenaṃ brahmāṇaṃ kamalodbhavam // GarP_1,89.4 //
tato varṣaśataṃ divyaṃ tapastepe mahāmanāḥ /
tatra sthitaściraṃ kālaṃ vaneṣu niyamasthitaḥ /
ārādhanāya sa tadā paraṃ niyamamāsthitaḥ // GarP_1,89.5 //
tataḥ pradarśayāmāsa brahmā lokapitāmahaḥ /
uvācātha prasanno 'smītyucyatāmabhivāñchitam // GarP_1,89.6 //
tato 'sau praṇipatyāha brahmāṇaṃ jagato gatim /
pitṝṇāṃ vacanāttena yatkartumabhivāñchitam // GarP_1,89.7 //
brahmovāca /
prajāpatistvaṃ bhavitā sraṣṭavyā bhavatā prajāḥ /
sṛṣṭvā prajāḥ sutānvipra samutpādya kriyāstathā // GarP_1,89.8 //
kṛtvā kṛtādhikārastvaṃ tataḥ siddhimavāpyasi /
satvaṃ yathoktaṃ pitṛbhiḥ kuru dāraparigraham // GarP_1,89.9 //
kāmaṃ cemamabhidhyāya kriyatāṃ pitṛpūjanam /
ta eva tuṣṭāḥ pitaraḥ pradāsyanti tavepsitam /
patnīṃ sutāṃśca santuṣṭāḥ kiṃ na dadyuḥ pitāmahāḥ // GarP_1,89.10 //
mārkaṇḍeya uvāca /
ityṛṣirvacanaṃ śrutvā brahmaṇo 'vyaktajanmanaḥ /
nadyā vivikte puline cakāra pitṛtarpaṇam // GarP_1,89.11 //
tuṣṭāva ca pitṝnvipraḥ stavairebhirathādṛtaḥ /
ekāgraprayato bhūtvā bhaktinamrātmakandharaḥ // GarP_1,89.12 //
ruciruvāca /
namasye 'haṃ pitṝn bhaktyā ye vasantyadhidevatam /
devairapi hi tarpyante ye śrāddheṣu svadhottaraiḥ // GarP_1,89.13 //
namasye 'haṃ pitṝn svarge ye tarpyante maharṣibhiḥ /
śrāddhairmanomayairbhaktyā bhuktimuktimabhīpsubhiḥ // GarP_1,89.14 //
namasye 'haṃ pitṝnsvarge siddhāḥ santarpayanti yān /
śrāddheṣu divyaiḥ sakalairupahārairanuttamaiḥ // GarP_1,89.15 //
namasye 'haṃ pitṝn bhaktyā yer'cyante guhyakairdivi /
tanmayatvena vādhadbhiḥ ṛddhimātyantikīṃ parām // GarP_1,89.16 //
namasye 'haṃ pitṝnmartyairarcyante bhuvi ye sadā /
śrāddheṣu śraddhayābhīṣṭalokapuṣṭipradāyinaḥ // GarP_1,89.17 //
namasye 'haṃ pitṝnviprairarcyante bhuvi ye sadā /
vāñchitābhīṣṭalābhāya prājāpatyapradāyinaḥ // GarP_1,89.18 //
namasye 'haṃ pitṝnye vai tarpyante 'raṇyavāsibhiḥ /
vanyaiḥ śrāddhairyatāhāraistaponirdhūtakalmaṣaiḥ // GarP_1,89.19 //
namasye 'haṃ pitṝnviprairnaiṣṭhikairdharmacāribhiḥ /
ye saṃyatātmabhirnityaṃ santarpyante samādhibhiḥ // GarP_1,89.20 //
namasye 'haṃ pitṝñchrāddhai rājanyāstarpayanti yān /
kavyairaśeṣaividhivallokadvayaphalapradān // GarP_1,89.21 //
namasye 'haṃ pitṝnvaiśyairarcyante bhuvi ye sadā /
svakarmābhiratairnnityaṃ puṣpadhūpānnavāribhiḥ // GarP_1,89.22 //
namasye 'haṃ pitṝñchrāddhe śūdrairapi ca bhaktitaḥ /
santarpyate jagatkṛtsnaṃ nāmnā khyātāḥ sukālinaḥ // GarP_1,89.23 //
namasye 'haṃ pitṝñchrāddhe pātāle ye mahāsuraiḥ /
santarpyante sudhāhārāstyaktadambhamadaiḥ sadā // GarP_1,89.24 //
namasye 'haṃ pitṝñchrāddhairarcyante ye rasātale /
bhogairaśeṣairvidhivannāgaiḥ kāmānabhīpsubhiḥ // GarP_1,89.25 //
namasye 'haṃ pitṝñchrāddhaiḥ sarpaiḥ santarpitānsadā /
tatraiva vidhivanmantrabhogasampatsamanvitaiḥ // GarP_1,89.26 //
pitṝnnamasye nivasanti sākṣādye devaloke 'tha mahītale vā /
tathāntarikṣe ca surāripūjyāste vai pratīcchantu mayopanītam // GarP_1,89.27 //
pitṝnnamasye paramārthabhūtā ye vai vimāne nivasantyamūrtāḥ /
yajanti yānastamalairmanobhiryogīśvarāḥ kleśavimuktihetūn // GarP_1,89.28 //
pitṝnnamasye divi ye ca mūrtāḥ svadhābhujaḥ kāmyaphalābhisandhau /
pradānaśaktāḥ sakalepsitānāṃ vimuktidā ye 'nabhisaṃhiteṣu // GarP_1,89.29 //
tṛpyantu te 'sminpitaraḥ samastā icchāvatāṃ ye pradiśanti kāmān /
suratvamindratvamito 'dhikaṃ vā gajāśvaratnāni mahāgṛhāṇi // GarP_1,89.30 //
somasya ye raśmiṣu yer'kabimbe śukle vimāne ca sadā vasanti /
tṛpyantu te 'sminpitaro 'nnatoyairgandhādinā puṣṭimito vrajantu // GarP_1,89.31 //
yeṣāṃ hute 'gnau haviṣā ca tṛptirye bhuñjate vipraśarīrasaṃsthāḥ /
ye piṇḍadānena mudaṃ prayānti tṛpyantu te 'sminpitaro 'nnatoyaiḥ // GarP_1,89.32 //
ye khaḍgamāṃsena surairabhīṣṭaiḥ kṛṣṇaistilairdivya manoharaiśca /
kālena śākena maharṣivaryaiḥ saṃprīṇitāste mudamatra yāntu // GarP_1,89.33 //
kavyānyaśeṣāṇi ca yānyabhīṣṭānyatīva teṣāṃ mama pūjitānām /
teṣāñca sānnidhyamihāstu puṣpagandhāmbubhojyeṣu mayā kṛteṣu // GarP_1,89.34 //
dinedine ye pratigṛhṇater'cāṃ māsāntapūjyā bhuvi ye 'ṣṭakāsu /
ye vatsarānte 'bhyudaye ca pūjyāḥ prayāntu te me pitaro 'tra tuṣṭim // GarP_1,89.35 //
pūjyā dvijānāṃ kumudendubhāso ye kṣattriyāṇāṃ jvalanārkavarṇāḥ /
tathā viśāṃ ye kanakāvadātā nīlīprabhāḥ śūdrajanasya ye ca // GarP_1,89.36 //
te 'sminsamastā mama puṣpagandhadhūpāmbubhojyādinivedanena /
tathāgnihomena ca yānti tṛptiṃ sadā pitṛbhyaḥ praṇato 'smi tebhyaḥ // GarP_1,89.37 //
ye devapūrvāṇyabhitṛptihetora śranti kavyāni śubhāhṛtāni /
tṛptāśca ye bhūtisṛjo bhavanti tṛpyantu te 'sminpraṇato 'smi tebhyaḥ // GarP_1,89.38 //
rakṣāṃsi bhūtānyasurāṃstathogrātrirṇāśayantu tvaśivaṃ prajānām /
ādyāḥ surāṇāmamareśapūjyāstṛpyantu te 'sminpraṇato 'smitebhyaḥ // GarP_1,89.39 //
agniṣvāttā barhiṣada ājyapāḥ somapāstathā /
vrajantu tṛptiṃ śrāddhe 'sminpitarastarpitā mayā // GarP_1,89.40 //
agniṣvāttāḥ pitṛgaṇāḥ prācīṃ rakṣantu me diśam /
tathā barhiṣadaḥ pāntu yāmyāṃ me pitaraḥ sadā /
pratīcīmājyapāstadvadudīcīmapi somapāḥ // GarP_1,89.41 //
rakṣobhūtapiśācebhyastathaivāsuradoṣataḥ /
sarvataḥ pitaro rakṣāṃ kurvantu mama nityaśaḥ // GarP_1,89.42 //
viśvo viśvabhugārādhyo dharmo dhanyaḥ śubhānanaḥ /
bhūtido bhūtikṛd bhūtiḥ pitṝṇāṃ ye gaṇā nava // GarP_1,89.43 //
kalyāṇaḥ kalyadaḥ kartā kalyaḥ kalyatarāśrayaḥ /
kalyatāheturanghaḥ ṣaḍime te gaṇāḥ smṛtāḥ // GarP_1,89.44 //
varo vareṇyo varadastuṣṭidaḥ puṣṭidastathā /
viśvapātā tathā dhātā saptaite ca gaṇāḥ smṛtāḥ // GarP_1,89.45 //
mahānmahātmā mahito mahimāvānmahābalaḥ /
gaṇāḥ pañca tathaivaite pitṝṇāṃ pāpanāśanāḥ // GarP_1,89.46 //
sukhado dhanadaścānyo dharmado 'nyaśca bhūtidaḥ /
pitṝṇāṃ kathyate caiva tathā gaṇacatuṣṭayam // GarP_1,89.47 //
ekatriṃśatpitṛgaṇā yairvyāptamakhilaṃ jagat /
ta evātra pitṛgaṇāstuṣyantu ca madāhitāt // GarP_1,89.48 //
mākraṇḍeya uvāca /
evaṃ tu stuvatastasya tejasorāśirucchritaḥ /
prādurbabhūva sahasā gaganavyāptikārakaḥ // GarP_1,89.49 //
taddṛṣṭvā sumahattejaḥ samācchādya sthitaṃ jagat /
jānubhyāmavanīṃ gatvā ruciḥ stotramidañjagau // GarP_1,89.50 //
ruciruvāca /
arcitānāmamūrtānāṃ pitṝṇāṃ dīptatejasām /
namasyāmi sadā teṣāṃ dhyānināṃ divyacakṣuṣām // GarP_1,89.51 //
indrādīnāṃ ca netāro dakṣamārīcayostathā /
saptarṣoṇāṃ tathānyeṣāṃ tānnamasyāmi kāmadān // GarP_1,89.52 //
manvādīnāṃ ca netāraḥ sūryācandramasostathā /
tānnamasyāmyahaṃ sarvānpitṝnapyudadhāvapi // GarP_1,89.53 //
nakṣatrāṇāṃ grahāṇāṃ ca vāyvagnyornabhasastathā /
dyāvāpṛthivyośca tathā namasyāmi kṛtāñjaliḥ // GarP_1,89.54 //
prajāpateḥ kaśyapāya somāya varuṇāya ca /
yogeśvarebhyaśca sadā namasyāmi kṛtāñjaliḥ // GarP_1,89.55 //
namo gaṇebhyaḥ saptabhyastathā lokeṣu saptasu /
svāyambhuve namasyāmi brahmaṇe yogacakṣuṣe // GarP_1,89.56 //
somādhārānpitṛgaṇānyogamūrtidharāṃstathā /
namasyāmi tathā somaṃ pitaraṃ jagatāmaham // GarP_1,89.57 //
agnirūpāṃstathaivānyānnamasyāmi pitṝnaham /
agnisomamayaṃ viśvaṃ yata etadaśeṣataḥ // GarP_1,89.58 //
ye ca tejasi ye caite somasūryāgnimūrtayaḥ /
jagatsvarūpiṇaścaiva tathā brahmasvarūpiṇaḥ // GarP_1,89.59 //
tebhyo 'khilebhyo yogibhyaḥ pitṛbhyo yatamānasaḥ /
namonamo namaste 'stu prasīdantu svadhābhujaḥ // GarP_1,89.60 //
mākraṇḍeya uvāca /
evaṃ stutāstatastena tajaso munisattamāḥ /
niścakramuste pitaro bhāsayanto diśādaśa // GarP_1,89.61 //
nivedanañca yattena puṣpagandhānulepanam /
tadbhūṣitānatha sa tāndadṛśe purataḥ sthitān // GarP_1,89.62 //
praṇipatya rucirbhaktyā punareva kṛtāñjaliḥ /
namastubhyaṃ namastubhyamityāha pṛthagādṛtaḥ // GarP_1,89.63 //
tataḥ prasannāḥ pitarastamūcurmunisattamam /
varaṃ vṛṇīṣveti sa tānuvācānatakandharaḥ // GarP_1,89.64 //
ruciruvāca /
prajānāṃ sargakartṛtvamādiṣṭaṃ brahmaṇā mama /
so 'haṃ patnīmabhīpsāmi dhanyāṃ divyāṃ prajāvatīm // GarP_1,89.65 //
pitara ūcuḥ /
atraiva sadyaḥ patnī te bhavatvatimanoramā /
tasyāñca putro bhavitā bhavato munisattama ! // GarP_1,89.66 //
manvantarādhipo dhīmāṃstvannāmnaivopalakṣitaḥ /
ruce ! raucya iti khyātiṃ prayāsyati jagattraye // GarP_1,89.67 //
tasyāpi bahavaḥ putrā mahābalaparākramāḥ /
bhaviṣyanti mahātmānaḥ pṛthivīparipālakāḥ // GarP_1,89.68 //
tvaṃ ca prijāpatirbhūtvā prajāḥ sṛṣṭvā caturvidhāḥ /
kṣīṇādhikāro dharmajñastataḥ siddhimavāpsyasi // GarP_1,89.69 //
stotreṇānena ca naro yo 'smāṃstoṣyati bhaktitaḥ /
tasya tuṣṭā vayaṃ bhogānātmajaṃ dhyānamuttamam // GarP_1,89.70 //
āyurārogyamarthaṃ ca putrapautrādikaṃ tathā /
vāñchadbhiḥ satataṃ stavyāḥ stotreṇānena vai yataḥ // GarP_1,89.71 //
śrāddheṣu ya imaṃ bhaktyā tvasmatprītikaraṃ stavam /
paṭhiṣyati dvijāgryāṇāṃ bhuñjatāṃ purataḥ sthitaḥ // GarP_1,89.72 //
stotraśravaṇasaṃprītyā sannidhāne pare kṛte /
asmābhirakṣayaṃ śrāddhaṃ tadbhaviṣyatyasaṃśayam // GarP_1,89.73 //
yadyapyaśrotriyaṃ śrāddhaṃ yadyapyupahataṃ bhavet /
anyāyopāttavittena yadi vā kṛtamanyathā // GarP_1,89.74 //
aśrāddhārhairupatairupahāraistathā kṛtaiḥ /
akāle 'pyatha vā deśe vidhihīnamathāpi vā // GarP_1,89.75 //
aśraddhayā vā puruṣairdambhamāśritya yatkṛtam /
asmākaṃ tṛptaye śrāddhantathāpyetadudīraṇāt // GarP_1,89.76 //
yatraitatpaṭhyate śrāddhe stotramastatsukhāvaham /
asmākaṃ jāyate tṛptistatra dvādaśāvarṣikī // GarP_1,89.77 //
hemante dvādaśābdāni tṛptimetatprayacchati /
śiśire dviguṇābdāni tṛptiṃ stotramidaṃ śubham // GarP_1,89.78 //
vasante ṣoḍaśa samāstṛptaye śrāddhakarmaṇi /
grīṣme ca ṣoḍaśaivaitatpaṭhitaṃ tṛptikārakam // GarP_1,89.79 //
vikale 'pi kṛte śrāddhe stotreṇānena sādhite /
varṣāsu tṛptirasmākamakṣayyā jāyate ruce // GarP_1,89.80 //
śaratkāle 'pi paṭhitaṃ śrāddhakāle prayacchati /
asmākametatpuruṣaistṛptiṃ pañcadaśābdikīm // GarP_1,89.81 //
yasmin gehe ca likhitametattiṣṭhati nityadā /
sannidhānaṃ kṛte śrāddhe tatrāsmākaṃ bhaviṣyati // GarP_1,89.82 //
tasmādetattvayā śrāddhe viprāṇāṃ bhuñjatāṃ puraḥ /
śrāvaṇīyaṃ mahābhāga asmākaṃ puṣṭikārakam // GarP_1,89.83 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe rucikṛtapitṛstotraṃ nāmaikonanavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 90
mākraṇḍeya uvāca /
tatastasmānnadīmadhyātsamuttasthau manoramā /
pramlaucā nāma tanvaṅgī tatsamīpe varāpsarāḥ // GarP_1,90.1 //
sā covāca mahātmānaṃ ruciṃ sumadhurākṣarakam /
prasādayāmāsa bhūyaḥ pramlocā ca varāpsarāḥ // GarP_1,90.2 //
atīvarūpiṇī kanyā matprasādvarāṅganā /
jātā varuṇaputreṇa puṣkareṇa mahātmanā // GarP_1,90.3 //
tāṃ gṛhāṇa mayā dattāṃ bhāryārthe varavarṇinīm /
manurmahāmatistasyāṃ samutpatsyati te sutaḥ // GarP_1,90.4 //
mārkaṇḍeya uvāca /
tatheti tena sāpyuktā tasmāttoyādvapuṣmatīm /
uddadhāra tataḥ kanyāṃ māninīṃ nāma nāmataḥ // GarP_1,90.5 //
nadyāśca puline tasminsa munirmunisattamāḥ /
jagrāha pāṇiṃ vidhivatsamānīya mahāmuniḥ // GarP_1,90.6 //
tasyāṃ tasya suto jajñe mahāvīryo mahādyutiḥ /

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 91
sūta uvāca /
svāyambhuvādyā munayo hariṃ dhyāyanti karmaṇā /
vratācārārcanādhyānastutijapyaparāyaṇāḥ // GarP_1,91.1 //
dehendriyamanobuddhiprāṇāhaṅkāravarjitam /
ākaśena vihīnaṃ vai tejasā parivarjitam // GarP_1,91.2 //
udakena vihīnaṃ vai taddharmaparivarjitam /
pṛthivīrahitaṃ caiva sarvabhatavivarjitam // GarP_1,91.3 //
bhūtādhyakṣaṃ tathā baddhaniyantāraṃ prabhuṃ vibhum /
caitanyarūpatārūpaṃ sarvādhyakṣaṃ nirañjanam // GarP_1,91.4 //
muktasaṅgaṃ maheśānaṃ sarvadevaprapūjitam /
tejorūpamasattvaṃ ca tapasā parivarjitam // GarP_1,91.5 //
rahitaṃ rajasā nityaṃ vyatiriktaṃ guṇaistribhiḥ /
sarvarūpavihīnaṃ vai kartṛtvādivivarjitam // GarP_1,91.6 //
vāsanārahitaṃ śuddhaṃ sarvadoṣavivarjitam /
pipāsāvarjitaṃ tattaccho kamohavivarjitam // GarP_1,91.7 //
jarāmaraṇahīnaṃ vai kūṭasthaṃ mohavarjitam /
utpattirahitaṃ caiva pralayena vivarjitam // GarP_1,91.8 //
satyaṃ sarvācārahīnaṃ niṣkalaṃ parameśvaram /
jāgratsvapnasuṣuptyādivarjitaṃ nāmavarjitam // GarP_1,91.9 //
adhyakṣaṃ jāgradādīnāṃ śāntarūpaṃ sureśvaram /
jāgradādisthitaṃ nityaṃ kāryakāraṇavarjitam // GarP_1,91.10 //
sarvadṛṣṭaṃ tathā mūrtaṃ sūkṣmaṃ sūkṣmataraṃ param /
jñānadṛk śrotravijñānaṃ paramānandarūpakam // GarP_1,91.11 //
viśvena rahitaṃ tadvattaijasena vivarjitam /
prājñena rahitañcaiva turīyaṃ paramākṣaram // GarP_1,91.12 //
sarvagoptṛ sarvahantṛ sarvabhūtātmarūpi ca /
buddhidharmavihīnaṃ vai nirādhāraṃ śivaṃ harim // GarP_1,91.13 //
vikriyārahitaṃ caiva vedāntairvedyameva ca /
vedarūpaṃ paraṃ bhūtamindriyebhyaḥ paraṃ śubham // GarP_1,91.14 //
śabdena varjitañcaiva rasena ca vivarjitam /
sparśena rahitaṃ devaṃ rūpamātravivarjitam // GarP_1,91.15 //
rūpeṇa rahitaṃ ñcaiva gandhena parivarjitam /
anādi brahma randhrāntamahaṃ brahmāsmi kevalam // GarP_1,91.16 //
evaṃ jñātvā mahādevadhyānaṃ kuryājjitendriyaḥ /
dhyānaṃ yaḥ kurute hyevaṃ sa bhavedbahma mānavaḥ // GarP_1,91.17 //
iti dhyānaṃ samākhyātamaśvirasya mayā tava /
adhunā kathayāmyanyatkintadbrūhi vṛṣadhvaja // GarP_1,91.18 //

iti śrīgāruḍe mahāpurāṇe prathamāṃśākhye ācārakāṇḍe haridhyānaṃ nāmaikanavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 92
rudrauvāca /
viṣṇordhyānaṃ punarbrūhi śaṅkhacakragadādhara /
yena vijñātamātreṇa kṛtakṛtyo bhavennaraḥ // GarP_1,92.1 //
hariruvāca /
pravakṣyāmi harerdhyānaṃ māyātantravimardakam /
mūrtāmūrtādibhedena taddhyānaṃ dvividhaṃ hara // GarP_1,92.2 //
amūrtaṃ rudra kathitaṃ hanta mūtta bravīmyaham /
sūryakoṭipratīkāśo jiṣṇurbhājiṣṇurekataḥ // GarP_1,92.3 //
kundagokṣīradhavalo harirdhyeyo mumukṣubhiḥ /
viśālena susaumyena śaṅkhena ca samanvitaḥ // GarP_1,92.4 //
sahasrādityatulyena jvālāmālograrūpiṇā /
cakreṇa cānvitaḥ śānto gadāhastaḥ śubhānanaḥ // GarP_1,92.5 //
kirīṭena mahārheṇa ratnaprajvalitena ca /
sāyudhaḥ sarvago devaḥ saroruhadharastathā // GarP_1,92.6 //
vanamālādharaḥ śubhraḥ samāṃso hemabhūṣaṇaḥ /
suvastraḥ śuddhadehaśca sukarṇaḥ padmasaṃsthitaḥ // GarP_1,92.7 //
hiraṇmayaśarīraśca cāruhārī śubhāṅgadaḥ /
keyūreṇa samāyukto vanamālāsamanvitaḥ // GarP_1,92.8 //
śrīvatsakaustubhayuto lakṣmīvandyekṣaṇānvitaḥ /
amimādiguṇairyuktaḥ sṛṣṭisaṃhārakārakaḥ // GarP_1,92.9 //
munidhyeyo 'suradhyeyo devadhyeyo 'tisundaraḥ /
brahmādistambaparyantabhūtajātahṛdisthitaḥ // GarP_1,92.10 //
sanātano 'vyayo medhyaḥ sarvānugrahakṛtprabhuḥ /
nārāyaṇo mahādevaḥ sphuranmakarakuṇḍalaḥ // GarP_1,92.11 //
santāpanāśano 'bhyarcyo maṅgalyo duṣṭanāśanaḥ /
sarvātmā sarvarūpaśca sarvago grahanāśanaḥ // GarP_1,92.12 //
cārvaṅgulīyasaṃyuktaḥ sudīptanakha eva ca /
śaraṇyaḥ lasukhakārī ca saumyarūpo maheśvaraḥ // GarP_1,92.13 //
sarvālaṅkārasaṃyuktaścārucandanacarcitaḥ /
sarvadevasamāyuktaḥ sarvadevapriyaṅkaraḥ // GarP_1,92.14 //
sarvalokahitaiṣī ca sarveśaḥ sarvabhāvanaḥ /
ādityamaṇḍale saṃstho agnistho vārisaṃsthitaḥ // GarP_1,92.15 //
vāsudevo jagaddhātā dhyeyo viṣṇurmumukṣubhiḥ /
vāsudevo 'hamasmīti ātmā dhyeyo harihariḥ // GarP_1,92.16 //
dhyāyantyevaṃ ca ye viṣṇuṃ te yānti paramāṃ gatim /
yājñavalkyaḥ purā hyevaṃ dhyātvā viṣṇuṃ sureśvaram // GarP_1,92.17 //
dharmopadeśakartṛtvaṃ saṃprāpyāgātparaṃ padam /
tasmāttvamapi deveśa ! viṣṇuṃ cintaya śaṅkara ! // GarP_1,92.18 //
viṣṇudhyānaṃ paṭhedyastu prāpnoti paramāṃ gatim // GarP_1,92.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣṇudhyānaṃ nāma dvinavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 93
maheśvara uvāca /
yājñavalkyena yatpūrvaṃ dharmaṃ proktaṃ kayaṃ hare ! /
tanme kāthaya keśighna ! yathā tattvena mādhava ! // GarP_1,93.1 //
hariruvāca /
yājñavalkyaṃ namaskṛtya mithilāyāṃ samāsthitam /
apṛcchannṝṣayo gatvā varṇadharmādyaśeṣataḥ /
tebhyaḥ sa kathayāmāsa viṣṇuṃ dhyātvā jitendriyaḥ // GarP_1,93.2 //
yājñavalkya uvāca /
yasmindeśe mṛgaḥ kṛṣṇastasmindharmānnibodhata /
purāṇanyāyamīmāṃsādharmaśāstrāṅgamiśritāḥ // GarP_1,93.3 //
vedāḥ sthānāni vidyānāṃ dharmasya ca caturdaśa /
vaktāro dharmaśāstrāṇāṃ manurviṣṇuryamo 'ṅgirāḥ // GarP_1,93.4 //
vasiṣṭhadakṣasaṃvartaśātātapaparāśarāḥ /
āpastambośanovyāsāḥ kātyāyanabṛhaspatī // GarP_1,93.5 //
gautamaḥ śaṅkhalikhito hārīto 'trirahaṃ tathā /
ete viṣṇuṃ samārādhya jātā dharmopadeśakāḥ // GarP_1,93.6 //
deśakāla upāyena dravyaṃ śraddhāsamanvitam /
pātre pradīyate yattatsakalaṃ dharmalakṣaṇam // GarP_1,93.7 //
ijyācāro damo 'hiṃsā dānaṃ svādhyāyakarma ca /
ayaṃ ca paramo dharmo yadyogenātmadarśanam // GarP_1,93.8 //
catvāro vedadharmajñāḥ parṣattraividyameva vā /
sā brūte yatsvadharmaḥ syādeko vādhyātmavittamaḥ // GarP_1,93.9 //
brahmakṣāttriyaviṭśūdrā varṇāstvādyāstrayo dvijāḥ /
niṣekādyāḥ śmaśānāntāsteṣāṃ vai mantrataḥ kriyāḥ // GarP_1,93.10 //
garbhādhānamṛtau puṃsaḥ savanaṃ spandanātpurā /
ṣaṣṭhe 'ṣṭame vā sīmantaḥ prasave jātakarma ca // GarP_1,93.11 //
ahanyekādaśe nāma caturthe māsi niṣkramaḥ /
ṣaṣṭhe 'nnaprāśanaṃ māsi cūḍāṃ kuryādyathākulam // GarP_1,93.12 //
evamenaḥ śamaṃ yāti bījagarbhasamudbhavam /
tūṣṇa īmetāḥ kriyāḥ strīṇāṃ vivāhaśca samantrakaḥ // GarP_1,93.13 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktavarṇadharṃmanirūpaṇaṃ nāma trinavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 94
yājñavalkya uvāca /
garbhāṣṭame 'ṣṭame vābde brāhmaṇasyopanāyanam /
rajñāmekādaśe saike viśāmeke yathākulam // GarP_1,94.1 //
upanīya kuruḥ śiṣyaṃ mahāvyāhṛtipūrvakam /
vedamadhyāpayedenaṃ śaucācārāṃśca śikṣayet // GarP_1,94.2 //
divā sandhyāsu karṇasthabrahmasūtra udaḍmukhaḥ /
kuryānmūtrapurīṣe tu rātrau ceddakṣiṇāmukhaḥ // GarP_1,94.3 //
gṛhītaśiśraścotthāya mṛdbhirabhyuddhṛtairjalaiḥ /
gandhalepakṣayakaraṃ śaucaṃ kuryānmahāvrataḥ // GarP_1,94.4 //
antarjānuḥ śucau deśa upaviṣṭa udaṅmukhaḥ /
prāgvā brāhmeṇa tīrthena dvijo nityamupaspṛśet // GarP_1,94.5 //
kaniṣṭhādeśinyaṅguṣṭhamūlānyagraṃ karasya ca /
prajāpatipitṛbrahmadevatīrthānyanukramāt // GarP_1,94.6 //
triḥ prāśyāpo dvirunmṛjya khānyādbhiḥ samupaspṛśet /
adbhistu prakṛtisthābhirhenābhiḥ phenabuhudaiḥ // GarP_1,94.7 //
hṛtkaṇṭhatālugābhistu yathāsaṃkhyaṃ dvijātayaḥ /
śudhyeraṃstrī ca śūdraśca sakṛtspṛṣṭābhirantataḥ // GarP_1,94.8 //
snānamabdaivatairmantrairmārjanaṃ prāṇasaṃyamaḥ /
sūryasya cāpyupasthānaṃ gāyattrayāḥ pratyayaṃ japaḥ // GarP_1,94.9 //
gāyattrīṃ śirasā sārdhaṃ japedvyāhṛtipūrvikām /
pratipraṇavasaṃyuktāṃ trirayaṃ prāṇasaṃyamaḥ // GarP_1,94.10 //
prāṇānāyamya samprokṣya tryṛcenābdaivatena tu /
japannāsīta sāvittrīṃ pratyagātārakodayāt // GarP_1,94.11 //
sandhyāṃ prāk prātarevaṃ hi tiṣṭhedāsūryadarśanāt /
agnikāryaṃ tataḥ kuryātsandhyayorubhayorapi // GarP_1,94.12 //
tato 'bhivādayedvṛdvānasāvahamiti bruvan /
guruṃ caivāpyupāsīta svādhyāyārthaṃ samāhitaḥ // GarP_1,94.13 //
sāhūtaścāpyadhīyīta sarvaṃ cāsmai nivedayet /
hitaṃ tasyācarennityaṃ manovākrāyakarmabhiḥ // GarP_1,94.14 //
daṇḍājinopavītāni mekhalāṃ caiva dhārayet /
brāhmaṇeṣu caredbhaikṣamanindyeṣvātmavṛttaye // GarP_1,94.15 //
ādimadhyāvasāneṣu bhavecchandopalakṣitā /
brāhmaṇakṣattriyaviśāṃ bhaikṣacaryā yathākramam // GarP_1,94.16 //
kṛtāgnikāryo bhuñjīta vinīto gurvanujñayā /
āpośānakriyāpūrvaṃ satkṛtyānnamakutsayan // GarP_1,94.17 //
brahmacāryāsthito naikamannamadyādanāpadi /
brāhmaṇaḥ kāmamaśrīyācchrāddhe vratamapaḍiyan // GarP_1,94.18 //
madhu māṃsaṃ tathā svinnamityādi parivarjayet /
sa gururyaḥ kriyāḥ kṛtvā vedamasmai prayacchati // GarP_1,94.19 //
upanīya dadātyenāmācāryaḥ sa prakīrtitaḥ /
ekadeśamupādhyāya ṛtvigyajñakṛducyate // GarP_1,94.20 //
ete mānyā yathāpūrvamebhyo mātā garīyasī /
prativedaṃ brahmacaryaṃ dvādaśābdāni pañca vā // GarP_1,94.21 //
grahaṇāntikamityeke keśāntaścaiva ṣoḍaśe /
āṣoḍaśā'dvāviṃśāccācaturviṃśācca vatsarāt // GarP_1,94.22 //
brahmakṣattraviśāṃ kāla aupanāyanikaḥ paraḥ /
ata ūrdhvaṃ patantyete sarvadharmavivarjitāḥ // GarP_1,94.23 //
sāvitrīpatitā vrātyā vrātyastomādṛte kratoḥ /
māturyadagre jāyante dvitīyaṃ mauñjabandhanam // GarP_1,94.24 //
brāhmaṇakṣattriya viśastasmādete dvijātayaḥ /
yajñānāṃ tapasāṃ caiva śubhānāṃ caiva karmaṇām // GarP_1,94.25 //
veda eva dvijātīnāṃ niḥ śreyasakaraḥ paraḥ /
madhunā payasā caiva sa devāṃstarpayeddvijaḥ // GarP_1,94.26 //
pitṝnmadhughṛtābhyāṃ ca ṛco 'dhīte hi so 'nvaham /
yajuḥ sāma paṭhettadvadatharvāṅgirasaṃ dvijaḥ // GarP_1,94.27 //
santarpayetpitṝndevānso 'nvahaṃ hi ghṛtāmṛtaiḥ /
vākovākyaṃ purāṇaṃ ca nārāśaṃsīśca gāthikāḥ // GarP_1,94.28 //
itihāsāṃstathā vidyā yo 'dhīte śaktito 'nvaham /
santarpayetpitṝndevānmāṃsakṣīrodanādibhiḥ // GarP_1,94.29 //
te tṛptāstarpayantyenaṃ sarvakāmaphalaiḥ śubhaiḥ /
yaṃyaṃ kratumadhītesau tasyasyāpnuyātphalam // GarP_1,94.30 //
bhūmidānasya tapasaḥ svādhyāyaphalabhāgdvijaḥ /
neṣṭhiko brahmacārī tu vasedācāryasannidhau // GarP_1,94.31 //
tadabhāve 'sya tanaye patnyāṃ vaiśvānare 'pi vā /
anena vidhinā dehe sādhayedvijitendriyaḥ /
brahmalokamavāpnoti na ceha jāyate punaḥ // GarP_1,94.32 //

ita śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākye ācārakāṇḍe yājñavalkyoktavarṇadharmanirūpaṇaṃ nāma caturnavatitamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 95
yājñavalkya uvāca /
śṛṇvantu munayo dharmān gṛhasthasya yatavratāḥ /
gurave ca dhanaṃ dattvā snātvā ca tadanujñayā // GarP_1,95.1 //
samāpitabrahmacaryo lakṣaṇyāṃ striyamudvahet /
ananyapūrvikāṃ kāntāmasapiṇḍāṃ yavīyasīm // GarP_1,95.2 //
arogiṇīṃ bhrātṛmatīmasamānārṣagotrajām /
pañcamātsaptamādūrdhvaṃ mātṛtaḥ pitṛtastathā // GarP_1,95.3 //
daśapūruṣavikhyātācchrotriyāṇāṃ mahākulāt /
savarṇaḥ śrotriyo vidvānvaro doṣānvito na ca // GarP_1,95.4 //
yaducyate dvijātīnāṃ śūdrāddāropasaṃgrahaḥ /
na tanmama mataṃ yasmāttatrāyaṃ jāyate svayam // GarP_1,95.5 //
tisro varṇānupūrvyeṇa dve tathaikā yathākramam /
brāhmaṇakṣattriyaviśāṃ bhāryāḥ svā śūdrajanmanaḥ // GarP_1,95.6 //
brāhmo vivāha āhūya dīyate śaktyalaṅkṛtā /
tajjaḥ punātyubhayataḥ puruṣonekaviṃśatim // GarP_1,95.7 //
yajñasthāyartvije daivamādāyārṣastu goyugam /
caturdaśa prathamajaḥ punātyuttarajaśca ṣaṭū // GarP_1,95.8 //
ityuktvā caratāṃ dharmaṃ saha yā dīyate 'rthine /
sa kāyaḥ pāvayettajjaḥ ṣaḍvaṃśyānātmanā saha // GarP_1,95.9 //
āsuro draviṇādānādgāndharvaḥ samayānmithaḥ /
rākṣaso yuddhaharaṇātpaiśācaḥ kanyakācchalāt // GarP_1,95.10 //
catvāro brāhmaṇasyādyāstathā gāndharvarākṣasau /
rājñastathāsuro vaiśye śūdre cāntyastu garhitaḥ // GarP_1,95.11 //
pāṇirgrāhyaḥ savarṇāsu gṛhṇīta kṣattriyā śaram /
vaiśyā pratodamādadyādvedane cāgrajanmanaḥ // GarP_1,95.12 //
pitā pitāmaho bhrātā sakulyo jananī tathā /
kanyāpradaḥ pūrvanāśe prakṛtīsthaḥ paraḥ paraḥ // GarP_1,95.13 //
aprayacchansamāpnoti bhrūṇahatyāmṛtāvṛtau /
eṣāmabhāve dātṝṇāṃ kanyā kuryāt svayaṃvaram // GarP_1,95.14 //
sakṛtpradīyate kanyā haraṃstāṃ coradaṇḍabhāk /
aduṣṭāṃ hi tyajandaṇḍyaḥ suduṣṭāṃ tu parityajet // GarP_1,95.15 //
aputrā gubapujñāto devaraḥ putrakānyagā /
sapiṇḍo vā samotro vā ghṛtābhyakta ṛtāviyāt // GarP_1,95.16 //
āgarbhasambhavaṃ gacchetpatitastvanyathā bhavet /
anena vidhinā jāta kṣetrapasya bhavetsutaḥ // GarP_1,95.17 //
hṛtādhikārāṃ malināṃ piṇḍamātropasevinīm /
paribhūtāmadhaḥ śayyāṃ vāsayedyvabhicāriṇīm // GarP_1,95.18 //
somaḥ śaucaṃ dadau tāsāṃ gandharvaśca subhāṃ giram /
pāvakaḥ sarvamedhyatvaṃ medhyā vai yoṣito yataḥ // GarP_1,95.19 //
vyabhicārādṛtauśuddhirgarbhetyāgaṃ karoti ca /
garbhabhartṛvadhe tāsāṃ tathā mahati pātake // GarP_1,95.20 //
surāpi vyādhitā dveṣṭrī vandhyārthaghnyapriyaṃvadā /
adhivinnā ca bhartavyā mahadenonyathā bhavet // GarP_1,95.21 //
yatrāvirodho dampatyostrivargastattra vardhate /
mṛte jīvati yā patyau yā nānyamupagacchati // GarP_1,95.22 //
seha kīrtimavāpnoti modate comayā saha /
śuddhāṃ tyajaṃstṛtīyāṃśaṃ dadyādāmaraṇaṃ striyāḥ // GarP_1,95.23 //
strībhirbharturvacaḥ kāryameṣa dharmaḥ paraḥ striyāḥ /
ṣoḍaśartuniśāḥ strīṇāṃ tāsu yugmāsu saṃviśet // GarP_1,95.24 //
brahmacārī ca parvāṇyādyāśtatastrastu varjayet /
evaṃ gacchaṃ striyaṃ kṣāmāṃ maghāṃ mūlāṃ ca varjayet // GarP_1,95.25 //
lakṣaṇyaṃ janayedeva putraṃ rogavivarjitam /
yathā kāmī bhavedvāpi strīṇāṃ (sma) valamanusmaran // GarP_1,95.26 //
svadāranirataścaiva striyo rakṣyā yatastataḥ /
bhartṛbhrātṛpitṛjñātiśvaśrūśvaśuradevaraiḥ // GarP_1,95.27 //
bandhubhiśca striyaḥ pūjyā bhūṣaṇācchādanāśanaiḥ /
saṃyato paskarā dakṣā hṛṣṭā vyayaparāṅmukhī // GarP_1,95.28 //
śvaśrūśvaśurayoḥ kuryātpādayorvandanaṃ sadā /
krīḍāśarīrasaṃskārasamājotsavadaśanam // GarP_1,95.29 //
hāsyaṃ paragṛhe yānaṃ tyajetpreṣitabhartṛkā /
rakṣetkanyāṃ pitā bālye yauvane patireva tām // GarP_1,95.30 //
vārdhakye rakṣate putro hyanyathā jñātayastathā /
patiṃ vinā na tiṣṭhettu divā vā yadi vā niśi // GarP_1,95.31 //
jyeṣṭhāṃ dharmavidhau kuryānna kaniṣṭhāṃ kadācana /
dāhayedagnihotreṇa striyaṃ vṛttavatīṃ patiḥ // GarP_1,95.32 //
āharedvidhivaddārānagniṃ caivāvilambitaḥ /
hitā bharturdivaṃ gacchediha kīrtīravāpya ca // GarP_1,95.33 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktagṛhalthadharmanirṇayo nāma pañcanavatitamo 'dhyāyaḥ


_____________________________________________________________


śrāgaruḍamahāpurāṇam- 96
yājñavalkya uvāca /
vakṣye saṅkarajātyādigṛhasthādi vidhiṃ param /
viprānmūrdhāvaṣikto hi kṣāttriyāyāṃ viśaḥ striyām // GarP_1,96.1 //
jāto 'mbaṣṭhastu śūdrāyāṃ niṣādaḥ parvato 'pi vā /
māhiṣyaḥ kṣattriyājjāto vaiśyāyāṃ mlecchasaṃjñitaḥ // GarP_1,96.2 //
śūdrāyāṃ karaṇo vaiśyādvinnāsveṣa vidhiḥ smṛtaḥ /
brāhmaṇyāṃ kṣattriyātsūto vaiśyādvaidehakastathā // GarP_1,96.3 //
śūdrājjātastu cāṇḍālaḥ sarvavarṇavigarhitaḥ /
kṣattriyā māgadhaṃ vaiśyācchūdrā kṣattārameva ca // GarP_1,96.4 //
śūdrādayogavaṃ vaiśyā janayāmāsa vai sutam /
māhiṣyeṇa karaṇyāṃ tu rathakāraḥ prajāyate // GarP_1,96.5 //
asatsantastu vai jñeyāḥ pratilomānulomajāḥ /
jātyutkarṣāddvijo jñeyaḥ saptame pañcame 'pi vā // GarP_1,96.6 //
vyatyaye karmaṇāṃ sāmyaṃ pūrvavaccottarāvaram /
karma smārtaṃ vivāhāgnau kurvīta pratyahaṃ gṛhī // GarP_1,96.7 //
dāyakālādṛte vāpi śrautaṃ vaitānikāgniṣu /
śarīracintāṃ nirvartya kṛtaśaucavidhirdvijaḥ // GarP_1,96.8 //
prātaḥ sandhyāmupāsīta dantadhāvanapūrvakam /
hutvāgnau saryadevatyāñjapenmantrānsamāhitaḥ // GarP_1,96.9 //
vedārthānadhigacchecca śāstrāṇi vividhāni ca /
yogakṣomādisiddhyarthamupeyādīśvaraṃ gṛhī // GarP_1,96.10 //
snātvā devānpitṝṃścaiva tarpayedarcayettathā /
vedānatha purāṇāni setihāsāni śaktitaḥ // GarP_1,96.11 //
japayajñānusiddhyarthaṃ vidyāṃ cādhyātmikīṃ japet /
balikarmasvadhāhomasvādhyāyātithisakriyāḥ // GarP_1,96.12 //
bhūtapitramarabrahmamanuṣyāṇāṃ mahāmakhāḥ /
devebhyastu hutaṃ cāgnau kṣipedbhūtabaliṃ haret // GarP_1,96.13 //
annaṃ bhūmauśvacāṇḍālavāyasebhyaśca niḥ kṣipet /
annaṃ pitṛmanuṣyebhyo deyamapyanvahaṃ jalam // GarP_1,96.14 //
svādhyāyamanvahaṃ kuryānna paceccānnamātmane /
bālasvavāsinīvṛddhagarbhiṇyāturakanyakāḥ // GarP_1,96.15 //
saṃbhojyātithibhṛtyāṃśca dampatyoḥ śeṣabhojanam /
prāṇāgnihotravidhināśrīyādannamakutsayan // GarP_1,96.16 //
mitaṃ vipākaṃ ca hitaṃ bhakṣyaṃ bālādipūrvakam /
āpośānenopariṣṭādadhastāccaiva bhujyate // GarP_1,96.17 //
anagnamamṛtaṃ caiva kāryamannaṃ dvijanmanā /
atithibhyastu varṇebhyo deyaṃ śaktyānupūrvaśaḥ // GarP_1,96.18 //
apraṇodyo 'tithiḥ sāyamapi nātra vicāraṇā /
satkṛtya bhikṣave bhikṣā dātavyā suvratāya ca // GarP_1,96.19 //
āgatān bhojayetsarvānmahokṣaṃ śrotriyāya ca /
pratisaṃvatsaraṃ tvarcyāḥ snātakācāryapārthivāḥ // GarP_1,96.20 //
priyo vivāhyaśca tathā yajñaṃ pratyṛrtvijaḥ punaḥ /
adhvanīno 'tithiḥ proktaḥ śrotriyo vedapāragaḥ // GarP_1,96.21 //
mānyāvetau gṛhasthasya brahmalokamabhīpsataḥ /
parapākarucirna syādanindyāmantraṇādṛte // GarP_1,96.22 //
vākpāṇipādacāpalyaṃ varjayaccātibhojanam /
śrotriyaṃ vātithiṃ tṛptamāsīmāntādanuvrajet // GarP_1,96.23 //
ahaḥ śeṣaṃ sahāsīta śiṣṭairiṣṭaiśca bandhubhiḥ /
upāsya paścimāṃ sandhyāṃ hutvāgnau bhojanaṃ tataḥ // GarP_1,96.24 //
kuryādbhatyaiḥ samāyuktaiścintayedātmano hitam /
brāhme muhūrte cotthāya mānyo vipro dhanādibhiḥ // GarP_1,96.25 //
vṛddhārtānāṃ samādeyaḥ panthā vai bhāravāhinām /
ijyādhyayanadānāni vaiśyasya kṣattriyasya ca // GarP_1,96.26 //
pratigraho 'dhiko vipre yājanādhyāpane tathā /
pradhānaṃ kṣattriye karma prajānāṃ paripālanam // GarP_1,96.27 //
kusīdakṛṣivāṇijyaṃ pāśupālyaṃ viśaḥ smṛtam /
śūdrasya dvijaśuśrūṣā dvijo yajñānna hāpayet // GarP_1,96.28 //
ahiṃsā satyamasteyaṃ śaucamindriyasaṃyamaḥ /
damaḥ kṣamārjavaṃ dānaṃ sarveṣāṃ dharmasādhanam // GarP_1,96.29 //
ācaretsadṛśīṃ vṛttimajihmāmaśaṭhāntathā /
traivārṣikā dhikānno yaḥ sa somaṃ pātumarhati // GarP_1,96.30 //
syādannaṃ vārṣikaṃ yasya kuryātprakasaumikīṃ kriyām /
pratisaṃvatsaraṃ somaḥ paśuḥ pratyayanaṃ tathā // GarP_1,96.31 //
kartavyā'grahaṇeṣṭiśca cāturmāsyāni yatnataḥ /
eṣāmasambhave kuryādiṣṭiṃ vaiśvānarīṃ dvijaḥ // GarP_1,96.32 //
hīnakalpaṃ na kurvīta sati dravye phalapradam /
caṇḍālo jāyate yajñakaraṇācchūdrabhikṣitāta // GarP_1,96.33 //
yajñārthalabdhaṃ nādadyādbhāsaḥ kāko 'pi vā bhavet /
kusūtakumbhīdhānyo vā tryāhikaḥ śvastano 'pi vā // GarP_1,96.34 //
jīvedvāpi śiloñchena śreyāneṣāṃ paraḥ paraḥ /
na svādhyāyavirodhyarthamīheta na yatastataḥ // GarP_1,96.35 //
rājāntevāsiyājyebhyaḥ sīdanniccheddhanaṃ kṣudhā /
dambhahaitukapāṣaṇḍibakavṛttīṃśca varjayet // GarP_1,96.36 //
śuklāmbaradharo nīcakeśaśmaśrunakhaḥ śuciḥ /
na bhāryādarśane 'śrīyānnaikavāsā na saṃsthitaḥ // GarP_1,96.37 //
apriyaṃ na vadejjātu brahmasūtrī vinītavān /
devapradakṣiṇāṅkuryādyaṣṭimānsakamaṇḍaluḥ // GarP_1,96.38 //
na tu mehennadīcchāyābhasmagoṣṭāmbuvartmasu /
na pratyagnyarkagosomasandhyāmbustrīdvijanmanām // GarP_1,96.39 //
nekṣetāgnyarkanagnāṃ strīṃ na ca saṃsṛṣṭamaithunām /
na ca mūtraṃ purīṣaṃ vā svapetpratyakūśirā na ca // GarP_1,96.40 //
ṣṭīvanāsṛkśakṛnmūtraviṣāṇyapsu na saṃkṣipet /
pādau pratāpayennāgnau na cainamabhilaṅghayet // GarP_1,96.41 //
pibennāñjalinā toyaṃ na śayānaṃ prabodhayet /
nākṣaiḥ krījecca kitavairvyādhitaiśca na saṃviśet // GarP_1,96.42 //
viruddhaṃ varjayetkama pretadhūmaṃ nadītaram /
keśabhasmatuṣāṅgārakapāleṣu ca saṃsthitim // GarP_1,96.43 //
nācakṣīta dhayantīṃ gāṃ nādvāreṇāviśetkracit /
na rājñaḥ pratigṛhṇāyāllubdhasyocchāstravartinaḥ // GarP_1,96.44 //
adhyāyānāmupākarma śrāvaṇyāṃ śravaṇena vā /
hastenauṣadhibhāve vā pañcamyāṃ śrāvaṇasya ca // GarP_1,96.45 //
pauṣamāsasya rohiṇyāmaṣṭakāyāmathāpi vā /
jalānte chandasāṃ kuryādutsargaṃ vidhivadvahiḥ // GarP_1,96.46 //
anadhyāyastryahaṃ prete śiṣyartviggurubandhuṣu /
upākarmaṇi cotsarge svaśākhaśrotriye mṛte // GarP_1,96.47 //
sandhyāgarjitanirghātabhūkampolkānipātane /
samāpya vedaṃ dyuniśamāraṇyakamadhītya ca // GarP_1,96.48 //
pañcadaśyāṃ caturdaśyāmaṣṭamyāṃ rāhusūtake /
ṛtusandhiṣu bhuktvā vā śrāddhikaṃ pratigṛhya ca // GarP_1,96.49 //
paśumaṇḍūkanakulaśvāhimārjārasūkaraiḥ /
kṛte 'ntare tvahorātraṃ śakrapāte tathocchraye // GarP_1,96.50 //
śvakroṣṭugardabholūkasāmabāṇārtaniḥ svane /
amedhyaśavaśūdrāntyaśmaśānapatitāntike // GarP_1,96.51 //
deśe 'śucāvātmani ca vidyutstanitasaṃplave /
bhuktvārdrapāṇirambho 'ntarardharātre 'timārute // GarP_1,96.52 //
digdāhe pāṃsuvarṣeṣu sandhyānī hārabhītiṣu /
dhāvataḥ pūtigandhe ca śiṣṭe ca gṛhamāgate // GarP_1,96.53 //
kharoṣṭrayānahastyaśvanauvṛkṣagirirohaṇe /
saptatriṃśadanadhyāyānetāṃstātkālikānviduḥ // GarP_1,96.54 //
vedadiṣṭaṃ tathācāryaṃ rājacchāyāṃ parastriyam /
nākrāmedraktaviṇmūtraṣṭhīvanodvartanāni ca // GarP_1,96.55 //
viprāhikṣattriyātmāno nāvajñeyāḥ kadācana /
dūrāducchiṣṭaviṇmūtrapādāmbhāṃsi samutsṛjet // GarP_1,96.56 //
śrutismṛtyuktamācāraṃ kuryānmarmaṇi na spṛśet /
na nindātāḍane kuryātsutaṃ śiṣyaṃ ca tāḍayet // GarP_1,96.57 //
ācaretsarvadā dharmaṃ tadviruddhaṃ tu nācaret /
mātāpitratithībhyāḍhyairvivādaṃ nācaredgṛhī // GarP_1,96.58 //
pañca piṇḍānanuddhṛtya na snāyātparavāriṣu /
snāyānnadīprastravaṇadevakhātahradeṣu ca // GarP_1,96.59 //
varjayetparaśayyādi na cāśrīyādanāpadi /
kadaryabaddhaco (vai) rāṇāṃ tathā cānamnikasya ca // GarP_1,96.60 //
vaiṇābhiśastavārdhuṣyagaṇikāgaṇadīkṣiṇām /
cikitsakāturakruddhaklībaraṅgopajīvinām // GarP_1,96.61 //
krūrograpatitavrātyadāmbhikocchiṣṭabhojinām /
śāstravikrayiṇaścaiva strījitagrāmayājinām // GarP_1,96.62 //
nṛśaṃsarājarajakakṛtaghnavadhajīvinām /
piśunānṛtinoścaiva somavikrayiṇastathā // GarP_1,96.63 //
bandināṃ svarṇakārāṇāmannameṣāṃ kadācana /
na bhoktavyaṃ vṛthā māṃsaṃ keśakīṭasamanvitam // GarP_1,96.64 //
bhaktaṃ paryuṣitocchiṣṭaṃ śvaspṛṣṭaṃ patito (te) kṣitam /
udakyāspṛṣṭasaṃghuṣṭamaparyāptaṃ ca varjayet // GarP_1,96.65 //
ghoghrātaṃ śakunocchiṣṭaṃ pādaspṛṣṭa ca kāmataḥ /
śūdreṣu dāsagopālakulamitrārdhasīriṇaḥ // GarP_1,96.66 //
bhojyānno nāpitaścaiva yaścātmānaṃ nivedayet /
annaṃ paryuṣitaṃ bhojyaṃ snehāktaṃ cirasaṃbhṛ (sthi) tam // GarP_1,96.67 //
asnehā api ghodhūmayavagorasavikriyāḥ /
auṣṭramaikaśaphaṃ strīṇāṃ payaśca parivarjayet // GarP_1,96.68 //
kravyādapakṣidātyūhaśukamāṃsāni varjayet /
sārasaikaśaphānhaṃsānbalākabakaṭiṭṭibhān // GarP_1,96.69 //
vṛthā kṛsarasaṃyāva pāyasāpūpaśaṣkulīḥ /
kuraraṃ jālapādaṃ ca khañjarīṭamṛgadvijān // GarP_1,96.70 //
cāṣānmatsyātraktapādañcagddhvā vai kāmato naraḥ /
ballūraṃ kāmato jagddhvā sopa vāsastryahaṃ bhavet // GarP_1,96.71 //
palāṇḍulaśunādīni jagddhvā cāndrāyaṇaṃ caret /
śrāddhe devānpitṝnprārcya khādanmāṃsaṃ na doṣabhāk // GarP_1,96.72 //
vasetsa narake ghora dināni paśuromataḥ /
saṃmitāni durācāro yo hantyavidhinā paśūn /
māṃsaṃ santyajya saṃprārthya kāmānyāti tato harim // GarP_1,96.73 //

iti śrīgāruje mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktaśrāddhanirūpaṇaṃ nāma ṣaṇṇavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 97
yājñavalkya uvāca /
dravyaśuddhiṃpravakṣyāmi tannibodhata sattamāḥ /
sauvarṇarājatābjānāṃ śaṅkharajjvādicarmaṇām // GarP_1,97.1 //
pātrāṇāṃ cāsanānāṃ ca vāriṇā śuddhiriṣyate /
uṣṇavābhaḥ strukstruvayordhānyādeḥ prokṣaṇena ca // GarP_1,97.2 //
takṣaṇāddāruśṛṅgāderyajñapātrasya mārjanāt /
soṣṇairudakagomūtraiḥ śudhyatyāvikakauśikam // GarP_1,97.3 //
bhaikṣyaṃ yoṣinmukhaṃ paśyanpunaḥ pākānmahīmayam /
gāghnāte 'nne tathā keśamakṣikākīṭadūṣite // GarP_1,97.4 //
bhasmakṣepādviśuddhiḥ syādbhūśuddhirmājanādinā /
trapusīsakatāmrāṇāṃ kṣārāmlodakavāribhiḥ // GarP_1,97.5 //
bhasmādbhirlohakāṃsyānāmajñātaṃ ca sadā śuci /
amedhyāktasya mṛttoyairgandhalepāpakarṣaṇāt // GarP_1,97.6 //
śuci gotṛptidaṃ toyaṃ prakṛtisthaṃ mahīgatam /
tathā māṃsaṃ śvacāṇḍālakravyādādinipātitam // GarP_1,97.7 //
raśmiragnī rajaśchāyā gauraśvo vasudhānilāḥ /
aśvājavipruṣo medhyā stathācamanabindavaḥ // GarP_1,97.8 //
snātvā pītvā kṣute supte bhuktvā rathyāprasarpaṇe /
ācāntaḥ punarācāmedvāso 'nyatparidhāya ca // GarP_1,97.9 //
kṣute niṣṭhīvite svāpe paridhāne 'śrupātane /
pañcasveteṣu nācāmeddakṣiṇaṃ śravaṇaṃ spṛśet /
tiṣṭhantyagnyādayo devā viprakarṇe tu dakṣiṇe // GarP_1,97.10 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktadravyaśuddhinirūpaṇaṃ nāma saptanavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 98
yājñavalkya uvāca /
atha dānividhiṃ vakṣye tanme śṛṇuta suvratāḥ /
anyebhyo brāhmaṇāḥ śreṣṭhāstebhyaścaiva kriyāparāḥ // GarP_1,98.1 //
brahmavettā ca tebhyo 'pi pātraṃ vidyāttapo 'nvitāḥ (tam) /
gobhūdhānyahiraṇyādi pātre dātavyamarcitam // GarP_1,98.2 //
vidyātapobhyāṃ hīnena na tu grāhyaḥ pratigrahaḥ /
gṛhṇanpradātāramadho nayatyātmānameva ca // GarP_1,98.3 //
dātavyaṃ pratyahaṃ pātre nimitteṣu viśeṣataḥ /
yācitenāpi dātavyaṃ śraddhāpūtaṃ tu śaktitaḥ // GarP_1,98.4 //
hemaśṛṅgī śaphaiḥ raupyaiḥ śuśīlā vastrasaṃyutā /
sakāṃsyāpātrā dātavya kṣīriṇī gauḥ sadakṣiṇā // GarP_1,98.5 //
daśasauvarṇikaṃ śṛṅgaṃ śaphaṃ saptapalaiḥ kṛtam /
pañcāśatpalikaṃ pātraṃ kāṃsyaṃ vatsasya kīrtyate // GarP_1,98.6 //
svarṇapippalapātreṇa vatso vā vatsikāpi vā /
asyā api ca dātavyamapatyaṃ rogavarjitam // GarP_1,98.7 //
dātā svargamavāpnoti vatsarānromasaṃmitān /
kaṣilā cetārayet bhūyaścāsaptamaṃ kulam // GarP_1,98.8 //
yāvadvatsasya dvau pādau mukhaṃ yonyāṃ pradṛśyate /
tāvadgauḥ pṛthivī jñeyā yāvadgarbhaṃ na muñcati // GarP_1,98.9 //
yathā kathañciddattvā gāndhenuṃ vādhenumeva vā /
arogāmaparikliṣṭāṃ dātā svarge mahīyate // GarP_1,98.10 //
śrāntasaṃvāhanaṃ rogiparicaryā surārcanam /
pādaśaucaṃ dvijocchiṣṭamārjanaṃ gāpradānavat // GarP_1,98.11 //
dvijāya yadabhīṣṭaṃ tu dattvā svargamavāpnuyāt /
bhūdīpāṃścānnavastrāṇi sarpirdattvā vrajecchiyam // GarP_1,98.12 //
gṛhadhānyacchatramālyavṛkṣayā naghṛtaṃ jalam /
śayyānulepanaṃ dattvā svargaloke mahīyate // GarP_1,98.13 //
brahmadātā brahmalokaṃ prāpnoti suradurlabham /
vedārthayajñaśāstrāṇi dharmaśāstrāṇi caiva hi // GarP_1,98.14 //
mūlyenāpi likhitvāpi brahmalokamavāpnuyāt /
etanmūlaṃ jagadyasmādasṛjatpūrvamīśvaraḥ // GarP_1,98.15 //
tasmātsarvaprayatnena kāryo vedārthasaṃgrahaḥ /
itihāsapurāṇaṃ vā likhitvā yaḥ prayacchati // GarP_1,98.16 //
brahmadānasamaṃ puṇyaṃ prāpnoti dviguṇonnatim /
lokāyataṃ kutarkaśca prākṛtamlecchabhāṣitam // GarP_1,98.17 //
na śrotavyaṃ dvijenaitadadho nayati taṃ dvijam /
samartho yo na gṛhṇīyāddātṛlokānavāpnuyāt // GarP_1,98.18 //
kuśāḥ śākaṃ payo gandhāḥ pratyākhyeyā na vāri ca /
ayacitāhṛtaṃ grāhyamapi duṣkṛtakarmaṇaḥ // GarP_1,98.19 //
anyatra kulaṭāṣaṇḍhapatitebhyo dviṣastathā /
devātithyarcanakṛte pitṛtṛptyarthameva ca /
sarvataḥ pratigṛhṇīyādātmatṛpsarthameva ca // GarP_1,98.20 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktadānadharmanirūpaṇaṃ nāmāṣṭanavatitamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 99
yājñavalkya uvāca /
atha śrāddhavidhiṃ vakṣye sarvapāpapraṇāśanam /
amāvasyāṣṭakāvṛddhikṛṣṇapakṣāyanadvayam // GarP_1,99.1 //
dravyaṃ brāhmaṇasampattirviṣuvatsūryasaṃkramaḥ /
vyatīpāto gajacchāyā grahaṇaṃ candrasūryayoḥ // GarP_1,99.2 //
śrāddhaṃ pratiruciścaiva śrāddhakālāḥ prakīrtitāḥ /
agniyaḥ sarvadeveṣu śrotriyo vedavidyuvā // GarP_1,99.3 //
vedārthavijjyeṣṭhasāmā trimadhustrisuparṇikaḥ /
svastrīya ṛtvigajāmātāyajyaśvaśuramātulāḥ // GarP_1,99.4 //
triṇāciketadauhitraśiṣyasambandhibāndhavāḥ /
karmaniṣṭhāstaponiṣṭhāḥ pañcāgnibrahmacāriṇaḥ // GarP_1,99.5 //
pitṛmātṛparāścaiva brāhmaṇāḥ śrāddhadevatāḥ /
rogī hīnātiriktāṅgaḥ kāṇaḥ paunarbhavastathā // GarP_1,99.6 //
avakīrṇyāda yo ye ca ye cācāravivarjitāḥ /
avaiṣṇavāśca te sarve na śrāddhārhāḥ kadācana // GarP_1,99.7 //
nimantrayecca pūrvedyurdvijairbhāvyaṃ ca saṃyataiḥ /
ājāntāṃścaiva pūrvāhnehyāsaneṣūpaveśayet // GarP_1,99.8 //
yugmāndeve tathā pitrye svapradeśeṣu śaktitaḥ /
dvau daiva prāgudak pitrye trīṇyekaṃ cobhayoḥ pṛthak // GarP_1,99.9 //
mātāmahānāmapyevaṃ tantraṃ vā vaiśvadevikam /
hastaprakṣālanaṃ dattvā viṣṭarārthe kuśānapi // GarP_1,99.10 //
āvāhya tadanujñāto viśvadevāsaityṛcā /
yavairannaṃ vikīryātha bhājane sapavitrake // GarP_1,99.11 //
śannodevyā payaḥ kṣiptvā yavo 'sīti yavāṃstathā /
yādivyā iti mantreṇa hasteṣveva viniḥ kṣipet // GarP_1,99.12 //
gandhodake tathā dīpamālyadāmapradīpakam /
apasavyaṃ tataḥ kṛtvā pitṝṇāmapradakṣiṇam // GarP_1,99.13 //
dviguṇāṃstu kuśāndattvā uśantastvetyṛcā pitṝn /
āvāhya tadanu jñāto japedāyantunastataḥ // GarP_1,99.14 //
yavārthastu tilaiḥ kāryaḥ kuryādarghyādi pūrvavat /
dattvārghyaṃ saṃstravāṃsteṣāṃ pātre kṛtvā vidhānataḥ // GarP_1,99.15 //
pitṛbhyaḥ sthānamasīti nyubjaṃ pātraṃ karotyadhaḥ /
agnau kariṣya ādāya pṛcchatyannaṃ ghṛplutam // GarP_1,99.16 //
kuruṣveti tathoktosau hutvāgnau pitṛyajñavat /
hutaśeṣaṃ pradadyācca bhājaneṣu samāhitaḥ // GarP_1,99.17 //
yathālābhopapanneṣu raupyeṣu ca viśeṣataḥ /
dattvānnaṃ pṛthivīpātramiti pātrābhimantraṇam // GarP_1,99.18 //
kṛtve daṃviṣṇurityevaṃ dvijāṅguṣṭhaṃ niveśayet /
savyāhṛtiṃ ca gāyattrīṃ madhuvātetyṛcastathā // GarP_1,99.19 //
japtvā yathāsukhaṃ vācyaṃ bhuñjīraṃste 'pi vāgyatāḥ /
annamiṣṭaṃ haviṣyaṃ ca dadyādakrodhanotvaraḥ // GarP_1,99.20 //
ātṛptestu pavitrāṇi japtvā pūrvajapaṃ tathā /
annamādāya tṛptāḥ sthaḥ śeṣaṃ caivānumantrya ca // GarP_1,99.21 //
tadannaṃ vikiredbhūmau dadyāccāpaḥ sakṛtsakṛt /
sarvamannamupādāya satilaṃ dakṣiṇāmukhaḥ // GarP_1,99.22 //
ucchiṣṭasannidhau piṇḍānpradadyātpitṛyajñavat /
mātāmahānāmapyavaṃ dadyādācamanaṃ tataḥ // GarP_1,99.23 //
svasti vācyaṃ tato dadyādakṣayyodakameva ca /
dattvā ca dakṣiṇāṃ śaktyā svadhākāramudāharet // GarP_1,99.24 //
vācyatāminyanujñātaḥ pitṛbhyaśca svadhocyatām /
viprairastu svadhetyukto bhūmau siñcettato jalam // GarP_1,99.25 //
prīyantāmiti cāhaivaṃ viśvedevyaṃ jalaṃ dadat /
dātāro no 'bhivardhantāṃ vedāḥ santatireva ca // GarP_1,99.26 //
śraddhā ca no mā vyagamadvahu deyaṃ ca no 'stviti /
ityutkrotkrā priyā vācaḥ praṇipatya visarjayet // GarP_1,99.27 //
vājevāje iti prītyā pitṛpūrvaṃ visarjanam /
yasmiṃste saṃstravāḥ pūrvamarghyapātre nipātitāḥ // GarP_1,99.28 //
pitṛpātraṃ taduttānaṃ kṛtvā viprānvisarjayet /
pradakṣiṇamanuvrajya bhuñjīta pitṛsevitam // GarP_1,99.29 //
brahmacārī bhavettāṃ tu rajanīṃ bhāryayā maha /
evaṃ pradakṣiṇaṃ kṛtvā vṛddhau nāndīmukhānapi // GarP_1,99.30 //
yajettadadhikarkandhūmiśrāḥ piṇḍā yaivaḥ śritāḥ /
ekoddiṣṭaṃ daivahīnaṃ ekānnaikapavitrakam // GarP_1,99.31 //
āvāhanāgnaukaraṇarahitaṃ tvapasavyavat /
upatiṣṭhatāmityakṣayyasthāne viprānvisarjayet // GarP_1,99.32 //
abhiraṇyatāṃ prabūyād bruyustebhiratāḥ sma ha /
gandho dakatilairmiśraṃ kuryātpātracatuṣṭayam // GarP_1,99.33 //
arghyārthaṃ pitṛpātreṣu pretapātraṃ prasecayet /
yesamānā iti dvābhyāṃ śeṣaṃ pūrvavadācaret // GarP_1,99.34 //
etatsapiṇḍīkaraṇamekoddiṣṭaṃ striyā api /
arvāk sapiṇḍīkaraṇaṃ yasya saṃvatsarādbhavet // GarP_1,99.35 //
tasyāpyannaṃ sodakumbhaṃ dadyātsaṃvatsaraṃ dvijaḥ /
piṇḍāṃśca goja viprebhyo dadyādgnau jale 'pi vā // GarP_1,99.36 //
haviṣyānnena vai māsaṃ pāyasena tu vatsaram /
mātsyahāriṇakaurabhraśākunacchāgapārṣataiḥ // GarP_1,99.37 //
aiṇarauravavā rāhaśāśamāṃsairyathākramam /
māsavṛddhyāpi tuṣyanti dattairiha pitāmahāḥ // GarP_1,99.38 //
dadyādvarṣātrayodaśyāṃ maghāsu ca na saṃśayaḥ /
pratipatprabhṛtiṣvevaṃ kanyā dīñchrāddhado labhet // GarP_1,99.39 //
śastreṇa nihatānāṃ tu caturdaśyāṃ pradīyate /
svargaṃ hyapatyamojaśca śauryaṃ kṣetraṃ balaṃ tathā // GarP_1,99.40 //
putraśraiṣṭyaṃ sa saubhāgyaṃ samṛddhiṃ mukhyatāṃ śubham /
pravṛttacakratāṃ caiva vāṇijyaprabhṛtīṃstathā // GarP_1,99.41 //
arogitvaṃ yaśo vītaśokatāṃ paramāṃ gatim /
dhanaṃ vidyāṃ ca vāksiddhiṃ kupyaṃ gojāvikaṃ tathā // GarP_1,99.42 //
aśvānāyuśca vidhivadyaḥ śrāddhaṃ saṃprayacchati /
kṛttikādibharaṇyantaṃ sa kāmānprāpnuyādimān // GarP_1,99.43 //
vastrādyāḥ prīṇayantyeva naraṃ śrāddhakṛtaṃ dvijāḥ /
āyuḥ prajā dhanaṃ vidyāṃ svargamokṣasukhāni ca // GarP_1,99.44 //
prayacchati yathā rājyaṃ prītyā nityaṃ pitāmahaḥ // GarP_1,99.45 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktaśrāddhavidhinirūpaṇaṃ nāma navanavatitamo 'dhyāyaḥ


_____________________________________________________________
śrāgaruḍamahāpurāṇam- 100
yājñavalkya uvāca /
vināyakopasṛṣṭasya lakṣaṇāni nibodhata /
svapne 'vagāhate 'tyarthaṃ jalaṃ muṇḍāṃśca paśyati // GarP_1,100.1 //
vimanā viphalārambhaḥ saṃsadityanimittataḥ /
rājā rājyaṃ kumārī ca patiṃ putraṃ ca gurviṇī // GarP_1,100.2 //
nāpnuyātsnāpanaṃ tasya puṇye 'hnividhipūrvakam /
gaurasarṣapakalkena sājyenotsāritasya tu // GarP_1,100.3 //
sarvauṣadhaiḥ sarvagandhairviliptaśirasastathā /
bhadrāsanopaviṣṭasya svasti vācyaṃ dvijāñchubhān // GarP_1,100.4 //
mṛttikāṃ rocanāṃ gandhān gugguluṃ cāpsu niḥ kṣipet /
yā āhṛtā ekavarṇaiścaturbhiḥ kalaśairhradāt // GarP_1,100.5 //
carmaṇyānuḍuhe rakte sthāpyaṃ bhadrāsane tathā /
sahasrākṣaṃ śatadhāramṛṣibhiḥ pāvanaṃ smṛtam // GarP_1,100.6 //
tena tvāmabhiṣiñcāmi pāvamānyaḥ punantu te /
bhagaṃ tu varuṇo rājā bhagaṃ sūryo bṛhaspatiḥ // GarP_1,100.7 //
bhagamindraśca vāyuśca bhagaṃ saptarṣayo daduḥ /
yatte keśeṣu daurbhāgyaṃ sīmante yacca mūrdhani // GarP_1,100.8 //
lalāṭe karṇayorakṣṇorāpastadghnuntu te sadā /
snātasya sārṣapaṃ tailaṃ snuveṇaudumbareṇa tu // GarP_1,100.9 //
juhuyānmūrdhani kuśānsavyena parigṛhya ca /
mitaścasamitaścaiva tathā śālakaṭaṅkaṭau // GarP_1,100.10 //
kuṣmāṇḍo rājaputraśca ante svāhāsamanvitaiḥ /
dadyāccatuṣpathe bhūmau kuśānāstīrya sarvaśaḥ // GarP_1,100.11 //
kṛtākṛtāṃstaṇḍulāṃśca palalaudanameva ca /
puṣpaṃ citraṃ sugandhaṃ ca surāṃ ca trividhāmapi // GarP_1,100.12 //
mūlakaṃ pūrikāpūpaṃ tathaivauṇḍerakastrajaḥ /
dadhi pāyasamannaṃ ca guḍapiṣṭaṃ samodakam // GarP_1,100.13 //
etānsarvānupāhṛtya bhūmau kṛtvā tataḥ śiraḥ /
ambikāmupatiṣṭhecca dadyādarghyaṃ kṛtāñjaliḥ // GarP_1,100.14 //
dūrvāsarṣapapuṣpaiśca putrajanmabhirantataḥ /
kṛtasvastyayanaṃ caiva prārthayedambikāṃ satīm // GarP_1,100.15 //
rūpaṃ dehi yaśodehi bhagaṃ bhagavati ! dehi me /
putrāndehi śriyaṃ dehi sarvānkāmāṃśca dehi me // GarP_1,100.16 //
brāhmaṇān bhojayetpaścācchuklavastrānulepanaiḥ /
vastrayugmaṅgurordadyāsaṃpūjya ca grahāṃstathā /
śreyaḥ karmaphalaṃ vindyātsūryārcanaratastathā // GarP_1,100.17 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkloktagaṇapatikalpanirūpaṇaṃ nāma śatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 101
yājñavalkya uvāca /
śrīkāmaḥ śāntikāmo vā grahadṛṣṭyabhicāravān /
grahayañjñaṃ samaṃ kuryādgahāścaite budhaiḥ smṛtāḥ // GarP_1,101.1 //
sūryaḥ somo maṅgalaśca budhaścaiva bṛhaspatiḥ /
śukraḥ śanaiścaro rāhuḥ keturgrahagaṇāḥ smṛtāḥ // GarP_1,101.2 //
tāmrakātsphāṭikādraktacandanātsvarṇakādubhau /
rajatādayasaḥ sīsātkāṃsyādvarṇānnibodhata // GarP_1,101.3 //
raktaḥ śuklastathā raktaḥ pītaḥ pītaḥ sitositaḥ /
kṛṣṇaḥ kṛṣṇaḥ kramādvarṇā dravyāṇi munayastataḥ // GarP_1,101.4 //
sthāpayedgahavarṇāni homārthaṃ pralikhetpaṭe /
snāpayeddhomayeccaiva grahadravyairvidhānataḥ /
suvarṇāni pradeyāni vāsāṃsi susumāni ca // GarP_1,101.5 //
gandhāśca balayaścaiva dhūpo deyaścagugguluḥ /
kartavyāstatra mantraiśca caravaḥ pratidaivatam // GarP_1,101.6 //
ākṛṣṇena imandevā agnirmūrdhādivaḥ kakut /
ubdudhyasveti juhuyādebhireva yathākramam // GarP_1,101.7 //
bṛhaspateparidīyeti sarve annātparisutam /
śannodevī kayānaśca ketuṅkraṇvanniti kramāt // GarP_1,101.8 //
arkaḥ palāśaḥ khadirastvapāmārgo 'tha pippalaḥ /
audumbaraḥ śamī dūrvā kuśāśca samidhaḥ kramāt // GarP_1,101.9 //
hotavyā madhusarpirbhyāṃ dadhnā caiva samanvitaḥ /
guḍaudanaṃ pāyasaṃ ca haviṣyaṃ kṣīraṣāṣṭikam // GarP_1,101.10 //
dadhyodanaṃ haviḥ pūpānmāṃsaṃ citrānnameva ca /
dadyādgahakramādetān grahebhyo bhājanaṃ tataḥ // GarP_1,101.11 //
dhenuḥ śaṅkhastathānaḍvānhema vāso hayastathā /
kṛṣṇā gaurāyasaṃ chāga etā vai dakṣiṇāḥ kramāt /
grahāḥ pūjyāḥ sadā yasmādrajyādi prāpyate phalam // GarP_1,101.12 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktagrahaśāntinirūpaṇaṃ nāmaikottaraśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 102
yājñavalkya uvāca /
vānaprasthāśramaṃ vakṣye tacchṛṇvantu maharṣayaḥ /
putreṣu bhāryāṃ niḥ kṣipya vanaṃ gacchetsahaiva vā // GarP_1,102.1 //
vānaprastho brahmacārī sāgniḥ sopāsanaḥ kṣamī /
aphālakṛṣṭenāgnīṃśca pitṛdevātithīṃstathā // GarP_1,102.2 //
bhṛtyāṃstu tarpayecchmaśrujaṭālomabhṛdātmavān /
dāntastriṣavaṇasnāyī nivṛttaśca pratigrahāt // GarP_1,102.3 //
svādhyāyavāndhyānaśīlaḥ sarvabhūtahita rataḥ (tiḥ) /
ahno māsasya madhye vā kuryādvārthaparigraham // GarP_1,102.4 //
kṛtaṃ tyajedāśvayuje yuñjetkālaṃ vratādinā /
pakṣe māse thavāśnīyāddantolūkhaliko bhavet // GarP_1,102.5 //
cāndrāyaṇī svapedbhūmau karma kuryātphalādinā /
grīṣme pañcāgnimadhyastho varṣāsu sthaṇḍileśayaḥ // GarP_1,102.6 //
ārdravāsāstu hemante yogābhyāsāddinaṃ nayet /
yaḥ kaṇṭakairvitudati candanairyaśca limpati /
akruddhaḥ parituṣṭaśca samastasya ca tasya ca // GarP_1,102.7 //

iti śrīgāruje mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktavānaprasthadharmanirūpaṇaṃ nāma dvyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 103
yājñavalkya uvāca /
bhikṣordharmaṃ pravakṣyāmitaṃ nibodhata sattamāḥ /
vanādgṛhādvā kṛtveṣṭiṃ sarvavedasadakṣiṇām // GarP_1,103.1 //
prājāpatyantadante 'pi agnimāropya cātmani /
sarvabhūtahitaḥ śāntastridaṇḍī sakamaṇḍaluḥ // GarP_1,103.2 //
sarvārāmaṃ parivrajya bhikṣārtho grāmamāśrayet /
apramattaścaredbhaikṣyaṃ sāyāhne nābhilakṣitaḥ // GarP_1,103.3 //
rohite bhikṣukairgrāme yātrāmātra malolupaḥ /
bhavetparamahaṃso vā ekadaṇḍī yamāditaḥ // GarP_1,103.4 //
siddhayogastyajandehamamṛtatvamihāpnuyāt /
dātātithipriyo jñānī gṛhī śrāddhe 'pimucyate // GarP_1,103.5 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktavānaprasthasannyāsadharmanirūpaṇaṃ nāma tryuttaraśatatamo 'dhyāyaḥ

_____________________________________________________________

śrāgaruḍamahāpurāṇam- 104
yājñavalkya uvāca /
narakātpatākodbhūtātkṣayātpāpasya kamaṇaḥ /
brahmahā śvā kharoṣṭraḥ syādbheko yakaḥ surāpyapi // GarP_1,104.1 //
svarṇacoraḥ kṛmiḥ kīṭaḥ tṛṇādirgurutalpagaḥ /
kṣayarogī śyāvadantaḥ kunakhī śipiviṣṭakaḥ // GarP_1,104.2 //
brahmahatyākramātsyuśca tatsarvaṃ vā śiśerbhavet /
annahartā mayāvī syānmūko vāgapahārakaḥ // GarP_1,104.3 //
dhānyahāryatiriktāṅgaḥ piśunaḥ pūtināsikaḥ /
tailāhārī tailapāyī pūtivaktrastu sūcakaḥ // GarP_1,104.4 //
brahmasvaṃ kanyakāṃ krītvā vane rakṣo bhavedvṛṣaḥ /
ratnahṛddhīnajātaḥ syātpatraśākaharaḥ śikhī // GarP_1,104.5 //
gucchaṃ cucundarī hṛtvā dhānyahṛnmūṣako bhavet /
phalaṃ kapiḥ paśūnhṛtvā tvajā kākaḥ payastathā // GarP_1,104.6 //
māṃsaṃ gṛdhraḥ paṭaṃ śvitrī cīrī lavaṇahārakaḥ /
yathākarma phalaṃ prāpya tiryaktvaṃ kālaparyayāt // GarP_1,104.7 //
jāyante lakṣaṇabhraṣṭā daridrāḥ puruṣādhamāḥ /
tato niṣkaluṣībhūtā kule mahati yoginaḥ // GarP_1,104.8 //
jāyante lakṣaṇopetā dhanadhānyasamanvitāḥ // GarP_1,104.9 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktakarmavipākanirūpaṇaṃ nāma caturuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 105
vihitasyānanuṣṭhānānninditasya ca sevanāt /
anigrahāccendriyāṇāṃ naraḥ patanamṛcchati // GarP_1,105.1 //
tasmādyatnena kartavyaṃ prāyaścittaṃ viśuddhaye /
evamasyāntarātmā ca lokaścaiva prasaditi // GarP_1,105.2 //
lokaḥ prasīdedātmaivaṃ prāyaścittairaghakṣayaḥ /
prāyaścittamakurvāṇāḥ paścāttāpavivarjitāḥ // GarP_1,105.3 //
narakānyānti pāpā vai mahārauravarauravān /
tāmistraṃ lohaśaṅkuṃ ca pūtigandhasamākulam // GarP_1,105.4 //
haṃsābhaṃ lohitodaṃ ca sañjīvananadīpatham /
mahānilayakākolamandhatāmistravāpanam // GarP_1,105.5 //
avīciṃ kumbhīpākaṃ ca yānti pāpā hyapuṇyataḥ /
brahmahā madyapaḥ steyī saṃyogī gurutalpagaḥ // GarP_1,105.6 //
gurunindā vedanindā brahmahatyāsame hyubhe /
niṣiddhabhakṣaṇaṃ jihmakriyācaraṇameva ca // GarP_1,105.7 //
rajasvalāmukhāsvādaḥ surāpānasamāni tu /
aśvaratnādiharaṇaṃ suvarṇasteyasaṃmitam // GarP_1,105.8 //
sakhibhāryākumārīṣu svayoniṣvantyajāsu ca /
sagotrāsu tathā strīṣu gurutalpasamaṃ smṛtam // GarP_1,105.9 //
pituḥ svasāraṃ mātuśca mātulānīṃ snuṣāma pi /
mātuḥ sapatnīṃ bhaginīmācāryatanayāṃ tathā // GarP_1,105.10 //
ācāryapatnīṃ svasutāṃ gacchaṃstu gurutalpagaḥ /
chittvā liṅgaṃ vadhastasya sakāmāyāḥ striyāstathā // GarP_1,105.11 //
govadho vrātyatāsteyamṛṇānāṃ ca parikriyā /
anāhitāgnitāpaṇyavikrayaḥ parivedanam // GarP_1,105.12 //
bhṛtyācādhyayanādānaṃ bhṛtakādhyā panantathā /
pāradāryaṃ pārivittyaṃ vārdhuṣyaṃ lavaṇakriyā // GarP_1,105.13 //
sacchūdraviṭkṣattrabandhorninditārthopajīvitā /
nāstikyaṃ vratalopaśca śūlyaṃ gośveva vikrayaḥ // GarP_1,105.14 //
pitṛmātṛsuhṛttyāgastaḍāgārāmavikrayaḥ /
kanyāyādūṣaṇa caiva parivindakayājanam // GarP_1,105.15 //
kanyāpradānaṃ tasyaiva kauṭilyaṃ vratalopanam /
ātmanor'the kriyārambho madyapastrīniṣevaṇam // GarP_1,105.16 //
svādhyāyāgnisutatyāgo bāndhavatyāga eva ca /
asacchāstrābhigamanaṃ bhāryātmaparivi krayaḥ // GarP_1,105.17 //
upapāpāni coktāni prāyaścittaṃ nibodhata /
śiraḥ kapāladhvajavān bhikṣāśī karma vedayan // GarP_1,105.18 //
brahmahā dvādaśa samā mitabhuk śuddhimāpnuyāt /
lomabhyaḥ svāheti ca vā lomaprabhṛti vai tanum // GarP_1,105.19 //
majjāntāṃ juhuyādvāpi svasvamantrairyathākramam /
śuddhiḥ syādbrāhmaṇatrāṇātkṛtvaivaṃ śuddhireva ca // GarP_1,105.20 //
nirātaṅkaṃ dvijaṃ gāṃ ca brāhmaṇārthe hato 'pi vā /
araṇye niyato juptvā triḥ kṛtvo vedasaṃhitām // GarP_1,105.21 //
sarasvatīṃ vā saṃsevyaṃ dhanaṃ pātre samarpayet /
yāgasthakṣattraviḍghāt caredbrahmahaṇo vratam // GarP_1,105.22 //
garbhahā vā yathāvarṇaṃ tathātreyīniṣū (sū) danam /
caredbratamahatvāpi ghātanārthamupāgataḥ // GarP_1,105.23 //
dviguṇaṃ savanasthe tu brāhmaṇe vratamācaret /
surāmbughṛtagomūtraṃ pītvā śuddhiḥ surāpiṇaḥ // GarP_1,105.24 //
agnivarṇaṃ ghṛtaṃ vāpi cīravāsa jaṭī bhavet /
vrataṃ brahmahaṇaḥ kuryātpunaḥ saṃskāramarhati // GarP_1,105.25 //
reteviṇmūtrapānācca surāpā brāhmaṇī tathā /
patilokaparibhraṣṭā gṛdhrī syātsūkarī śunī // GarP_1,105.26 //
svarṇahārī dvijo rājñe dattvā tu musalaṃ tathā /
karmaṇaḥ khyāpanaṃ kṛtvā hatastena bhavecchuciḥ // GarP_1,105.27 //
ātmatulyaṃ suvarṇaṃ vā dattvā śuddhimiyāddvijaḥ /
śayane sārdhamāyasyā yoṣitā nibhṛtaṃ svapet // GarP_1,105.28 //
ucchedya liṅgaṃ vṛṣaṇaṃ nairṛtyāmutsṛjoddiśi /
prājāpatyaṃ caretkṛcchraṃ samā vā gurutalpagaḥ // GarP_1,105.29 //
cāndrāyaṇaṃ vā trīnmāsanabhyasedvedasaṃhitām /
pañcagavyaṃ pibedgoghno māsamāsīta saṃyataḥ // GarP_1,105.30 //
goṣṭheśayo go 'nugāmī gopradānena śudhyati /
upapātakaśuddhiḥ syāccāndrāyaṇavratena ca // GarP_1,105.31 //
payasā vāpi māsena parākeṇāpi vā punaḥ /
ṛṣabhaikaṃ sahasraṃ gā dadyātkṣattravadhe pumān // GarP_1,105.32 //
brahmahatyāvrataṃ vāpi vatsaratritayaṃ caret /
vaiśyahābdaṃ ca (bdāṃśca) redetaddadyādvaikaśataṃ gavām // GarP_1,105.33 //
ṣaṇmāsācchūdrahā caitaddadyādvā dhenavo daśa /
apraduṣṭāṃ striyaṃ hatvā śūdrahatyāvrataṃ caret // GarP_1,105.34 //
mārjāragodhānakulapaśumaṇḍūkaghātanāt /
pibetkṣīraṃ tryahaṃ pāpī kṛcchraṃ vāpyadhikaṃ caret // GarP_1,105.35 //
gaje nīlānvṛṣānpañca śuke vatsaṃ dvihāyanam /
kharājameṣeṣu vṛṣo deyaḥ krauñce trihāyaṇaḥ // GarP_1,105.36 //
vṛkṣagulmalatāvīrucchedane japyamṛkśatam /
avakīrṇo bhavedgattvā brahmacārī ca yoṣitam // GarP_1,105.37 //
gardabhaṃ paśumālabhya nairṛtaṃ ca viśudhyati /
madhumāṃsāśane kāryaṃ kṛcchraṃ śeṣavratāni ca // GarP_1,105.38 //
kṛcchratrayaṃ guruḥ kuryānmriyet prahito yadi /
pratikūlaṃ guroḥ kṛtvā prasādyaiva viśudhyati // GarP_1,105.39 //
ripūndhānyapradānādyaiḥ snehādyairvāpyupakramet /
kriyamāṇopakāre ca mṛte vipre na pātakam // GarP_1,105.40 //
mahāpāpopapāpābhyāṃ yobhiśasto mṛṣā param /
abbhakṣo māsamāsīta sa jāpī niyatandriyaḥ // GarP_1,105.41 //
aniyukto bhrātṛbhāryāṃ gacchaṃścāndrāyaṇaṃ caret /
trirātrānte ghṛtaṃ prāśya gatvodakyāṃ śucirbhavet // GarP_1,105.42 //
goṣṭhe vasanbrahmacārī māsamekaṃ payovratī /
gāyattrījapyanirato mucyate 'satpratigrahāt // GarP_1,105.43 //
triḥ kṛcchramācaredvrātyayājako 'pi carannapi /
vedaplāvī yavāśyabdaṃ tyaktvā ca śaraṇāgatān // GarP_1,105.44 //
prāṇāyāmatrayaṃ kuryātkharayānoṣṭrayānagaḥ /
nagnaḥ snātvā ca suptvā ca gatvā caiva divā striyam // GarP_1,105.45 //
guruntvaṃ kṛtya huṅkṛtya vipraṃ nirjitya vāda taḥ /
prasādya taṃ ca munayastato hyupavaseddinam // GarP_1,105.46 //
vipre daṇḍodyame kṛcchramatikṛcchraṃ nipātane /
deśaṃ kālaṃ vayaḥ śaktiṃ pāpaṃ cāvekṣya yatnataḥ // GarP_1,105.47 //
prāyaścitaṃ prakalpyaṃ syādyatra yoktā tu niṣkṛtiḥ /
garbhatyāgo bhartṛnindā strīṇāṃ patanakāraṇam // GarP_1,105.48 //
eṣa grahāntike doṣaḥ tasmāttāṃ dūtarastyajet /
vikhyātadoṣaḥ kurvīta guroranumataṃ vratam // GarP_1,105.49 //
asaṃvikhyātadoṣastu rahasyaṃ vratamācaret /
trirātropoṣaṇo japtvā brahmahā tvaghamarṣaṇam // GarP_1,105.50 //
antarjale viśuddhe ca dattvā gāṃ ca payasvinīm /
lomabhyaḥ svāheti ṛcā divasaṃ mārutāśanaḥ // GarP_1,105.51 //
jale japtvā tu juhuyāccātvāriṃśadghṛtāhutīḥ /
trirātropoṣaṇo hutvā kūṣmāṇḍībhirghṛtaṃ śuciḥ // GarP_1,105.52 //
surāpaḥ svarṇahārī ca rudrajāpī jale sthitaḥ /
sahasraśīrṣājapyena mucyate gurutalpagaḥ // GarP_1,105.53 //
prāṇāyāmaśataṃ kuryātsarvapāpāpanuktye /
oṅkārābhiyutaṃ somasalilapraśanācchuciḥ // GarP_1,105.54 //
kṛtvopavāsaṃ retoviṇmūtrāṇāṃ prāśanedvijaḥ /
ajñānakṛtapāpasya nāśaḥ sandhyātraye kṛte // GarP_1,105.55 //
rudraikādaśajapyāddhi pāpanāśo bhaveddvijaiḥ /
vedābhyāsarataṃ śāntaṃ pañcayajñakriyāparam // GarP_1,105.56 //
na spṛśanti hā pāpāni cāśu smṛtvā hyapohitaḥ /
japtvā sahasragāyattrīṃ śucirbrahmahaṇādṛte // GarP_1,105.57 //
brahmacaryaṃ dayā kṣāntirdhyānaṃ satyamakalkatā /
ahiṃsā steyamādhurye damaścaite yamāḥ smṛtāḥ // GarP_1,105.58 //
snānamaunopavāsojyāsvādhyāyopasthanigrahaḥ /
tapo 'krodho gurorbhaktiḥ śaucaṃ ca niyamāḥ smṛtāḥ // GarP_1,105.59 //
pañcagavyaṃ tu gokṣīraṃ dadhimūtraśakṛdghṛtam /
jagdhvā parehnyupavasetkṛcchraṃ sāntapanaṃ caret // GarP_1,105.60 //
pṛthak sāntapanairdravyaiḥ ṣaḍahaḥ sopavāsakaḥ /
saptāhena tu kṛcchro 'yaṃ mahāsāntapanaḥ smṛtaḥ // GarP_1,105.61 //
parṇodumbararājīvabīlvapatrakuśodakaiḥ /
pratyekaṃ pratyahābhyastaiḥ parṇa kṛcchra udāhṛtaḥ // GarP_1,105.62 //
taptakṣīraghṛtāmbūnāmekaikaṃ pratyahaṃ pibet /
ekarātropavāsaśca taptakṛcchraśca pāvanaḥ // GarP_1,105.63 //
ekabhaktena naktena tathaivāyācitena ca /
upavāsena cakana pādakṛcchra udāhṛtaḥ // GarP_1,105.64 //
yathā kathañcittriguṇaḥ prajāpatyo 'yamucyate /
ayamevātikṛcchraḥ syātpāṇipūrṇāmbubhojanāt // GarP_1,105.65 //
kṛcchrātikṛcchraṃ payasā divasānekaviṃśatim /
dvādaśāhopavāsaiśca parākaḥ samudāhṛtaḥ // GarP_1,105.66 //
piṇyākācāmatakrāmbusaktūnāṃ prativāsaram /
ekaikamupavāsaśca kṛcchraḥ saumyo 'yamucyate // GarP_1,105.67 //
eṣāṃ trirātramabhyāsādekaikaṃ syādyathākramāt /
tulāpuruṣa ityeṣa jñeyaḥ pañcadaśāhikaḥ // GarP_1,105.68 //
tithipiṇḍāṃścaredvṛddhyā śukle śikhyaṇḍasaṃmitān /
ekaikaṃ hrāsayetkṛṣṇe piṇḍaṃ cāndrāyaṇaṃ caret // GarP_1,105.69 //
yathākathañcitpiṇḍānāṃ catvāriṃśacchatadvayam /
māsenaivopabhuñjīta cāndrāyaṇamathāparam // GarP_1,105.70 //
kṛtvā triṣavaṇaṃ snānaṃ piṇḍaṃ cāndrāyaṇaṃ caret /
pavitrāṇi japetpiṇḍān gāyattryā cābhimantrayet // GarP_1,105.71 //
anādiṣṭeṣu pāpeṣu śuddhiścāndrāyaṇena tu /
dharmārtho yaścaredetaccandrasyaiti salokatām // GarP_1,105.72 //
kṛcchrakṛddharmakāmastu mahatīṃ śriyamaśnute // GarP_1,105.73 //

iti śrāgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktaprāyaścittaviveko nāma pañcottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 106
yājñavalkya uvāca /
pretā (ta) śaucaṃ pravakṣyāmi tacchṛṇudhvaṃ yatavratāḥ /
ūnadvivarṣaṃ nikhanenna kuryādu dakaṃ tataḥ // GarP_1,106.1 //
ā śmaśānādanuvrajya itarairjñātibhiryutaḥ /
yamasūktaṃ tathā japyaṃ japadbhirlaukikāgninā // GarP_1,106.2 //
sa dagdhavya upetaścaidāhitāgnyāvṛtārthavat /
saptamāddaśamādvāpi jñātayo 'bhyupayāntyapaḥ // GarP_1,106.3 //
apanaḥ śośucadaghamanena pitṛdiṅmukhāḥ /
evaṃ mātāmahācāryapatnīnāṃ codakakriyāḥ // GarP_1,106.4 //
kāmodakāḥ putrasakhisvastrīyaśvaśurartvijaḥ /
nāmagotreṇa hyudakaṃ sakṛtsiñcanti vāgyatāḥ // GarP_1,106.5 //
pāṣaṇḍapatitānāṃ tu na kuryurudakakriyāḥ /
nabrahmacāriṇo vrātyā yoṣitaḥ kāmagāstathā // GarP_1,106.6 //
surāpyastvātmaghātinyo nāśaucodakabhājanāḥ /
tato na roditavyaṃ hi tvanityā jīvasaṃ sthitiḥ // GarP_1,106.7 //
kriyā kāryā yathāśakti tato gacchedgṛhānprati /
vidaśya nimbapatrāṇi niyatā dvāri veśmanaḥ // GarP_1,106.8 //
ācamyāthāgnimudakaṃ gomayaṃ gaurasarṣapān /
praviśeyuḥ samālabhya kṛtvāśmani padaṃ śanaiḥ // GarP_1,106.9 //
praveśanādikaṃ karma pretasaṃsparśanādapi /
īkṣatāṃ tatkṣaṇācchuddhiḥ pareṣāṃ snānasaṃyamāt // GarP_1,106.10 //
krītalabdhāśanā bhūmau svapeyuste pṛthakpṛthak /
piṇḍayajñakṛtā deyaṃ pretāyānnaṃ dinatrayam // GarP_1,106.11 //
jalamekāhamākāśe sthāpyaṃ kṣīraṃ tu mṛnmaye /
vaitānopāsanāḥ kāryāḥ kriyāśca śruticoditāḥ // GarP_1,106.12 //
ādantajanmanaḥ sadyaḥ ācūḍaṃ naiśikī smṛtā /
trirātramā vratādeśāddaśarātramataḥ param // GarP_1,106.13 //
trirātraṃ daśarātraṃ vā śāvamāśaucamucyate /
ūnadvivarṣa ubhayoḥ sūtakaṃ mātureva hi // GarP_1,106.14 //
antarā janmamaraṇe śeṣāhobhirviśudhyati /
daśa dvādaśa varṇānāṃ tathā pañcadaśaiva ca // GarP_1,106.15 //
triṃśaddināni ca tathā bhavati pretasūtakam /
ahastvadattakanyāsu bāleṣu ca viśodhanam // GarP_1,106.16 //
gurvantevāsyanūcānamātulaśrotriyeṣu ca /
anauraseṣu putreṣu bhāryāsvanyagatāsu ca // GarP_1,106.17 //
nivāsarājani tathā tadahaḥ śuddhikāra(ṇa)m /
hatānāṃ nṛpagoviprairanvakṣaṃ cātmaghātinām // GarP_1,106.18 //
viṣādyaiśca hatānāṃ ca nāśaucaṃ pṛthivīpateḥ /
satrivratibrahmacāridātṛbrahmavidāṃ tathā // GarP_1,106.19 //
dāne vivāhe yajñe ca saṃgrāme deśaviplave /
āpadyapi ca kaṣṭāyāṃ sadyaḥ śaucaṃ vidhīyate // GarP_1,106.20 //
kālo 'gniḥ karmamṛdvāyurmano jñānaṃ tapo japaḥ (lam) /
paścāttāṣo nirāhāraḥ sarveṣāṃ śuddhihetavaḥ // GarP_1,106.21 //
akāryakāriṇāṃ dānaṃ vego nadyāstu śuddhikṛt /
kṣāttreṇa karmaṇā jīvedviśāṃ vāpyāpadi dvijaḥ // GarP_1,106.22 //
phalasomakṣaumavīruddadhi kṣīraṃ ghṛtaṃ jalam /
tilodanarasakṣāramadhu lākṣā śṛtaṃ haviḥ // GarP_1,106.23 //
vastropalāsavaṃ puṣpaṃ śākamṛccarmapādukam /
eṇatvacaṃ ca kauśeyaṃ lavaṇaṃ māsameva ca // GarP_1,106.24 //
piṇyākamūlagandhāṃśca vaiśyavṛtto na vikrayet /
dharmārthaṃ vikrayaṃ neyāstilā dhānyena tatsamāḥ // GarP_1,106.25 //
lavaṇādi na vikrīyāttathā cāpadgato dvijaḥ /
hīnādvipro vigṛhṇaṃśca lipyate nārkavaddvijaḥ // GarP_1,106.26 //
kuryātkṛṣyādikaṃ tadvadavikreyā hayāstathā /
bubhukṣitastryaṃ sthitvā dṛṣṭvā vṛttivivarjitam /
rājā dharmyāṃ prakurvīta vṛttiṃ viprādikasya ca // GarP_1,106.27 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yājñavalkyoktāśaucāpadvṛttyornirūpaṇaṃ nāma paḍuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 107
sūta uvāca /
parāśaro 'bravīdvyāsaṃ dharmaṃ varṇāśramādikam /
kalpekalpe kṣayotpattyā kṣīyante nu prajādayaḥ // GarP_1,107.1 //
śrutiḥ smṛtiḥ sadācaro yaḥ kaścidve dakartṛkaḥ /
vedāḥ smṛtā brāhmaṇādau dharmā manvādibhiḥ sadā // GarP_1,107.2 //
dānaṃ kaliyuge dharmaḥ kartāraṃ ca kalau tyajet /
pāpakṛtyaṃ tu tatraiva śāpaṃ phalati varṣataḥ // GarP_1,107.3 //
ācārātprāpnuyātsarvaṃ ṣaṭ karmāṇi dinedine /
sandhyā snānaṃ japo homo devātithyādipūjanam // GarP_1,107.4 //
apūrvaḥ suvratī vipro hyapūrvā yatayastadā /
kṣattriyaḥ parasainyāni jitvā pṛthvīṃ prapālayet // GarP_1,107.5 //
vaṇik kṛṣyādi vaiśye syāddvijabhaktiśca śūdrake /
abhakṣyabhakṣaṇāccauryādagamyā gamanātpatet // GarP_1,107.6 //
kṛṣiṃ kurvandvijaḥ śrāntaṃ balīvardaṃ na vāhayet /
dinārdhaṃ snānayogādikārī viprāṃśca bhojayet // GarP_1,107.7 //
nirvapetpañca yajñāni krūre nindāṃ ca kārayet /
tilājyaṃ na vikrīṇita sūnāyajñamaghānvitaḥ // GarP_1,107.8 //
rājño dattvā tu ṣaḍbhāgaṃ devatānāṃ ca viṃśatim /
trayastriṃśacca viprāṇāṃ kṛṣikartā na lipyate // GarP_1,107.9 //
karṣakāḥ kṣattraviṭchūdrāḥ khale 'dattvā tu caurakaḥ /
dinatrayeṇa śudhyeta brāhmaṇaḥ pretasūtake // GarP_1,107.10 //
kṣattro daśāhādvaiśyāstu dvādaśāhānmāsi śūdrakaḥ /
yāti vipro daśāhāttu kṣattro dvādaśakāddināt // GarP_1,107.11 //
pañcadaśāhādvaiśyastu śūdro māsena śudhyati /
ekapiṇḍāstu dāyādāḥ pṛthagdvāraniketanāḥ // GarP_1,107.12 //
janmanā ca vipattau ca bhavetteṣāṃ ca sūtakam /
caturthe daśarātraṃ syātṣaṇṇiśāḥ puṃsi pañcame // GarP_1,107.13 //
ṣaṣṭhe catura hācchuddhiḥ saptame ca dinatrayam /
deśāntare mṛte bāle sadyaḥ śuddhiryato mṛte // GarP_1,107.14 //
ajātadantā ye bālā ye ca garbhādviniḥ sṛtāḥ /
na teṣāmagnisaṃskāro na piṇḍaṃ nodakakriyā // GarP_1,107.15 //
yadi garbho vipadyata stravate vāpi yoṣitaḥ /
yāvanmāsaṃ sthito garbhastāvaddināni sūtakam // GarP_1,107.16 //
ānāmakaraṇātsadya ācūḍāntādaharniśam /
āvratāttu trirātreṇa tadūrdhvandaśabhirdinaiḥ // GarP_1,107.17 //
ācaturthādbhavetstravaḥ pātaḥ pañcamaṣaṣṭhayoḥ /
brahmacaryā dagnihotrānnāśuddhiḥ saṅgavarjanāt // GarP_1,107.18 //
śilpinaḥ kāravo vaidyā dāsīdāsāśca bhṛtyakāḥ /
agnimāñchrotriyo rājā sadyaḥ śaucāḥ prakīrtitāḥ // GarP_1,107.19 //
daśāhācchudhyate mātā snānātsūte pitā śuciḥ /
saṅgātsūtau sūtakaṃ syādupaspṛśya pitā śuciḥ // GarP_1,107.20 //
vivāhotsavayajñeṣu antarā mṛtasūtake /
pūrvasaṃkalpitādanyavarjanaṃ ca vidhīyate // GarP_1,107.21 //
mṛtena śudhyate sūtiḥ mṛtavajjātakaṃ janau /
gograhādau vipannānāmekarātraṃ tu sūtakam // GarP_1,107.22 //
anāthapretavahanātprāṇāyāmena śudhyati /
pretaśūdrasya vahanāntrirātramaśucirbhavet // GarP_1,107.23 //
ātmaghātiviṣodvandhakṛmidaṣṭe na saṃskṛtiḥ /
gohataṃ kṛmidaṣṭaṃ ca spṛṣṭvā kṛcchreṇa śudhyati // GarP_1,107.24 //
aduṣṭāpatitaṃ bhāryā yauvane yā parityajet /
saptajanma bhavetstrītvaṃ vaidhavyaṃ ca punaḥ punaḥ // GarP_1,107.25 //
bālahatyā tvagamanādṛtau ca strī tu sūkari /
agamyā vratakāriṇyo bhraṣṭapānodakakriyāḥ // GarP_1,107.26 //
aurasaḥ kṣetrajaḥ putraḥ pitṛjau piṇḍadau pituḥ /
parivittestu kṛcchraṃ syātkanyāyāḥ kṛcchrameva ca // GarP_1,107.27 //
atikṛcchraṃ careddātā hotā cāndrāyaṇañcaret /
kubjavāmanaṣaṇḍeṣu gadgadeṣu jaḍeṣu ca // GarP_1,107.28 //
jātyandhabadhire mūke na doṣaḥ parivedane /
naṣṭe mṛte pravrajite klībe vā patite patau // GarP_1,107.29 //
pañcasvāpatsu nārīṇāṃ patiranyo vidhīyate /
bhartrā sahamṛtā nārī romābdāni vaseddivi // GarP_1,107.30 //
śvādidaṣṭastu gāyattryā japācchuddho bhavennaraḥ /
dāhyo lokāgninā vipraścāṇḍālādyairhato 'gnimān // GarP_1,107.31 //
kṣīraiḥ prakṣālya tasyāsthi svāgninā mantrato dahet /
pravāse tu mṛte bhūyaḥ kṛtvā kuśamayaṃ dahet // GarP_1,107.32 //
kṛṣṇājine samāstīrya ṣaṭ śatāni palāśajān /
śamīṃ śiśre viniḥ kṣipya araṇiṃ vṛṣaṇe kṣipet // GarP_1,107.33 //
kaṇḍaṃ dakṣiṇahaste tu vāmahaste tathopabhṛt /
pārśve tūlūkhalaṃ dadyātpṛṣṭhe tu musalaṃ dadet // GarP_1,107.34 //
ure niḥ kṣipya dṛṣadaṃ taṇḍulājyatilānmukhe /
śrotra ca prokṣaṇīṃ dādyadājyasthālīṃ ca cakṣuṣoḥ // GarP_1,107.35 //
karṇe netre mukhe ghrāṇe hiraṇyaśakalān kṣipet /
agnihotropakaraṇādbrahmalokagatirbhavet // GarP_1,107.36 //
asau svargāya lokāya svāhetyājyāhutiḥ sakṛt /
haṃsasārasakrauñcānāṃ cakravākaṃ ca kukruṭam // GarP_1,107.37 //
mayarameṣaghātī ca ahorātreṇa śudhyati /
pakṣiṇaḥ sakalānhatvā ahorātreṇa śudhyati // GarP_1,107.38 //
sarvāṃścatuṣpadānhatvā ahorātro ṣito japet /
śūdraṃ hatvā caretkṛcchramatikṛcchraṃ tu vaiśyahā /
kṣattraṃ cāndrāyaṇaṃ vipraṃ dvāviṃśātriṃśamāhare (vahe) t // GarP_1,107.39 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākye ācārakāṇḍe parāśaroktadharmanirūpaṇaṃ nāma saptottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 108
sūta uvāca /
nītisāraṃ pravakṣyāmi arthaśāstrādisaṃśritam /
rājādibhyo hitaṃ puṇyamāyuḥ svargādidāyakam // GarP_1,108.1 //
sadbhiḥ saṅgaṃ prakurvīta siddhikāmaḥ sadā naraḥ /
nāsadbhirihalokāya paralokāya vā hitam // GarP_1,108.2 //
varjayetkṣudrasaṃvādamaduṣṭasya tu darśanam /
virodhaṃ saha mitreṇa saṃprītiṃ śatrusevinā // GarP_1,108.3 //
mūrkhaśiṣyopadeśena duṣṭastrībharaṇena ca /
duṣṭānāṃ saṃprayogeṇa paṇḍito 'pyavasīdati // GarP_1,108.4 //
brāhmaṇaṃ bāliśaṃ kṣattramayoddhāraṃ viśaṃ jaḍam /
śūdramakṣarasaṃyuktaṃ dūrataḥ parivarjayet // GarP_1,108.5 //
kālena ripuṇāsandhiḥ kāle mitreṇa vigrahaḥ /
kāryakāraṇamāśritya kālaṃ kṣipati paṇḍitaḥ // GarP_1,108.6 //
kālaḥ pacati bhūtāni kālaḥ saṃharate prajāḥ /
kālaḥ supteṣu jāgarti kālo hi duratikramaḥ // GarP_1,108.7 //
kāleṣu harate vīryaṃ kāle garbhe ca vartate /
kālo janayate sṛṣṭiṃ punaḥ kālo 'pi saṃharet // GarP_1,108.8 //
kālaḥ sūkṣmagatirnityaṃ dvividhaśceha bhāvyate /
sthūlasaṃgrahacāreṇa sūkṣmacārāntareṇa ca // GarP_1,108.9 //
nītisāraṃ surendrāya imamūca bṛhaspatiḥ /
sarvajño yena cendro 'bhūddaityānhatvāpnuyāddivam // GarP_1,108.10 //
rājarṣibrāhmaṇaiḥ kāryaṃ devaviprādipūjanam /
aśvamedhena yaṣṭabyaṃ mahāpātakanāśanam // GarP_1,108.11 //
uttamaiḥ saha sāṅgatyaṃ paṇḍitaiḥ saha satkathām /
alubdhaiḥ saha mitratvaṃ kurvāṇo nāvasīdati // GarP_1,108.12 //
parīvādaṃ parārthaṃ ca parihāsaṃ parastriyam /
paraveśmani vāsaṃ ca na kurvīta kadācana // GarP_1,108.13 //
paro 'pi hitavābandhurbandhurapyahitaḥ paraḥ /
ahito dehajo vyādhirhitamāraṇyamauṣadham // GarP_1,108.14 //
sa bandhuryo hite yuktaḥ sa pitā yastu poṣakaḥ /
tanmitraṃ yatra viśvāsaḥ sa deśo yatra jīvyate // GarP_1,108.15 //
sa bhṛtyo yo vidheyastu tadbījaṃ yatprarohati /
sā bhāryā yā priyaṃ brūte sa putro yastu jīvati // GarP_1,108.16 //
sa jīvati guṇā yasya dharmo yasya sa jīvati /
guṇadharmavihīno yo niṣphala tasya jīvanam // GarP_1,108.17 //
sā bhāryā yā gṛhe dakṣā sā bhāryāyā priyaṃvadā /
sā bhāryā yā patiprāṇā sā bhāryā yā pativratā // GarP_1,108.18 //
nitya snātā sugandhā ca nityaṃ ca priyavādinī /
alpabhuktālpabhāṣī ca satataṃ maṅgalairyutā // GarP_1,108.19 //
satataṃ dharmabahulā satataṃ ca patipriyā /
satataṃ priyavakrī ca satataṃ tvṛtukāminī // GarP_1,108.20 //
etadādikriyāyuktā sarvasau bhāgyavardhinī /
yasyedṛśī bhavedbhāyyā sa devendrona mānuṣaḥ // GarP_1,108.21 //
yasya bhāryā virūpākṣī kaśmalā kalahapriyā /
uttarottaravādā syā sā jarā na jarā jarā // GarP_1,108.22 //
yasya bhāryā śritānyañca paraveśmābhikāṅkṣiṇī /
kukriyā tyaktalajjā ca sā jarā na jarā jarā // GarP_1,108.23 //
yasya bhāryā guṇajñā ca bhartāramanugāminī /
alpālpena tu santuṣṭā sā priyā na priyā priyā // GarP_1,108.24 //
duṣṭā bhāryā śaṭhaṃ mitraṃ bhṛtyaścottaradāyakaḥ /
sasarpe ca gṛhe vāsomṛtyureva na saṃśayaḥ // GarP_1,108.25 //
tyaja durjanasaṃsargaṃ bhaja sādhusamāgamam /
kuru puṇyamahorātra smara nityamanityatām // GarP_1,108.26 //
vyālīkaṇṭhapradeśāhyapi ca phaṇabhṛdbhāṣaṇā yā ca raudrī yā kṛṣṇā vyākulāgī rudhiranayanasaṃvyākulā vyāghrakalpā /
krodhe yaivogravaktrā sphuradanalaśikhā kākajihvā karālā sevyā na strī vidagdhā parapuragamanā bhrāntacittā virākta // GarP_1,108.27 //
saktiḥ sutoke sukṛtaṃ kṛtaghne śatiṃ ca vahnau (sītāpahau hyatapayaiva)?haime /
utpadyate daivavaśātkadācidveśyāsu rāgo na bhavetkadācit // GarP_1,108.28 //
bhujaṅgame veśmani dṛṣṭidṛṣṭe vyādhau cikitsāvinivartite ca /
dehe ca bālyādivayo 'nvite ca kālā vṛto 'sau labhate dhṛtiṃ kaḥ // GarP_1,108.29 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhaspatiproktanītisāranirūpaṇaṃ nāmāṣṭottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 109
sūta uvāca /
āpadarthe dhanaṃ rakṣeddārānrakṣeddhanairapi /
ātmānaṃ satataṃ rakṣeddārairapi dhanairapi // GarP_1,109.1 //
tyajedakaṃ kulasyārthe grāmasyārthe kulaṃ tyajet /
grāmaṃ janapadasyārthe ātmārthe pṛthivīṃ tyajet // GarP_1,109.2 //
varaṃ hi narake vāso na tu duścarite gṛhe /
narakātkṣīyate pāpa kugṛhānna nivartate // GarP_1,109.3 //
calatyekena pādena tiṣṭhatyekena buddhimān /
na parīkṣya paraṃ sthānaṃ pūrvamāyatanaṃ tyajet // GarP_1,109.4 //
tyajeddeśamasadvṛttaṃ vāsaṃ sopadravaṃ tyajet /
tyajetkṛpaṇarājānaṃ mitraṃ māyāmayaṃ tyajet // GarP_1,109.5 //
arthena kiṃ kṛpaṇahastagatena kena jñānena kiṃ bahuśaṭhāgrahasaṃkulena /
rūpeṇa kiṃ guṇaparākramavarjitena mitreṇa kiṃ vyasanakālaparāṅmukhena // GarP_1,109.6 //
adṛṣṭapūrvā bahavaḥ sahāyāḥ sarve padasthasya bhavanti mitrāḥ /
arthairvihīnasya padacyutasya bhavatyakāle svajano 'pi śatruḥ // GarP_1,109.7 //
āpatsu mitraṃ jānī yādraṇe śūraṃ rahaḥ śucim /
māryā ca vibhave kṣīṇe durbhikṣe ca priyātithim // GarP_1,109.8 //
vṛkṣaṃ kṣīṇaphalaṃ tyajanti vihagāḥ śuṣkaṃ saraḥ sārasānirdravyaṃ puruṣaṃ tyajanti gaṇikā bhraṣṭaṃ nṛpaṃ mantriṇaḥ /
puṣpaṃ paryuṣitaṃ tyajanti madhupāḥ dargdha vanāntaṃ mṛgāḥ sarvaḥ kāryavaśājjano hi ramate kasyāsti ko vallabhaḥ // GarP_1,109.9 //
lubdhamarthapradānena ślādhyamañjalikarmaṇā /
mūrkhaṃ chandānuvṛttyā ca yāthātathyena paṇḍitam // GarP_1,109.10 //
sadbhāvena hi tuṣyanti devāḥ satpuruṣā dvijāḥ /
itareḥ khādyapānena mānadānena paṇḍitāḥ // GarP_1,109.11 //
uttamaṃ praṇipātena śaṭhaṃ bhedena yojayet /
nīcaṃ svalpapradānena samaṃ tulyaparākramaiḥ // GarP_1,109.12 //
yasyayasya hi yo bhāvastasyatasya hitaṃ vadan /
anupraviśya medhāvī kṣipramātmavaśaṃ nayet // GarP_1,109.13 //
nadīnāṃ ca nakhīnāṃ ca śṛṅgiṇāṃ śastrapāṇinām /
viśvāso naiva gantavyaḥ striṣu rājakuleṣu ca // GarP_1,109.14 //
arthanāśaṃ manastāpaṃ gṛhe duścaritāni ca /
vañcanaṃ cāpa mānaṃ ca matimānna prikāśayet // GarP_1,109.15 //
hīnadurjanasaṃsarga atyantavirahādaraḥ /
sneho 'nyagehavāsaśca nārīsacchīlanāśanam // GarP_1,109.16 //
kasya doṣaḥ kule nāsti vyādhinā ko pīḍitaḥ /
kena na vyasanaṃ prāptaṃ śriyaḥ kasya nirantarāḥ // GarP_1,109.17 //
kor'thaṃ prāpya na garvito bhuvi naraḥ kasyāpadonāgatāḥ strībhiḥ kasya na khaṇḍitaṃ bhuvi manaḥ ko nāma rājñāṃ priyaḥ /
kaḥ kālasya na gocarāntaragataḥ kor'tho gato gauravaṃ ko vā durjanavāgurānipatitaḥ kṣemeṇa yātaḥ pumān // GarP_1,109.18 //
suhṛtsvajanabandhurna buddhiryasya na cātmani /
yasminkarmaṇi siddhe 'pi na dṛśyeta phalodayaḥ /
vipattau ca mahadduḥkhaṃ tadvudhaḥ kathamācaret // GarP_1,109.19 //
yasmindeśe na saṃmānaṃ na prītirna ca bāndhavāḥ /
na ca vidyāgamaḥ kaścittaṃ deśaṃ parivarjayet // GarP_1,109.20 //
dhanasya yasya rājato bhayaṃ na cāsti caurataḥ /
mṛtaṃ ca yanna mucyate samarjayasva taddhanam // GarP_1,109.21 //
yadarjitaṃ prāṇaharaiḥ pariśramairmṛtasya taṃ vai vibhajantirikthinaḥ /
kṛtaṃ ca yadduṣkṛtamarthalipsayā tadeva doṣopahatasya yautukam // GarP_1,109.22 //
sañcitaṃ nihitaṃ dravyaṃ parāmṛśyaṃ muhurmuhuḥ /
ākhoriva kadaryasya dhanaṃ duḥ khāya kevalam // GarP_1,109.23 //
nagnā vyasanino rūkṣāḥ kapālāṅkitapāṇayaḥ /
darśayantīha lokasya adātuḥ phalamīdṛśam // GarP_1,109.24 //
śikṣayanti ca yācante dehīti kṛpaṇā janāḥ /
avastheyamadānasya mā bhūdevaṃ bhavānapi // GarP_1,109.25 //
sañcitaṃ kratuśatairna yujyate yācitaṃ guṇavate na dīyate /
tatkadaryaparirakṣitaṃ dhanaṃ corapārthivagṛhe prayujyate // GarP_1,109.26 //
na devebhyo na viprobhyo bandhubhyo naiva cātmane /
kadaryasya dhanaṃ yāti tvagnitaskararājasu // GarP_1,109.27 //
atikleśena ye 'pyarthā dharmasyātikrameṇa ca /
arervā praṇipātena mā bhūtaste kadācana // GarP_1,109.28 //
vidyāghāto hyanabhyāsaḥ strīṇāṃ ghātaḥ kucailatā /
vyādhīnāṃ bhojanaṃ jīrṇaṃ śatrorghātaḥ prapañcatā // GarP_1,109.29 //
taskarasya vadho daṇḍaḥ kumitrasyālpabhāṣaṇam /
pṛthak śayyā tu nārīṇāṃ brāhmaṇasyānimantraṇam // GarP_1,109.30 //
durjanāḥ śilpino dāsā duṣṭāśca paṭahāḥ striyaḥ /
tāḍitā mārdavaṃ yānti na te satkārabhājanam // GarP_1,109.31 //
jānīyātpreṣaṇe bhṛtyānbāndhavānvyasanāgame /
mitramāpadi kāle ca bhāryāñca vibhavakṣaye // GarP_1,109.32 //
strīṇāṃ dviguṇa āhāraḥ prajñā caiva caturguṇā /
ṣaḍguṇo vyavasāyaśca kāmaścāṣṭaguṇaḥ smṛtaḥ // GarP_1,109.33 //
na svapnena jayennidrāṃ na kāmena striyaṃ jayet /
na cendhanairjayedvahniṃ na madyena tṛṣāṃ jayet // GarP_1,109.34 //
samāṃsairbhojanaiḥ snigdhairmadyairgandhavilepanaiḥ /
vastrairmanoramairmālyaiḥ kāmaḥ strīṣu vijṛmbhate // GarP_1,109.35 //
brahmacarye 'pi vaktavyaṃ prāptaṃ manmathaceṣṭitam /
hṛdyaṃ hi puruṣaṃ dṛṣṭvā yoniḥ praklidyate striyāḥ // GarP_1,109.36 //
suveṣaṃ puruṣaṃ dṛṣṭvā bhrātaraṃ yadi vā sutam /
yoniḥ klidyati nārīṇāṃ satyaṃsatyaṃ hi śaunaka ! // GarP_1,109.37 //
nadyaśca nāryaśca samasvabhāvāḥ svatantrabhāve gamanādikeca /
toyaiśca doṣaiśca nipātayanti nadyo hi kūlāni kulā ni nāryaḥ // GarP_1,109.38 //
nadī pātayate kūlaṃ nārī pātayate kulam /
nārīṇāñca nadīnāṃ ca svacchandā lalitā gatiḥ // GarP_1,109.39 //
nāgnistṛpyati kāṣṭhānāṃ nāpagānāṃ mahodadhiḥ /
nāntakaḥ sarvabhūtānāṃ na puṃsāṃ vāmalocanāḥ // GarP_1,109.40 //
na tṛptirasti śiṣṭānāmiṣṭānāṃ priyavādinām /
sukhānāñca sutānāñca jīvitasya varasya ca // GarP_1,109.41 //
rājā na tapto dhanasaṃcayena na sāgarastṛptimagājjalena /
na paṇḍitastṛpyati bhāṣitena tṛptaṃ na cakṣurnṛpadarśanena // GarP_1,109.42 //
svakarma dharmārjitajīvitānāṃ śāstreṣu dāreṣu sadā ratānām /
jitendriyāṇāmatithipriyāṇāṃ gṛhe 'pi mokṣaḥ puruṣottamānām // GarP_1,109.43 //
mano 'nukūlāḥ pramadārūpavatyaḥ svalaṅkṛtāḥ /
vasaḥ prāsādapṛṣṭheṣu svargaḥ syācchubhakarmaṇaḥ // GarP_1,109.44 //
na dānena na mānena nārjavena na savayā /
na śastreṇa na śāstreṇa sarvathā viṣamā striyaḥ // GarP_1,109.45 //
śanairvidyā śanairthāḥ śanaiḥ parvatamāruhet /
śanaiḥ kāmaṃ ca dharmaṃ ca pañcaitāni śanaiḥ śanaiḥ // GarP_1,109.46 //
śāśvataṃ devapūjādi vipradānaṃ ca śāśvatam /
śāśvataṃ saguṇā vidyā suhṛnmitraṃ ca śāśvatam // GarP_1,109.47 //
ye bālabhāvānna paṭhanti vidyāṃ ye yauvanasthā hyadhanātmadārāḥ /
te śocanīyā iha jīvaloke manuṣyarūpeṇa mṛgāścaranti // GarP_1,109.48 //
paṭhane bhojane cittaṃ na kuryācchāstrasevakaḥ /
sudūramapi vidyārtho vrajedgaruḍavegavān // GarP_1,109.49 //
ye bālabhāve na paṭhanti vidyāṃ kāmāturā yauvananaṣṭavittāḥ /
te vṛddhabāve paribhūyamānāḥ saṃdahyamānāḥ śiśire yathābjam // GarP_1,109.50 //
tarke 'pratiṣṭhā śrutayo vibhinnāḥ nāsāvṛṣiryasya mataṃ na bhinnam /
dharmasya tattvaṃ nihitaṃ guhāyāṃ mahājano yena gataḥ sa panthāḥ // GarP_1,109.51 //
ākārairiṅgitairgatyā ceṣṭayā bhāṣitena ca /
netravakravikārābhyāṃ lakṣyate 'ntargataṃ manaḥ // GarP_1,109.52 //
anuktamapyūhati paṇḍito janaḥ pareṅgitajñānaphalā hi buddhayaḥ /
udīritorthaḥ paśunāpi gṛhyate hayāśca nāgāśca vahanti darśitam // GarP_1,109.53 //
arthādbhraṣṭastīrthayātrāṃ tu gacchetsatyādbhraṣṭo rauravaṃ vai vrajecca /
yogādbhraṣṭaḥ satyaghṛtiñca gacchedrājyādbhraṣṭo mṛgayāyāṃ vrajecca // GarP_1,109.54 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhadṛ nītisāre navottaraśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 110
sūta uvāca /
yodhruvāṇi parityajya hyadhuvāṇi niṣevate /
dhruvāṇi tasya naśyanti hyadhruvaṃ naṣṭameva ca // GarP_1,110.1 //
vāgyantrahīnasya narasya vidyā śastraṃ yathā kāpuruṣasya haste /
na tuṣṭimutpādayate śarīre hyandhasya dārā iva darśanīyāḥ // GarP_1,110.2 //
bhojye bhojanaśaktiśca ratiśaktirvarastriyaḥ /
vibhave dānaśaktiśca nālpasya tapasaḥ phalam // GarP_1,110.3 //
agnihotraphalā vedāḥ śīlavṛttiphalaṃ śubham /
ratiputraphalā dārā dattabhuktaphalaṃ dhanam // GarP_1,110.4 //
varayetkulajāṃ prājño virūpāmapi kanyakām /
surūpāṃ sunitambāñca nākulīnāṃ kadācana // GarP_1,110.5 //
arthenāpi hi kiṃ tena yasyānarthe tu saṃgatiḥ /
ko hi nāma śikhājātaṃ pannagasya maṇiṃ haret // GarP_1,110.6 //
havirduṣṭakuladvāhyaṃ bālādapi subhāṣitam /
amedhyātkāñcanaṃ grāhyaṃ strīratnaṃ duṣkulādapi // GarP_1,110.7 //
viṣādapyamṛtaṃ grāhyamamedhyādapi kāñcanam /
nīcādapyuttamāṃ vidyāṃ strīratnaṃ duṣkulādapi // GarP_1,110.8 //
na rājñā saha mitratvaṃ na sarpo nirviṣaḥ kracit /
na kulaṃ nirmalaṃ tatra strījano yatra jāyate // GarP_1,110.9 //
kule niyojayedbhaktaṃ putraṃ vidyāsu yojayet /
vyasane yojayecchatrumiṣṭaṃ dharme niyojyet // GarP_1,110.10 //
sthāneṣveva prayoktāvyā bhṛtyāścābharaṇāni ca /
na hi cūḍāmaṇiḥ pāde śobhate vai kadācana // GarP_1,110.11 //
cūḍāmaṇiḥ samudro 'gnirghaṇṭā cākhaṇḍamambaram /
athavā pṛthivīpālo mūrdhni pāde pramādataḥ // GarP_1,110.12 //
kusumastabakasyeva dve gatī tu manasvinaḥ /
mūrdhni vā sarvalokānāṃ śīrṣataḥ patito vane // GarP_1,110.13 //
kanakabhūṣaṇasaṃgrahaṇocito yadi maṇistrapuṇi pratibadhyate /
na ca virauti na cāpi sa śobhate bhavati yojayiturvacanīyatā // GarP_1,110.14 //
vājivāraṇalauhānāṃ kāṣṭhapāṣāṇavāsasām /
nārīpuruṣatoyānāmantaraṃ mahadantaram // GarP_1,110.15 //
kadarthitasyāpi hi dhairyavṛtterna śakyate sarvaguṇapramāthaḥ /
adhaḥ khalenāpi kṛtasya vahnernādhaḥ śikhā yāti kadācideva // GarP_1,110.16 //
na sadaśvaḥ kaśāghātaṃ siṃho na gajagarjitam /
vīro vā paranirdiṣṭaṃ na sahedbhīmaniḥ svanam // GarP_1,110.17 //
yadi vibhavavihīnaḥ pracyuto vāśu daivānna tu khalajanasevāṃ kāṅkṣayennaiva nīcām /
na tṛṇamadanakārye sukṣudhārto 'tti siṃhaḥ pibati rudhiramuṣṇaṃ prāyaśaḥ kuñcarāṇām // GarP_1,110.18 //
sakṛdduṣṭañca yo mitraṃ punaḥ sandhātumicchati /
sa mṛtyumeva gṛhṇīyādgarbhamaśvatarī yathā // GarP_1,110.19 //
śatrorapatyāni priyaṃvadāni nopekṣitavyāni budhairmanuṣyaiḥ /
tānyeva kāleṣu vipatkarāṇi viṣasya pātrāṇyapi dāruṇāni // GarP_1,110.20 //
upakāragṛhītena śatruṇā śatrumuddharet /
pādalagnaṃ karasthena kaṇṭakenaiva kaṇṭakam // GarP_1,110.21 //
apakāraparānnityaṃ cinta yenna kadācana /
svayameva patiṣyanti kūlajātā iva drumāḥ // GarP_1,110.22 //
anarthā hyartharūṣāśca arthāścānartharūpiṇaḥ /
bhavanti te vināśāya daivāyattasya vai sadā // GarP_1,110.23 //
kāryakālocitāpāpā matiḥ sañjāyate hi vai /
sānukūle tu daive śaṃ puṃsaḥ sarvatra jāyate // GarP_1,110.24 //
dhanaprayogakāryeṣuḥ tathā vidyā gameṣu ca /
āhāre vyavahāre ca tyaktalajjaḥ sadā bhavet // GarP_1,110.25 //
dhaninaḥ śrotriyo rājā nadī vaidyastu pañcamaḥ /
pañca yatra na vidyante na kuryāttatratra saṃsthitim // GarP_1,110.26 //
lokayātrā bhayaṃ lajjā dākṣiṇyaṃ dānaśīlatā /
pañca yatra na vidyante na tatra divasaṃ vaset // GarP_1,110.27 //
kālavicchotriyo rājā nadī sādhuśca pañcamaḥ /
ete yatra na vidyante tatra vāsaṃ na kārayet // GarP_1,110.28 //
naikatra pariniṣṭhāsti jñānasya kila śaunaka /
sarvaḥ sarvaṃ na jānāti sarvajño nāsti kutracit // GarP_1,110.29 //
na sarvavitkaścidihāsti loke nātyantamūrkho bhuvi cāpi kaścit /
jñānena nīcottamamadhyamena yo 'yaṃ vijānāti sa tena vidvān // GarP_1,110.30 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhadṛ nītisāre daśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 111
sūta uvāca /
pārthivasya tu vakṣyāmi bhṛtyānāñcaiva lakṣaṇam /
sarvāṇi hi mahīpālaḥ samyaṅnityaṃ parīkṣayet // GarP_1,111.1 //
rājyaṃ pālayate nityaṃ satyadharmaparāyaṇaḥ /
nirjitya parasainyāni kṣitaṃ dharmeṇa pālayet // GarP_1,111.2 //
puṣpātpuṣpaṃ vicinvīta mūlacchedaṃ na kārayet /
mālākāra ivāraṇye na yathāṅgārakārakaḥ // GarP_1,111.3 //
dogdhāraḥ kṣīrabhuñjānā vikṛtaṃ tanna bhuñjate /
pararāṣṭraṃ mahīpālairbhoktavyaṃ na ca dūṣayet // GarP_1,111.4 //
nodhaśchindyāttu yo dhenvāḥ kṣārārtho labhate payaḥ /
evaṃ rāṣṭraṃ prayogeṇa pīḍyamānaṃ na vardhate // GarP_1,111.5 //
tasmātsarvaprayatnena pṛthivīmanupālayen /
pālakasya bhavedbhūmiḥ kīrtirāyuryaśo balam // GarP_1,111.6 //
ābhyarcya viṣṇuṃ dharmātmā gobrāhmaṇahite rataḥ /
prajāḥ pālayituṃ śaktaḥ pārthivo vijitendriyaḥ // GarP_1,111.7 //
aiśvaryamadhruvaṃ prāpya rājā dharme matiñcaret /
kṣaṇena vibhavo naśyennātmāyattaṃ dhanādikam // GarP_1,111.8 //
satyaṃ manoramāḥ kāmāḥ satyaṃ ramyā vibhūtayaḥ /
kintu vai vanitāpāṅgabhaṅgilolaṃ hi jīvitam // GarP_1,111.9 //
vyāghrīva tiṣṭhati jarā paritarjayantī rogāśca śatrava iva prabhavanti gātre /
āyuḥ paristravati bhinnaghaṭādivāmbho loko na cātmahitamācaratīha kaścit // GarP_1,111.10 //
niḥ śaṅkaṃ kiṃ manuṣyāḥ kuruta parahitaṃ yuktamagre hitaṃ yanmodadhvaṃ kāminībhirmadanaśarahatā mandamandātidṛṣṭyā /
mā pāpaṃ saṃkurudhvaṃ dvijahariparamāḥ saṃbhajadhvaṃ sadaiva āyurniḥ śeṣameti skhalati jalaghaṭībhūtamṛtyucchalena // GarP_1,111.11 //
mātṛvatparadāreṣu paradravyeṣu loṣṭavat /
ātmavat sarvabhūteṣu yaḥ paśyati sa paṇḍitaḥ // GarP_1,111.12 //
etadarthaṃ hi viprendrā rājyamicchanti bhūbhṛtaḥ /
yadeṣāṃ sarvakāryeṣu vaco na pratihanyate // GarP_1,111.13 //
etadarthaṃ hi kurvanti rājāno dhanasañcayam /
rakṣayitvā tu cātmānaṃ yaddhanaṃ taddvijātaye // GarP_1,111.14 //
oṅkāraśabdo viprāṇāṃ yena rāṣṭraṃ pravardhate /
sa rājā vardhate yogādvyādhibhiśca na badhyate // GarP_1,111.15 //
asamarthāśca kurvanti munayo dravyasañcayam /
kiṃ punastu mahīpālaḥ putravatpālayanprajāḥ // GarP_1,111.16 //
yasyārthāstasya mitrāṇi yasyārthāstasya bāndhavāḥ /
yasyārthāḥ sa mumāṃllāke yasyārthāḥ sa ca paṇḍitaḥ // GarP_1,111.17 //
tyajanti mitrāṇi dhanairvihīnaṃ putrāśca dārāśca suhṛjjanāśca /
te cārthavantaṃ punarāśrayanti hyartho hi loke puruṣasya bandhuḥ // GarP_1,111.18 //
andhā hi rājā bhavati yastu sāstravivarjitaḥ /
andhaḥ paśyati cāreṇa śāstrahīno na paśyati // GarP_1,111.19 //
yasya putrāśca bhṛtyāśca mantriṇaśca purohitāḥ /
indriyāṇi prasuptāni tasya rājyaṃ ciraṃ na hi // GarP_1,111.20 //
yenārjitāstrayo 'pyo 'pyete putrā bhṛtyāśca bāndhavāḥ /
jitā tena samaṃ bhūpaiścaturabdhirvasundharā // GarP_1,111.21 //
laṅghayecchāstrayuktāni hetuyuktāni yāni ca /
sahi naśyati vai rājā iha loke paratra ca // GarP_1,111.22 //
manastāpaṃ na kurvīta āpadaṃ prāpya pārthivaḥ /
samabuddhiḥ prasannātmā prasannātmā sukhaduḥkhe samo bhavet // GarP_1,111.23 //
dhīrāḥ kaṣṭamanuprāpya na bhavanti viṣādinaḥ /
praviśya vadanaṃ rāhoḥ kiṃ nodati punaḥ śaśī // GarP_1,111.24 //
dhigdhik śarīrasukhalālitamānaveṣu mā khedayeddhanakṛśaṃ hi śarīrameva /
saddārakā hyadhanapāṇḍusutāḥ śrutā hi duḥkhaṃ vihāya punareva sukhaṃ prapannāḥ // GarP_1,111.25 //
gandharvavidyāmālokya vādyaṃ ca gaṇikāgaṇān /
dhanurvedārthaśāstrāṇi loke rakṣecca bhūpatiḥ // GarP_1,111.26 //
kāraṇena vinā bhṛtye yastu kupyati pārthivaḥ /
sa gṛhṇāti viṣonmādaṃ kṛṣṇasarpavisarjitam // GarP_1,111.27 //
cāpalādvārayeddṛṣṭiṃ mithyāvākyañca vārayet /
mānave śrotriye caiva bhṛtyavarge sadaiva hi // GarP_1,111.28 //
līlāṃ karoti yo rājā bhṛtyasvajanagarvitaḥ /
śāsane sarvadā kṣipraṃ ripubhiḥ paribhūyate // GarP_1,111.29 //
huṅkāre bhṛkuṭīṃ naiva sadā kurvīta pārthivaḥ /
vinā doṣeṇa yo bhṛtyānrājādhamaṇa śāsti ca /
līlāsukhāni bhogyāni tyajediha mahīpatiḥ // GarP_1,111.30 //
sukhapravṛttaiḥ sādhyantai śatravo vigrahe sthitaiḥ // GarP_1,111.31 //
udyogaḥ sāhasaṃdhairyaṃ buddhiḥ śaktiḥ parākramaḥ /
ṣaḍvidho yasya utsāhastasya devo 'pi śaṅkate // GarP_1,111.32 //
udyogena kṛte kārye siddharyasya na vidyate /
daivaṃ tasya pramāṇaṃ hi kartavyaṃ pauruṣaṃ sadā // GarP_1,111.33 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhadṛ nītisāre ekādaśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 112
sūta uvāca /
bhṛtyā bahuvidhā jñeyā uttamādhamamadhyamāḥ /
niyoktavyā yathārheṣu trividheṣveva karmasu // GarP_1,112.1 //
bhṛtye parikṣaṇaṃ vakṣye yasyayasya hi yo guṇaḥ /
tamimaṃ saṃpravakṣyāmi ye yathākathitaṃ kila // GarP_1,112.2 //
yathā caturbhiḥ kanakaṃ parīkṣyate nigharṣaṇacchedanatāpatāḍanaiḥ /
tathā caturbhirbhṛtakaṃ parīkṣayedvatena śīlena kalena karmaṇā // GarP_1,112.3 //
kulaśīlaguṇopetaḥ satyadharmaparāyaṇaḥ /
rūpavānsuprasannaśca kośādhyakṣo vidhīyate // GarP_1,112.4 //
mūlyarūpaparīkṣākṛdbhave dratnaparīkṣakaḥ /
balābalaparijñātā senādhyakṣo vidhīyate // GarP_1,112.5 //
iṅgitākāratattvajño balavān priyadarśanaḥ /
apramādī pramāthī ca pratīhāraḥ sa ucyate // GarP_1,112.6 //
medhāvī vākpaṭuḥ prājñaḥ satyavādī jitendriyaḥ /
sarvaśāstrasamālokī hyeṣa sādhuḥ sa lekhakaḥ // GarP_1,112.7 //
buddhimānmatimāṃścaiva paracittopalakṣakaḥ /
krūro yathoktavādī ca eṣa dūto vidhīyate // GarP_1,112.8 //
samastasmṛtiśāstrajñaḥ paṇḍito 'tha jitendriyaḥ /
śauryavīryaguṇopeto dharmādhyakṣo vidhīyate // GarP_1,112.9 //
pitṛpaitāmaho dakṣaḥ śāstrajñaḥ satyavācakaḥ /
śuciśca kaṭhinaścaiva sūpakāraḥ sa ucyate // GarP_1,112.10 //
āyurvedakṛtābhyāsaḥ sarveṣāṃ priyadarśanaḥ /
āyuḥ śīlaguṇopeto vaidya eva vidhīyate // GarP_1,112.11 //
vedavedāṅgatattvajño japahamaparāyaṇaḥ /
āśīrvādaparo nityameṣa rājapurohita // GarP_1,112.12 //
lekhakaḥ pāṭhakaścaiva gaṇakaḥ pratirodhakaḥ /
ālasyayuktaścaidrājā karma saṃvarjayetsadā // GarP_1,112.13 //
dvijihvamudvegakaraṃ krūramekāntadāruṇam /
khalasyāheśca vadanamapakārāya kevalam // GarP_1,112.14 //
durjanaḥ parihartavyo vidyayālaṅkṛto 'pisan /
maṇinā bhūṣitaḥ sarpaḥ kimasau na bhayaṅkaraḥ // GarP_1,112.15 //
akāraṇaviṣkṛtakopadhāriṇaḥ khalādbhayaṃ kasya na nāma jāyate /
viṣaṃ mahāherviṣamasya durvacaḥ saduḥ sahaṃ sannipatetsadā mukhe // GarP_1,112.16 //
tulyārthaṃ tulyasāmarthyaṃ marmajñaṃ vyavasāyinam /
ardharājyaharaṃ bhṛtyaṃ yo hanyātsa na hanyate // GarP_1,112.17 //
śūratvayuktā mṛdumandavākyā jitendriyāḥ satyaparākramāśca /
prāgeva paścādviparī tarupā ye te tu bhṛtyā na hitā bhavanti // GarP_1,112.18 //
nirālasyāḥ susantuṣṭāḥ pratibodhakāḥ /
sukhaduḥ khasamā dhīrā bhṛtyā lokeṣu durlabhāḥ // GarP_1,112.19 //
kṣāntistayavihīnaśca krūrabuddhiśca nindakaḥ /
dāmbhikaḥ kapaṭī caiva śaṭhaśca spṛhayānvitaḥ /
aśakto bhayabhītaśca rājñā tyaktavya eva saḥ // GarP_1,112.20 //
susandhānāni cāstrāṇi śastrāṇi vividhāni ca /
durge praveśitavyāni tataḥ śatruṃ nipātayet // GarP_1,112.21 //
ṣaṇmāsamatha varṣaṃ vā sandhiṃ kuryānnarādhipaḥ /
paśyansañcitamātmānaṃ punaḥ śatruṃ nipātayet // GarP_1,112.22 //
mūrkhānniyojayedyastu trayo 'pyete mahīpateḥ /
ayaśaścārthanāśaśca narake caiva pātanam // GarP_1,112.23 //
yatkiñcitkurute karma śubhaṃ vā yādi vāśubham /
tena sma vardhate rājā sūkṣmato bhṛtyakāryataḥ // GarP_1,112.24 //
tasmādbhūmīśvaraḥ prājñaṃ dharmakāmārthasādhane /
niyoja yeddhisatataṃ gobrāhmaṇahitāya vai // GarP_1,112.25 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhaspatyukta nītiptāre dvādaśottarakaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 113
sūta uvāca /
guṇavantaṃ niyuñjīta guṇahīnaṃ vivarjayet /
paṇḍitasya guṇāḥ sarve mūrve doṣāśca kevalāḥ // GarP_1,113.1 //
sadbhirāsīta satataṃ sadbhiḥ kurvīta saṅgatim /
sadbhirvivādaṃ maitrīñca nāsadbhiḥ kiñcidācaret // GarP_1,113.2 //
paṇḍitaiśca virnātaiśca dharmaśaiḥ satyavādibhiḥ /
bandhstho 'pi tiṣṭhecca na tu rājye khalaiḥ saha // GarP_1,113.3 //
sāvaśeṣāṇi kāryāṇi kuvatrarthe yujyate /
tasmātsarvāṇi kāryāṇi sāvaśeṣāṇi kārayet // GarP_1,113.4 //
madhuheva duhetsāraṃ kusumañca na ghātayet /
vatsāpekṣī duhetkṣīraṃ bhūmiṃ gāñcaiva pārthipaḥ // GarP_1,113.5 //
yathākrameṇa puṣpebhyaścinute madhu ṣaṭpadaḥ /
tathā vittamu pādāya rājā kurvīta sañcayam // GarP_1,113.6 //
valmīkaṃ madhujālañca śuklaṇkṣe tu candramāḥ /
rājadravyañca bhaikṣyañca stokaṃstokaṃ pravardhate // GarP_1,113.7 //
arjitasya kṣayaṃ dṛṣṭā saṃpradattasya sañcayam /
avandhyaṃ divasaṃ kuryāddānadhyayanakarmasu // GarP_1,113.8 //
vane 'pi doṣāḥ prabhavanti rāgiṇāṃ gṛhe 'pi pañcendriyanigrahastapaḥ /
akutsite karmaṇi yaḥ pravartate nivṛttarāgasya gṛhaṃ tapovanam // GarP_1,113.9 //
satyena rakṣyate dharmo vidyā yogena rakṣyate /
mṛjayā rakṣyate pātraṃ kulaṃ śalina rakṣyate // GarP_1,113.10 //
varaṃ vindhyāṭavyāṃ nivasanamabhuktasya maraṇaṃ varaṃ sarpākīrṇe śayanamatha kūpe nipatanam /
varaṃ bhrāntāvarte sabhayajalamadhye praviśanaṃ na tu svīye pakṣe hi dhanamaṇu dehīti kathanam // GarP_1,113.11 //
bhāgyakṣayeṣu kṣīyante nopabhogena sampadaḥ /
pūrvārjite hi sukṛte na naśyanti kadācana // GarP_1,113.12 //
viprāṇāṃ bhūṣaṇaṃ vidyā pṛthivyā bhūṣaṇaṃ nṛpaḥ /
nabhaso bhūṣaṇaṃ candraḥ śīlaṃ sarvasya bhūṣaṇam // GarP_1,113.13 //
ete te candratulyāḥ kṣitipatitanayā bhīmasenārjunādyāḥ śurāḥ satyapratijñā dinakaravapuṣaḥ keśavenopagūḍhāḥ /
te vai duṣṭagrahasthāḥ kṛpaṇavaśagatā bhaikṣyacaryāṃ prayātāḥ ko vā kasminsamartho bhavati vidhivaśādbhrāmayetkarmarekhā // GarP_1,113.14 //
brahmā yena kulālavanniyamito brahmāṇḍabhāṇḍodare viṣṇuryena daśāvatāragahane kṣipto mahāsaṅkaṭe /
rudroyena kapālapāṇipuṭake bhikṣāṭanaṃ kāritaḥ sūryo bhrāmyati nityameva gagane taramai namaḥ karṇaṇe // GarP_1,113.15 //
dātā baliryācakako murārirdānaṃ mahī vipramukhasya madhye /
dattvā phalaṃ bandhanameva labdhaṃ namo 'stu te daiva yatheṣṭakāriṇe // GarP_1,113.16 //
mātā yadi bhavellakṣmīḥ pitā sākṣājjanārdanaḥ /
kubuddhau pratipattiścaittasmindaṇḍaḥ patetsadā // GarP_1,113.17 //
yenayena yathā yadvatpurā karma suniścitam /
tattadevāntarā bhuṅkte svayamāhitamātmanā // GarP_1,113.18 //
ātmanā vihitaṃ duḥ khamātmanā vihitaṃ sakham /
garbhaśayyāmupādāya bhuṅkte vai paurvadaihikam // GarP_1,113.19 //
na cāntarikṣe na samudramadhye na parvatānāṃ vivarapraveśe /
na mātṛmūrdhni pradhṛtastathāṅke tyaktuṃ kṣamaḥ karma kṛtaṃ naro hi // GarP_1,113.20 //
dugastrikūṭaḥ parikhā samudro rakṣāṃsi yodhāḥ paramā ca vṛttiḥ /
śāstrañca vai tūśanasā pradiṣṭaṃ sa rāvaṇaḥ kālavaśādvinaṣṭaḥ // GarP_1,113.21 //
yasminvayasi yatkāle yaddivā yacca vā niśi /
yanmuhūrte kṣaṇe vāpi tattathā na tadanyathā // GarP_1,113.22 //
gacchanti cāntarikṣe vā praviśanti mahītale /
dhārayanti diśaḥ sarvā nādattamupalabhyate // GarP_1,113.23 //
purādhītā ca yā vidyā purā dattañca yaddhanam /
purā kṛtāni karmāṇi hyagre dhāvanti dhāvataḥ // GarP_1,113.24 //
karmāṇyatra pradhānāni samyagṛkṣe śubhagrahe /
vasiṣṭhakṛtalagnāpi jānakī duḥ khabhājanam // GarP_1,113.25 //
sthūlajaṅgho yadā rāmaḥ śabdagāmī ca lakṣmaṇaḥ /
ghanakeśī yadā sītā trayaste duḥ khabhājanam // GarP_1,113.26 //
na pituḥ karmaṇā putraḥ pitā vā putrakarmaṇā /
svayaṃ kṛtena gacchanti svayaṃ baddhāḥ svakarmaṇā // GarP_1,113.27 //
karmajanyaśarīreṣu rogāḥ śarīramānasāḥ /
śarā iva patantīha vimuktā dṛḍhadhanvibhiḥ // GarP_1,113.28 //
anyathā śāstragārbhiṇyā dhiyā dhīror'thamīhate /
svāmivatprākkṛtaṃ karma vidadhāti tadanyathā // GarP_1,113.29 //
bālo yuvā ca vṛddhaśca yaḥ karoti śubhāśubham /
tasyāntasyāmavasthāyāṃ bhuṅkte janmanijanmani // GarP_1,113.30 //
anīkṣamāṇo 'pi naro videśastho 'pi mānavaḥ /
svakarmapātavātena nīyate yatra tatphalam // GarP_1,113.31 //
prāptavyamarthaṃ labhate manuṣyo devo 'pi taṃ vārayituṃ na śaktaḥ /
ato na śocāmi na vismayo me lalāṭalekhā na punaḥ prayāti (yadasmadīyaṃ na tu tat pareṣām // GarP_1,113.32 //
sarpaḥ kūpe gajaḥ skandhe bila ākhuśca dhāvati /
naraḥ śīghratarādeva karmaṇaḥ kaḥ palāyate // GarP_1,113.33 //
nālpā bhavati sadvidyā dīyamānāpi vardhate /
kūpasthamiva pānīyaṃ bhavatyeva bahūdakam // GarP_1,113.34 //
yer'thā dharmeṇa te satyā ye 'dharmeṇa gatāḥ śriyaḥ /
dharmārtho ca mahāṃlloke tatsmṛtvā hyarthakāraṇāt // GarP_1,113.35 //
annārtho yāni duḥ khāni karoti kṛpaṇo janaḥ /
tānyeva yadi dharmārtho na bhūyaḥ kleśabhājanam // GarP_1,113.36 //
sarveṣāmeva śaucānāmannaśaucaṃ viśiṣyate /
yo 'nnārthaiḥ śuciḥ śaucānna mṛdā vāriṇā śuciḥ // GarP_1,113.37 //
satyaṃ śaucaṃ manaḥ śaucaṃ śaucamindriyanigrahaḥ /
sarvabhūte dayā śaucaṃ jalaśaucañca pañcamam // GarP_1,113.38 //
yasya satyañca śaucañca tasya svargo na durlabhaḥ /
satyaṃ hi vacanaṃ yasya so 'śvamedhādviśiṣyate // GarP_1,113.39 //
mṛttikānāṃ sahasreṇa codakānāṃ śatena hi /
na śudhyati durācāro bhāvopahatacetanaḥ // GarP_1,113.40 //
yasya hastau ca pādau ca manaścaiva susaṃyatam /
vidyā tapaśca kīrtiśca sa tīrthaphalamaśnute // GarP_1,113.41 //
na prahṛṣyati saṃmānairnāvamānaiḥ prakupyati /
na kruddhaḥ paruṣaṃ brūyādetatsādhostu lakṣaṇam // GarP_1,113.42 //
daridrasya manuṣyasya prājñasya madhurasya ca /
kāle śrutvā hitaṃ vākyaṃ na kaścitparituṣyati // GarP_1,113.43 //
na mantrabalavīryeṇa prajñayā pauruṣeṇa ca /
alabhyaṃ labhyate martyaistatra kā parivedanā // GarP_1,113.44 //
ayācito mayā labdho punarmatpreṣaṇādgataḥ /
yatrāgatastatra gatastatra kā parivedanā // GarP_1,113.45 //
ekavṛkṣe sadā rātrau nānāpakṣisamāgamaḥ /
prabhāte 'nyadiśo yānti kā tatra parivedanā // GarP_1,113.46 //
ekasārthaprayātānā sarveṣāntatra gāminām /
yastvekastvarito yāti kā tatra parivedanā // GarP_1,113.47 //
avyaktādīni bhūtāni vyaktamadhyāni śaunaka /
avyaktanidhanānyenava kā tatra parivedanā // GarP_1,113.48 //
nāprāptakālo mriyate viddhaḥ śaraśatairapi /
kuśāgreṇa tu saṃspṛṣṭaṃ prāptakālo na jīvati // GarP_1,113.49 //
labdhavyānyeva labhate gantavyānyeva gacchati /
prāptavyānyeva prāpnāti duḥ khāni ca sukhāni ca // GarP_1,113.50 //
tattatprāpnoti puruṣaḥ ki pralāpaiḥ kariṣyati /
ācodyamānāni yathā puṣpāṇi ca phalāni ca /
svakālaṃ nātivartante tathā karma purākṛtam // GarP_1,113.51 //
śīlaṃ kulaṃ naiva na caiva vidyā jñānaṃ guṇā naiva na bījaśuddhiḥ /
bhāgyāni pūrvaṃ tapasārjitāni kāle phalantyasya yathaiva vṛkṣāḥ // GarP_1,113.52 //
tatra mṛtyuryatra hantā tatra śrīryatra sampadaḥ /
tatra tatra svayaṃ yāti preryamāṇaḥ svakarmabhiḥ // GarP_1,113.53 //
bhūtapūrvaṃ kṛtaṃ karma kartāramanutiṣṭhati /
yathā dhenusahasreṣu vatso vindanti mātaram // GarP_1,113.54 //
evaṃ pūrvakṛtaṃ karma kartāramanutiṣṭhāti /
sukṛtaṃ bhuṅkṣva cātmīyaṃ mūḍha kiṃ paritapyase // GarP_1,113.55 //
yathā pūrvakṛtaṃ karma śubhaṃ vā yadi vāśubham /
tathā janmāntare tadvai kartā ramanugacchati // GarP_1,113.56 //
nīcaḥ sarṣapamātrāṇi paracchidrāṇi paśyati /
ātmano balivamātrāṇi paśyannapi na paśyati // GarP_1,113.57 //
rāgadveṣādiyuktānāṃ na sukhaṃ kutraciddvija /
vicārya khalu paśyāmi tatsukhaṃ yatra nirvṛtiḥ // GarP_1,113.58 //
yatra sneho bhayaṃ tatra sneho duḥ khasya bhājanam /
snehamūlāni duḥ khāni tasmistyakte mahatsukham // GarP_1,113.59 //
śarīramevāyatanaṃ duḥ khasya ca sukhasya ca /
jīvitañca śarīrañca jātyaiva saha jāyate // GarP_1,113.60 //
sarvaṃ paravaśaṃ duḥ khaṃ sarva mātmavaśaṃ sukham /
etadvidyātsamāsena lakṣaṇaṃ sukhaduḥ khayoḥ // GarP_1,113.61 //
sukhasyānantaraṃ duḥ khaṃ duḥ khasyānantaraṃ sukham /
śukhaṃ duḥ khaṃ manuṣyāṇāṃ cakravatparivartate // GarP_1,113.62 //
yadgataṃ tadatikrāntaṃ yadi syāttacca dūrataḥ /
vartamānena varteta na sa śokena bādhyate // GarP_1,113.63 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhadṛ nītisāre trayośottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 114
sūta uvāca /
na kaścitkasyacinmitraṃ na kaścitkasyacidripuḥ /
kāraṇādeva jāyante mitrāṇi ripavastathā // GarP_1,114.1 //
śokatrāṇaṃ bhayatrāṇaṃ prītiviśvāsabhājanam /
kena ratnāṃmadaṃ sṛṣṭaṃ mitramityakṣaradvayam // GarP_1,114.2 //
sakṛduccaritaṃ yena harirityakṣaradvayam /
baddhaḥ parikarastena mokṣāya gamanaṃ prati // GarP_1,114.3 //
na mātari na dāreṣu na sodarye na cātmaje /
viśvāsastādṛśaḥ puṃsāṃ yādṛṅmitre svabhāvaje // GarP_1,114.4 //
yadicchecchāśvatīṃ prītiṃ trīndoṣānparivarjayet /
dyutamarthaprayogañca parokṣe dāradarśanam // GarP_1,114.5 //
mātrā svastrā duhitrā vā na viviktāsano vaset /
balavānindriyagrāmo vidvāṃsamapi karṣati // GarP_1,114.6 //
viparītaratiḥ kāmaḥ svāyateṣu na vidyate /
yathopāyo vadho daṇḍastathaiva hyanu vartate // GarP_1,114.7 //
api kalpānilasyaiva turagasya mahodadheḥ /
śakyate prasaro boddhuṃ na hyaraktasye catasaḥ // GarP_1,114.8 //
kṣaṇo nāsti raho nāsti na sti prārthayitā janaḥ /
tena śaunaka nārīṇāṃ satītvamupajāyate // GarP_1,114.9 //
eka vai sevate nityamanyaścetapi rocate /
puruṣāṇāmalābhena nārī caiva pativratā // GarP_1,114.10 //
jananī yāni kurute rahasyaṃ madanāturā /
sutaistāni na cintyāni śīlavipratipattibhiḥ // GarP_1,114.11 //
parādhīnā nidrā paradṛdayakṛtyānusaraṇaṃ sadā helā hāsyaṃ niyatamapi śokena rahitam /
paṇe nyastaḥ kāyo viṭajanakhurairdāritagalo bahūtkaṇṭhavṛtirjagati gaṇikrāyā bahumataḥ // GarP_1,114.12 //
agnirāpaḥ striyo mūrkhāḥ sarpā rājakulāni ca /
nityaṃ paropasevyāni sadyaḥ prāṇaharāṇi ṣaṭ // GarP_1,114.13 //
kiṃ citraṃ yadi veda (śabda) śāstrakuśalo vipro bhavetpaṇḍitaḥ kiṃ citraṃ yadi daṇḍanītikuśalo rājā bhaveddhārmikaḥ /
kiṃ citraṃ yadi rūpayauvanavatī sādhvī bhavetkāminī taccitraṃ yadi nirdhano 'pi puruṣaḥ pāpaṃ na kuryātkracit // GarP_1,114.14 //
nātmacchidraṃ pare dadyādvidyācchidraṃ parasya ca /
gūhetkūrma ivāṅgāni parabhāvañca lakṣayet // GarP_1,114.15 //
pātālatalavā sinya uccaprākārasaṃsthitāḥ /
yadi no cikurodbhedāllabhyante kaiḥ striyo na hi // GarP_1,114.16 //
samadharmā hi marmajñastīkṣṇaḥ svajanakaṇṭakaḥ /
na tathā bādhate śatruḥ kṛtavairo bahiḥ sthitaḥ // GarP_1,114.17 //
sa paṇḍito yo hyanuñjayedvai miṣṭena bālaṃ viniyena śiṣṭam /
arthena nārīṃ tapasā hi devānsarvāṃśca lokāṃśca susaṃgraheṇa // GarP_1,114.18 //
chalena mitraṃ kaluṣeṇa dharmaṃ paropatāpena samṛddhibhāvanam /
sukhena vidyāṃ puruṣeṇa nārīṃ vāñchanti vai ye na ca paṇḍitāste // GarP_1,114.19 //
phalārtho phalinaṃ vṛkṣaṃ yaśchindyāddurmatirnaraḥ /
niṣphalaṃ tasya vai kāryāṃ mahādoṣamavāpnuyāt // GarP_1,114.20 //
sadhano hi tapasvī ca dūrato vai kṛtaśramaḥ /
madyapa strī satītyevaṃ vipra na śraddadhāmyaham // GarP_1,114.21 //
na viśvasedaviśvaste mitrasyāpi na viśvaset /
kadācitkupitaṃ mitraṃ sarvaṃ guhyaṃ prakāśayet // GarP_1,114.22 //
sarvabhūteṣu viśvāsaḥ sarvabhūteṣu sāttvikaḥ /
svabāvamātmanā gūhedetatsādhorhi lakṣaṇam // GarP_1,114.23 //
yasminkasminkṛte kārye kartāramanuvartate /
sarvathā vartamāno 'pi dhairyabuddhintu kārayet // GarP_1,114.24 //
vṛddhāḥ striyo navaṃ madyaṃ śuṣkaṃ māṃsaṃ trimūlakam /
rātrau dadhi divā svapnaṃ vidvānṣaṭ parivarjayet // GarP_1,114.25 //
viṣaṃ goṣṭhī daridrasya vṛddhasya taruṇī viṣam /
viṣaṃ kuśikṣitā vidyā ajīrṇe bhojanaṃ viṣam // GarP_1,114.26 //
priyaṃ gānamakuṇṭhasya nīcasyoccāsanaṃ priyam /
priyaṃ dānaṃ daridrasya bhūnaścataruṇī priyā // GarP_1,114.27 //
atyambupānaṃ kaṭhināśanañca dhātukṣayovegavidhāraṇañca /
divāśayo jāgaraṇañca rātrau ṣaḍbhirnarāṇāṃ nivasanti rogāḥ // GarP_1,114.28 //
bālātapaścāpyatimaithunañca śmaśānadhūmaḥ karatāpanañca /
rajasvalāvatkranirīkṣaṇañca sudīrghamāyurnanu karṣayecca // GarP_1,114.29 //
śuṣkaṃ māṃsaṃ striyo vṛddhā bālārkastaruṇaṃ dadhi /
prabhāte maithunaṃ nidrā sadyaḥ prāṇaharāṇi ṣaṭ // GarP_1,114.30 //
sadyaḥ pakraghṛtaṃ drākṣā bālā strī kṣīrabhojanam /
uṣṇodakaṃ tarucchāyā sadyaḥ prāṇaharāṇi ṣaṭ // GarP_1,114.31 //
kūpādakaṃ vaṭacchāyā nārīṇāñca payodharaḥ /
śītakāle bhaveduṣṇamuṣṇakāle ca śītalam // GarP_1,114.32 //
trayo balakarāḥ sadyo bālābhyaṅgasubhojanam /
trayo balaharāḥ sadyo hyadhvā ve maithunaṃ jvaraḥ // GarP_1,114.33 //
śuṣkaṃ māṃsaṃ payo nityaṃ bhāryāmitraiḥ sahaiva tu /
na bhāktavyaṃ nṛpaiḥ sārdhaṃ viyogaṃ kurute kṣaṇāt // GarP_1,114.34 //
kucelina dantamalopadhāriṇaṃ bahvāśinaṃ niṣṭhuravākyabhāṣiṇam /
sūryodaye hyastamaye 'pi śāyinaṃ vimuñcati śrīrapi cakrapāṇinam // GarP_1,114.35 //
nityaṃ chedastṛṇānaṃ dharaṇivilakhanaṃ pādayoścāpamārṣṭiḥ dantānāmapyaśaucaṃ malinavasanatā rūkṣatā mūrdhajānām /
dve sadhye cāpi nidrā vivasanaśayanaṃ grāsahāsātirekaḥ svāṅge pīṭhe ca vādyaṃ nidhanamupanayetkeśavasyāpi lakṣmīm // GarP_1,114.36 //
śiraḥ sudhautaṃ caraṇau sumārjitau varāṅganāsevanamalpabhojanam /
anagnaśāyitvamaparvamaithunaṃ cirapranaṣṭāṃ śriyamānayanti ṣaṭ // GarP_1,114.37 //
yasya kasya tu puṣpasya pāṇāḍarasya viśeṣataḥ /
śirasā dhāryamāṇasya hyalakṣmīḥ pratihanyate // GarP_1,114.38 //
dīpasya paścimā chāyā chāyā śayyāsanasya ca /
rajakasya tu yattīrthalakṣmīstatra tiṣṭhati // GarP_1,114.39 //
bālātapaḥ pretadhūmaḥ strī vṛddhā taruṇaṃ dadhi /
āyuṣkāmo na seveta tathā saṃmārjanīrajaḥ // GarP_1,114.40 //
gajāśvarathadhānyānāṃ gavāñcaiva rajaḥ śubham /
aśubhaṃ ca vijānīyātkharoṣṭrajāvikeṣu ca // GarP_1,114.41 //
gavāṃ rajo dhānyarajaḥ putrasyāṅgabhavaṃ rajaḥ /
etadrajo mahāśastaṃ mahāpātakanāśanam // GarP_1,114.42 //
ajārajaḥ khararajo yattu saṃmārjanīrajaḥ /
etadrajo mahāpāpaṃ mahākilbiṣakārakam // GarP_1,114.43 //
śūrpavāto nakhāgrāmbu snānavastramṛjodakam /
keśāmbu mārjanīreṇurhanti puṇyaṃ purā kṛtam // GarP_1,114.44 //
viprayorvipravahnyośca dampatyoḥ svāminostathā /
antareṇa na gantavyaṃ hayasya vṛṣabhasya ca // GarP_1,114.45 //
strīṣu rājāgnisarpeṣu svādhyāye śatrusevane /
bhogāsvādeṣu viśvāsaṃ kaḥ prājñaḥ kartumarhati // GarP_1,114.46 //
na viśvasedaviśvastaṃ viśvastaṃ viśvastaṃ nātiviśvaset /
viśvāsādbhayamutpannaṃ mūlādapi nikṛntati // GarP_1,114.47 //
vairiṇā saha sandhāya viśvasto yadi tiṣṭhati /
sa vṛkṣāgre prasupto hi patitaḥ pratibudhyate // GarP_1,114.48 //
nātyantaṃ mṛdunā bhāvyaṃ nātyantaṃ kūrakarmaṇā /
mṛdunaiva mṛduṃ hanti dāruṇenaiva dāruṇam // GarP_1,114.49 //
nātyantaṃ saralairbhāvyaṃ nātyantaṃ mṛdunā tathā /
saralāstatra chidyante kubjāstiṣṭhanti pādapāḥ // GarP_1,114.50 //
namanti phalino vṛkṣā namanti guṇino janāḥ /
śuṣkavṛkṣāśca mūrkhāśca bhidyante na namanti ca // GarP_1,114.51 //
aprārthitāni duḥ khāni yathaivāyānti yānti ca /
mārjāra iva lumpeta tathā prārthayitāra naraḥ // GarP_1,114.52 //
pūrvaṃ paścāccarantyārye sadaiva bahusampadaḥ /
viparītamanārye ca yathecchasi tathā cara // GarP_1,114.53 //
ṣaṭkarṇo bhidyate mantraścatuḥ karṇaścadhāryate /
dvikarṇasya tu mantrasya brahmāpyanta na budhyate // GarP_1,114.54 //
tayā gavā kiṃ kriyate yā na dogdhrī na garbhiṇī /
kor'tha putreṇa jātena yo na vidvānna dhārmikaḥ // GarP_1,114.55 //
ekenāpi suputreṇa vidyāyuktena dhīmatā /
kulaṃ puruṣasiṃhena candreṇa gaganaṃ yathā // GarP_1,114.56 //
ekenāpi suvṛkṣeṇa puṣpitena sugandhinā /
vanaṃ suvāsitaṃ sarvaṃ suputreṇa kulaṃ yathā // GarP_1,114.57 //
eko hi guṇavānputro nirguṇena śatena kim /
candro hanti tamāṃsyeko na ca jyotiḥ sahasrakam // GarP_1,114.58 //
lālayetpañca varṣāṇi daśa varṣāṇi tāḍayet /
prāpte tu ṣoḍaśe varṣe putraṃ mitravadācaret // GarP_1,114.59 //
jāyamāno hareddārān vardhamāno hareddhanam /
mriyamāṇo haretprāṇānnāsti putrasamo ripuḥ // GarP_1,114.60 //
kecinmṛgamukhā vyāghrāḥ kecidvyāghramukhā mṛgāḥ /
tatsvarūpapahijñāne hyaviśvāsaḥ padepade // GarP_1,114.61 //
ekaḥ kṣamāvatāṃ doṣo dvitīyo nopapadyate /
yadenaṃ kṣamayā yuktamaśaktaṃ manyate janaḥ // GarP_1,114.62 //
etadevānumanyeta bhogā hi kṣaṇabhaṅginaḥ /
snigdheṣu ca vidagdhasya matayo vai hyanākulāḥ // GarP_1,114.63 //
jyeṣṭhaḥ pitṛsamo bhrātā mṛte pitari śaunaka /
sarveṣāṃ sa pitā hi syātsarveṣāmanupālakaḥ // GarP_1,114.64 //
kaniṣṭheṣu ca sarveṣu samatvenānuvartate /
samāpabhogajīveṣu yathaivaṃ tanayeṣu ca // GarP_1,114.65 //
bahūnāmalpasārāṇāṃ samavāyo hi dāruṇaḥ /
tṛṇairāveṣṭitā rajjustayā nāgo 'pi badhyate // GarP_1,114.66 //
apahṛtya parasvaṃ hi yastu dānaṃ prayacchati /
sa dātā narakaṃ yāti yasyārthāstasya tatphalam // GarP_1,114.67 //
devadravyavināśena brahmasvaharaṇena ca /
kulānyakulatāṃ yānti brāhmaṇātikrameṇa ca // GarP_1,114.68 //
brahmaghne ca surāpe ca core bhagnavrate tathā /
niṣkṛtirvihitā sadbhiḥ kṛtaghne nāsti niṣkṛtiḥ // GarP_1,114.69 //
nāśranti pitaro devāḥ kṣudrasya vṛṣalīpateḥ /
bhāryājitasya nāśranti yasyāścopapatirgṛhe // GarP_1,114.70 //
akṛjajñamanāryañca dīrdharoṣamanārjavam /
caturo viddhi cāṇḍālāñjātyā jāyeta pañcamaḥ // GarP_1,114.71 //
nopekṣitavyo durbaddhi śatruralpo 'pyavajñayā /
vahniralpo 'pyasaṃhāryaḥ kurute bhasmasājjagat // GarP_1,114.72 //
nave vayasi yaḥ śāntaḥ sa śānta iti me matiḥ /
dhātuṣu kṣīyamāṇeṣu śamaḥ kasya na jāyate // GarP_1,114.73 //
panthāna iva viprendra sarvasādhāraṇāḥ śriyaḥ /
madīyā iti matvā vai na hi harṣayuto bhavet // GarP_1,114.74 //
cittāyattaṃ dhātuvaśyaṃ śarīraṃ citte naṣṭe dhātavo yānti nāśam /
tasmāccittaṃ sarvadā rakṣaṇīyaṃ svasthe citte dhātavaḥ sambhavanti // GarP_1,114.75 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bṛhadṛ nītisāre caturdaśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 115
sūta uvāca /
kumāryāṃ ca kumitraṃ ca kurājānaṃ kuputrakam /
kukanyāṃ ca kudeśaṃ ca dūrataḥ parivarjayet // GarP_1,115.1 //
dharmaḥ pravrajitastapaḥ pracalitaṃ satyaṃ ca dūraṃ gataṃ pṛthvī vandhyaphalā janāḥ kapaṭino laulye sthitā brāhmaṇāḥ /
martyāḥ strīvaśagāḥ striyaśca capalā nīcā janā unnatāḥ hā kaṣṭaṃ khalujīvitaṃ kaliyuge dhanyā janā ye mṛtāḥ // GarP_1,115.2 //
dhanyāste ye na paśyanti deśabhaṅgaṃ kulakṣayam /
paracittagatān dārānputraṃ kuvyasane sthitam // GarP_1,115.3 //
kuputre nirvṛtirnāsti kubhāryāyāṃ kuto ratiḥ /
sumitra nāsti viśvāsaḥ kurājye nāsti jīvitam // GarP_1,115.4 //
parānnaṃ ca parasvaṃ ca paraśayyāḥ parastriyaḥ /
paraveśmani vāsaśca śakrādapi harecchriyam // GarP_1,115.5 //
ālāpādgātrasaṃsparśātsaṃsargātsaha bhojanāt /
āsanācchayanādyānātpāpaṃ saṃkramate nṛṇām // GarP_1,115.6 //
striyo naśyanti rūpeṇa tapaḥ krodhana naśyati /
gāvo dvarapracāreṇa śūdrānnena dvijottamaḥ // GarP_1,115.7 //
āsanādekaśayyāyāṃ bojanātpaṅktisaṅkarāt /
tataḥ saṃkramate pāpaṃ ghaṭāddhaṭa ivodakam // GarP_1,115.8 //
lālane bahavo doṣāstāḍane bahavo guṇāḥ /
tasmācchiṣyaṃ ca putraṃ ca tāḍayenna tu lālayet // GarP_1,115.9 //
adhvā jarā dehavatāṃ parvatānāṃ jalaṃ jarā /
asaṃbhogaśca nārīṇāṃ vastrāṇāmātapo jarā // GarP_1,115.10 //
adhamāḥ kalimicchanti sandhimicchati madhyamāḥ /
uttamā mānamicchanti māno hi mahatāṃ dhanam // GarP_1,115.11 //
māno hi mūlamarthasya māne sati dhanena kim /
prabhraṣṭamānadarpasya kiṃ dhanena kimāyuṣā // GarP_1,115.12 //
adhamā dhanamicchanti dhanamānau hi madhyamāḥ /
uttamā mānamicchanti māno hi mahatāṃ dhanam // GarP_1,115.13 //
vane 'pi siṃhā na namanti kaṃ ca bubhu kṣitā māṃsanirīkṣaṇaṃ ca /
dhanairvihīnāḥ sukuleṣu jātā na nīcakarmāṇi samārabhante // GarP_1,115.14 //
nābhiṣeko na saṃskāraḥ siṃhasya kriyate vane /
nityamūrjitasattvasya svayameva mṛgendratā // GarP_1,115.15 //
vaṇikpramādī bhṛkaśca mānī bhikṣurvilāsī hyadhanaśca kāmī /
varāṅganā cāpriyavādinī ca na te ca karmāṇi samārabhante // GarP_1,115.16 //
dātā daridraḥ kṛpaṇor'thayuktaḥ puttro 'vidheyaḥ kujanasya sevā /
paropakāreṣu narasya mṛtyuḥ prajāyate duścaritāni pañca // GarP_1,115.17 //
kāntāviyogaḥ svajanāpamānaṃ ṛṇasya śeṣaḥ kujanasya sevā /
dāridrayābhāvādvimukhāśca mitrā vināgninā pañca dahanti tīvrāḥ // GarP_1,115.18 //
cintāsahasreṣu ca teṣu madhye cintāścatasro 'pyasidhāratulyāḥ /
nīcāpamānaṃ kṣudhitaṃ kalatraṃ bhāryā viraktā sahajoparodhaḥ // GarP_1,115.19 //
vaśyaśca purtrer'tha karī ca vidyā arogitā sajjanasaṅgatiśca /
iṣṭā ca bhāryā vaśavartinī ca duḥ khasya mūloddharaṇāni pañca // GarP_1,115.20 //
kuraṅgamātaṅgapataṅgaṃbhṛga mīnā hatāḥ pañcabireva pañca /
ekaḥ pramāthī sa kathaṃ na ghātyo yaḥ sevate pañcabhireva pañca // GarP_1,115.21 //
adhīraḥ karkaśaḥ stabdhaḥ kucelaḥ svayamāgataḥ /
pañca viprā na pūjyante bṛhaspatisamā api // GarP_1,115.22 //
āyuḥ karma ca vittaṃ ca vidyā nidhanameva ca /
pañcaitāni vivicyante jāyamānasya dehinaḥ // GarP_1,115.23 //
parvatārohaṇe toye gokule duṣṭanigrahe /
patitasya samutthāne śastāḥ pañca (hyete) guṇāḥ smṛtāḥ // GarP_1,115.24 //
abhracchāyā khale prītiḥ paranārīṣu saṃgatiḥ /
pañcaite hyasthirā bhāvā yauvanāni dhanāni ca // GarP_1,115.25 //
asthiraṃ jīvitaṃ loke asthiraṃ dhanayauvanam /
asthiraṃ puttradārādyaṃ dharmaḥ kīrtiryaśaḥ sthiram // GarP_1,115.26 //
śata jīvitamatyalpaṃ rātristasyārdhahāriṇī /
vyādhiśokajarāyāsairardhaṃ tadapi niṣphalam // GarP_1,115.27 //
āyurvarṣaśataṃ nṛṇāṃ parimitaṃ rātrau tadardhaṃ gataṃ tasyārdhasthitakiñcidardhamadhikaṃ bālyasya kāle gatam /
kiñcidvandhuviyogaduḥ khamaraṇairbhūpālasevāgataṃ śeṣaṃ vāritaraṅgagarbhacapalaṃ mānena kiṃ māninām // GarP_1,115.28 //
ahorātramayo loke jarārūpeṇa saṃcaret /
mṛtyurgrasati bhūtāni pavanaṃ pannago yathā // GarP_1,115.29 //
gacchatastiṣṭhato vāpi jāgrataḥ svapato na cet /
sarvasattvahitārthāya paśoriva viceṣṭitam // GarP_1,115.30 //
ahitahitavicāraśūnyabuddheḥ śrutisamaye bahubhirvitarkitasya /
udarabharaṇamātratuṣṭabuddheḥ puruṣapaśośca paśośca ko viśeṣaḥ // GarP_1,115.31 //
śaurye tapasi dāne ca yasya na prathitaṃ yaśaḥ /
vidyāyāmarthalābhe vā māturuccāra eva saḥ // GarP_1,115.32 //
yajjīvyate kṣaṇamapi prathitaṃ manuṣyairvijñānavikramayaśobhirabhagnamānaiḥ /
tannāma jīvitamiti pravadanti tajjñāḥ kāko 'pi jīvati ciraṃ ca baliṃ ca bhuṅkte // GarP_1,115.33 //
kiṃ jīvitena dhanamānavivarjitena mitreṇa kiṃ bhavati bhītisaśaṅkitena /
siṃhavrataṃ carata gacchata mā viṣādaṃ kāko 'pi jīvati ciraṃ ca baliṃ ca bhuṅkte // GarP_1,115.34 //
yo vātmanīha na gurau na ca bhṛtyavarge dīne dayāṃ na kurute na ca mitrakārye /
kiṃ tasya jīvitaphalenamanuṣyaloke kāko 'pi jīvati ciraṃ ca baliṃ ca bhuṅkte // GarP_1,115.35 //
yasya trivargaśūnyāni dinānyāyānti yānti ca /
sa lauhakārabhastreva śvasannapi na jīvati // GarP_1,115.36 //
svādhīnavṛtteḥ sāphalyaṃ na parādhīnavartitā /
ye parādhīnakarmāṇo jīvanto 'pi ca te mṛtāḥ // GarP_1,115.37 //
su(sva) pūrā vai kāpuruṣāḥ su(sva) pūro mūṣikāñjaliḥ /
asantuṣṭaḥ kāpuruṣaḥ svalpakenāpi tuṣyati // GarP_1,115.38 //
abhracchāyā tṛṇādagnirnocasevā patho jalam /
veśyārāgaḥ khale prītiḥ ṣaḍete budvudopamāḥ // GarP_1,115.39 //
vācā vihitasārthena loko na ca sukhāyate /
jīvitaṃ mānamūlaṃ hi māne mlāne kutaḥ sukham? // GarP_1,115.40 //
abalasya balaṃ rājā bālasya ruditaṃ balam /
balaṃ mūrkhasya maunaṃ hi taskarasyānṛtaṃ balam // GarP_1,115.41 //
yathāyathā hi puruṣaḥ śāstraṃ samadhigacchati /
tathātathāsya medhā syādvijñānaṃ cāsya rocate // GarP_1,115.42 //
yathāyathā hi puruṣaḥ kalyāṇe kurute matim /
tathātathā hi sarvatra śliṣyate lokasupriyaḥ // GarP_1,115.43 //
lobhapramādaviśvāsaiḥ puruṣo naśyati tribhiḥ /
tasmāllobho na kartavyaḥ pramādo nona viśvaset // GarP_1,115.44 //
tāvadbhayasya bhetavyaṃ yāvadbhayamanāgatam /
utpanne tu bhaye tīvre sthātavyaṃ vai hyabhītavat // GarP_1,115.45 //
ṛṇaśeṣaṃ cāgniśeṣaṃ vyādhiśeṣaṃ tathaiva ca /
punaḥ punaḥ pravardhante tasmāccheṣaṃ na kārayet // GarP_1,115.46 //
kṛte pratikṛtaṃ kuryāddhiṃsite pratihiṃsitam /
na tatra doṣaṃ paśyāmi duṣṭe doṣaṃ samācaret // GarP_1,115.47 //
parokṣe kāryahantāraṃ pratyakṣe priyavādinam /
varjayettādṛśaṃ mitraṃ māyāmayamariṃ tathā // GarP_1,115.48 //
durjanasya hi saṃgena sujano 'pi vinaśyati /
prasannamapi pānīyaṃ kardamaiḥ kaluṣīkṛtam // GarP_1,115.49 //
sa bhuṅkte sadvijo bhuṅkte samaśeṣanirūpaṇam /
tasmātsarvaprayatnena dvijaḥ pūjyaḥ prayatnataḥ // GarP_1,115.50 //
tadbhujyate yaddvijabhuktaśeṣaṃ sa buddhimānyo na karoti pāpam /
tatsauhṛdaṃ yakriyate parokṣe dambhairvinā yaḥ kriyate sa dharmaḥ // GarP_1,115.51 //
na sā sabhā yatra na santi vṛddhāḥ vṛddhā na te ye na vadanti dharmam /
dharmaḥ sa no yatra na satyamasti naitatsatyaṃ yacchalenānuviddham // GarP_1,115.52 //
brāhmaṇo 'pi manuṣyāṇāmādityaścaiva tejasām /
śiro 'pi sarvagātrāṇāṃ vratānāṃ satyamuttamam // GarP_1,115.53 //
tanmaṅgalaṃ yatra manaḥ prasannaṃ tajjīvanaṃ yanna parasya sevā /
tadarjitaṃ yatsvajanena bhuktaṃ tadgarjitaṃ yatsamare ripūṇām // GarP_1,115.54 //
sā strīyā na madaṃ kuryātsa sukhī tṛṣṇayojjhitaḥ /
tanmitraṃ yatra viśvāsaḥ puruṣaḥ sa jitendriyaḥ // GarP_1,115.55 //
tatra muktādarasneho viluptaṃ yatra sauhṛdam /
tadeva kevalaṃ ślaghyaṃ yasyātmā kriyate stutau // GarP_1,115.56 //
nadīnāmagnihotrāṇāṃ bhāratasya kalasya ca /
mūlānveṣo na kartavyo mūlāddoṣo na hīyate // GarP_1,115.57 //
lavaṇajalāntā nadyaḥ strībhedāntaṃ ca maithunam /
ṣaiśunyaṃ janavārtāntaṃ vittaṃ duḥ khatrayāntakam // GarP_1,115.58 //
rājyaśrīrbrahmaśāpāntā pāpāntaṃ brahmavarcasam /
ācāntaṃ ghoṣavāsāntaṃ kulasyāntaṃ striyā prabho (bhuḥ) // GarP_1,115.59 //
sarve kṣayāntā nilayāḥ patanāntāḥ samucchrayāḥ /
saṃyogā viprayogāntā maraṇāntaṃ hi jīvitam // GarP_1,115.60 //
yadīcchetpunarāgantuṃ nātidūramanuvrajet /
udakāntānnivarteta snigdhavarṇācca pādapāt // GarP_1,115.61 //
anāyake na vastavyaṃ na caiva bahunāyake /
strīnāyake na vastavyaṃ vastavyaṃ bālanāyake // GarP_1,115.62 //
pitā rakṣati kaumāre bhattā rakṣati yauvane /
putrastu sthavire kāle na strī svātantryamarhati // GarP_1,115.63 //
tyajedvandhyāmaṣṭame 'bde navame tu mṛtaprijām /
ekādaśe strījananīṃ sadyaścāpriyāvādinīm // GarP_1,115.64 //
anarthitvānmanuṣyāṇāṃ bhiyā parijanasya ca /
arthādapetamaryādāstrayastiṣṭhanti bhartṛṣu // GarP_1,115.65 //
aśvaṃ śrāntaṃ gajaṃ mattaṃ gāvaḥ prathamasūtikāḥ /
anūdake ca maṇḍūkānprājño dūreṇa varjayet // GarP_1,115.66 //
arthāturāṇāṃ na suhṛnna bandhuḥ kāmāturāṇāṃ na bhayaṃ na lajjā /
cintāturāṇāṃ na sukhaṃ na nidrā kṣudhāturāṇāṃ na balaṃ na tejaḥ // GarP_1,115.67 //
kuto nidrā daridrasya parapreṣyavarasya ca /
paranārīprasaktasya paradravyaharasya ca // GarP_1,115.68 //
sukhaṃ svapityanṛṇavānvyādhimuktaśca yo naraḥ /
sāvakāśastu vai bhuṅkte yastu dārairna saṅgataḥ // GarP_1,115.69 //
ambhasaḥ parimāṇe unnataṃ kamalaṃ bhavet /
svasvāminā balavatā bhṛtyo bhavati garvitaḥ // GarP_1,115.70 //
sthānasthitasya padmasya mitre varuṇabhāskarau /
sthānacyutasya tasyaiva kledaśoṣaṇakārakau // GarP_1,115.71 //
ye padasthasya mittrāṇi te tasya riputāṃ gatāḥ /
bhānoḥ padme jale prītiḥ sthaloddharaṇaśoṣaṇaḥ // GarP_1,115.72 //
sthānasthitāni pūjyante pūjyante ca pade sthitāḥ /
sthānabhraṣṭā na pūjyante keśā dantā nakhā narāḥ // GarP_1,115.73 //
ācāraḥ kulamākhyati deśamākhyāti bhāṣitam /
sambhramaḥ snehamākhyāti vapurākhyāti bhojanam // GarP_1,115.74 //
vṛthā vṛṣṭiḥ samudrasya vṛthā tṛptasya bhojanam /
vṛthā dānaṃ samṛddhasya nīcasya sukṛtaṃ vathā // GarP_1,115.75 //
dūrastho 'pi samīpastho yo yasya hṛdaye sthitaḥ /
hṛdayādapi niṣkrāntaḥ samīpastho 'pi dūrataḥ // GarP_1,115.76 //
mukhabhaṅgaḥ svaro dīno gātrasvedo mahadbhayam /
maraṇe yāni cihnāni tāni cihnāni yācake // GarP_1,115.77 //
kubjasya kīṭaghātasya vātānniṣkāsitasya ca /
śikhare vasatastasya varaṃ janma na yācitam // GarP_1,115.78 //
jagatpatirhi yācitvā viṣṇurvāmanatāṃ yataḥ /
kānyo 'dhikatarastasya yor'tho yāti na lāghavam // GarP_1,115.79 //
mātā śatruḥ pitā vairī bālā yena na pāṭhitāḥ /
sabhāmadhye na śobhante haṃsamadhye bakāyathā // GarP_1,115.80 //
vidyā nāma kurūparūpamadhikaṃ vidyātiguptaṃ dhanaṃ vidyā sādhukarī janapriyakarī vidyā gurūṇāṃ guruḥ /
vidyā bandhujanārtināśanakarī vidyā paraṃ daivataṃ vidyā rājasu pūjitā hi manujo vidyavihīnaḥ paśuḥ // GarP_1,115.81 //
gṛhe cābhyantare dravyaṃ lagnaṃ caiva tu dṛśyate /
aśeṣaṃ haraṇīyaṃ ca vidyā na hriyate paraiḥ // GarP_1,115.82 //
śaunakīyaṃ nītisāraṃ viṣṇuḥ sarvatratāni ca /
kathayāmāsa vaipūrvaṃ tatra śuśrāva śaṅkaraḥ /
śaṅkarādaśṛṇodvyāso vyāsādasmābhireva ca // GarP_1,115.83 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śaunakoktanītisārādivarṇanaṃ nāma pañcadaśottaraśatatamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 116
brahmovāca /
vratāni vyāsa vakṣyāmi hariryaiḥ sarvado bhavet /
sarvamāsarkṣatithiṣu vāreṣu harirarcitaḥ // GarP_1,116.1 //
ekabhaktena naktena upavāsaphalādinā /
dadāti dhanadhānyādi putrarājyajayādikam // GarP_1,116.2 //
vaiśvānaraḥ pratipadi kuberaḥ pūjitor'thadaḥ /
poṣya brahmo pratipadyarcitaḥ śristathāśvinī // GarP_1,116.3 //
dvitīyāyāṃ yamo lakṣmīnārāyaṇa ihārthadaḥ /
tṛtīyāyāṃ tridevāśca gaurīvighneśaśaṅkarāḥ // GarP_1,116.4 //
caturthyāṃ ca caturvyūhaḥ pañcamyāmarcito hariḥ /
kārtikeyo raviḥ ṣaṣṭhyāṃ saptamyāṃ bhāskaror'thadaḥ // GarP_1,116.5 //
durgāṣṭamyāṃ navamyāṃ ca mātaro 'tha diśor'thadāḥ /
daśamyāṃ ca yamaścandra ekādaśyāmṛṣīnyajet // GarP_1,116.6 //
dvādaśyāṃ ca hariḥ kāmastrayodaśyāṃ maheśvaraḥ /
caturdaśyāṃ pañcadaśyāṃ brahmā ca pitaror'thadāḥ // GarP_1,116.7 //
amāvāsyāṃ pūjanīyā vārā vai bhāskarādayaḥ /
nakṣatrāṇi ca yogāśca pūjitāḥ sarvadāyakāḥ // GarP_1,116.8 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe tithyādivratavarṇanaṃ nāma ṣoḍaśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 117
brahmovāca /
mārgaśīrṣe site pakṣe vyāsāṃnaṅgatrayodaśī /
mallikājaṃ dantakāṣṭhaṃ dhutūraiḥ pūjayecchivam // GarP_1,117.1 //
anaṅgāyeti naivedyaṃ madhaprāśyātha pauṣake /
yogeśvaraṃ pūjayecca bilvapatraiḥ kadambajam /
dantakāṣṭhaṃ candanādi naivedyaṃ kṛsarādikam // GarP_1,117.2 //
māghe naṭeśvarāyārcya kundairmauktikamālayā /
plakṣeṇa dantakāṣṭhaṃ ca naivedyaṃ pūrikā mune // GarP_1,117.3 //
vīreśvaraṃ phālgune tu pūjayettu marūbakaiḥ /
śarkarāśākamaṇḍāśca cūtajaṃ dantadhāvanam // GarP_1,117.4 //
caitre yajetsu rūpāya karpūraṃ prāśayenniśi /
dantadhāvanāṭajaṃ naivedyaṃ śaṣkulīṃ dadet // GarP_1,117.5 //
pūjā damanakaḥ śambhorveśākhe 'śokrapuṣpakaiḥ /
mahārūpāya naivedyaṃ guḍabhaktaṃ puṭṭabaram // GarP_1,117.6 //
dantakāṣṭhaṃ prāśayecca dadejjatīphalaṃ tathā /
pradyumnaṃ pūjayejjyeṣṭhe campakairbilvajaṃ daśet // GarP_1,117.7 //
lavagārā tathā ṣaḍhi umāmadati śāsanaḥ? /
aguruṃ dantakāṣṭhaṃ ca tamapāmārgakairyajet // GarP_1,117.8 //
śrāvaṇe karavīraṃ ca śambhave śūlapāṇaye /
gandhāśano ghṛtādyaiśca karavīrajaśodhanam // GarP_1,117.9 //
sadyojātaṃ bhādrapade bakulaiḥ pūpakairyajet /
gandharvāśo madanakamāśvine ca surādhipam // GarP_1,117.10 //
campakaiḥ svarṇavā (dhār) yādo jinmodakasaṃpradaḥ /
khādiraṃ dantakāṣṭhaṃ ca kārtike rudramarcayet // GarP_1,117.11 //
badaryā dantakāṣṭhaṃ ca madano daśamāśanaḥ /
kṣīraśākapradaḥ padmairabdante śivamarcayet // GarP_1,117.12 //
ratimuktamanaṅgaṃ ca svarṇamaṇḍalasaṃsthitam /
gandhādyairdaśasāhasraṃ tilavrīhyādi homayet // GarP_1,117.13 //
jāgaraṃ gītavaditraṃ prabhita'bhyārcya vedayet /
dvijāya śayyāṃ pātraṃ ca chatraṃ vastramupānahau // GarP_1,117.14 //
gāṃ dvijaṃ bhojayedbhaktyā kṛtakṛtyo bhavennaraḥ /
etadudyāpanaṃ sarvaṃ vrateṣu dhyepamīdṛśam /
phalañca śrīsutārogyasaubhāgyasvargataṃ bhavet // GarP_1,117.15 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe 'naṅgatrayodaśīvrataṃ nāma saptadaśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 118
brahmovāca /
vrataṃ kaivalyaśamanamakhaṇḍadvādaśīṃ vade /
māgaśīrṣe site pakṣe gavyāśī samupoṣitaḥ // GarP_1,118.1 //
dvādaśyāṃ pūjaye dviṣṇuṃ dadyānmāsacatuṣṭayam /
pañcavrīhiyutaṃ pātraṃ viprāyedamudāharet // GarP_1,118.2 //
saptajanmani he viṣṇo yanmayā hi vrataṃ kṛtam /
bhagavaṃstvatprasādena tadakhaṇḍamihāstu me // GarP_1,118.3 //
yathākhaṇḍaṃ jagatsarvaṃ tvameva puruṣottama /
tathākhilānyakhaṇḍāni vritāni mama santi vai // GarP_1,118.4 //
saktupātrāṇi caitrādau śrāvaṇādau ghṛtānvitān /
vratakṛdvatapūrṇastu strīputrasvargabhāgbhavet // GarP_1,118.5 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe 'khaṇḍadvādaśīvratakathanaṃnāmāṣṭādaśottara śatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 119
brahmovāca /
agastyārghyavrataṃ vakṣye bhuktimuktipradāyakam /
aprāpte bhāskare kanyāṃ sati bhāge tribhirdinaiḥ // GarP_1,119.1 //
arghyaṃ dadyādagastyāya mūrtiṃ saṃpūjya vai mune ! /
kāśapuṣpamayīṃ kumbhe pradoṣe kṛtajāgaraḥ // GarP_1,119.2 //
dadhyakṣatādyaiḥ saṃpūjya upoṣya phalapuṣpakaiḥ /
pañcavarṇasamāyuktaṃ hemaraupyasamanvitam // GarP_1,119.3 //
saptadhānyayutaṃ pātraṃ dadhicandanacarcitam /
agastyaḥ khanamāneti mantreṇārghyaṃ pridāpayet // GarP_1,119.4 //
khāsapuṣpapratīkāśa agnimārutasambhava ! /
mitrāvāruṇayoḥ puttro kumbhayone namo 'stu te // GarP_1,119.5 //
śūdrastryādiranenaiva tyajeddhānyaṃ phalaṃ rasam /
dadyāddvijātaye kumbhaṃ sahiraṇyaṃ sadakṣiṇam /
bhojayecca dvijānsapta varṣaṃ kṛtvā tu sarvabhāk // GarP_1,119.6 //

iti śrīgāruḍe mahāpurāṇe prathamāṃśākhye ācārakāṇḍe 'gastyārghyavrataṃ nāmakonaviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 120
brahmovāca /
rambhātṛtīyāṃ vakṣya ca saubhagyaśrīsutādidām /
mārgaśīrṣesite pakṣe tṛtīyāyāmupoṣitaḥ // GarP_1,120.1 //
gaurīṃ yajedvilvapatraiḥ kuśodakakarastataḥ /
kadambādau girisutāṃ pauṣe marubakairyajet // GarP_1,120.2 //
karpūrādaḥ kṛsarado mallikādantakāṣṭhakṛt /
māghesubhadrāṃ kalhārairghṛtāśo maṇḍakapradaḥ // GarP_1,120.3 //
gītīmayaṃ tantakāṣṭhaṃ phālgune gomatīṃ yajet /
kundaiḥ kṛtvā dantakāṣṭhaṃ jīvāśaḥ śaṣkulīpradaḥ // GarP_1,120.4 //
viśālākṣīṃ damanakaiścaitre ca kṛsarapradaḥ /
dadhiprāśo dantakāṣṭhaṃ tagaraṃ śrīmukhīṃ yajet // GarP_1,120.5 //
vaiśākhe karṇikāraiśca aśokāśo vaṭapradaḥ /
jyeṣṭhe nārāyaṇīmarcecchatapatraiśca khaṇḍadaḥ /
lavaṅgāśo bhavedeva āṣāḍhe mādhavīṃ yajet // GarP_1,120.6 //
tilāśo bilvapatraiśca kṣīrānnavaṭakapradaḥ /
audumbaraṃ dantakāṣṭhaṃ tagaryāḥ śrāvaṇe śriyam // GarP_1,120.7 //
dantakāṣṭhaṃ mallikāyā kṣīrado hyuttamāṃ yajet /
padmairyajedbhādrapade śṛṅgadāśo gṛḍādidaḥ // GarP_1,120.8 //
rājaputrīṃ cāśvayuje japāpuṣpaiśca jīrakam /
prāśayenniśi naivedyaiḥ kṛsaraiḥ kārtike yajet // GarP_1,120.9 //
jātīpuṣpaiḥ padmajāṃ ca pañcagavyāśano yajet /
ghṛtodanaṃ ca varṣānte sapatnīkāndvijānyajet // GarP_1,120.10 //
umāmaheśvaraṃ pūjya pradadyācca guḍādikam /
vastracchatrasuvarṇādyaiḥ rātrau ca kṛtajāgaraḥ /
gītavādyairdadatpratargavādyaṃ sarvamānpuyāt // GarP_1,120.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe rambhātṛtīyāvrataṃ nāma viṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 121
brahmovāca /
cāturmāsyavratānyūce ekādaśyāṃ samācaret /
āṣāḍhyāṃ paurṇamāsyāṃ vā sarveṇaharimarcyaca // GarP_1,121.1 //
idaṃ vrataṃ mayā deva gṛhītaṃ puratastava /
nirvighnaṃ siddhimāpnotu prasanne tvayi keśava // GarP_1,121.2 //
gṛhīte 'sminvrate deva yadyapūrṇe mriyāmyaham /
tanme bhavatu sampūrṇaṃ tvatprasādājjanārdana // GarP_1,121.3 //
evamabhyarcya gṛhṇīyādvratārcanajapādikam /
sarvāghaṃ ca kṣayaṃ yāti cikīrṣedyo harervratam // GarP_1,121.4 //
snātvāyobhyacya gṛhṇīyādvratārcanajapādikam /
snātvā yaccaturo māsānekabhaktena pūjayet /
viṣṇuṃ sa yāti viṣṇorva lokaṃ malavivarjitam // GarP_1,121.5 //
madyamāṃsasurātyagī vedaviddharipūjanāt /
tailavarji viṣṇulokaṃ viṣṇubhākkṛcchrapādakṛt // GarP_1,121.6 //
ekarātropavāsācca devo vaimāniko bhavet /
śvetadvīpaṃ trirātrāttu vrajetṣaṣṭhānnakṛnnaraḥ // GarP_1,121.7 //
cāndrāyaṇāddharerdhāma labhenmuktimayācitām /
prājāpatyaṃ viṣṇulokaṃ parākavratakṛddharim // GarP_1,121.8 //
saktuyāvakabhikṣāśī payodadhighṛtāśanaḥ /
gomūtrayāvakāhāraḥ pañcagavyakṛtāśanaḥ /
śākamalaphalādyāśī rasavarjo ca viṣṇubhāk // GarP_1,121.9 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe cāturmāsyavratanirūpaṇaṃ nāmakāvaśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 122
brahmovāca /
vrataṃ māsopavāsākhyaṃ sarvotkṛṣṭaṃ vadāmite /
vānaprastho yatirnārī kuryānmāsopavāsakam // GarP_1,122.1 //
āśvinasya site pakṣe ekādaśyāmupoṣitaḥ /
vratametattu gṛhṇīyādyāvattriṃśaddināni tu // GarP_1,122.2 //
adyaprabhṛtyahaṃ viṣṇo yāvadutthānakaṃ tava /
arcayetvāmanaśraṃstu dināni triṃśadeva tu // GarP_1,122.3 //
kārtikāśvinayorviṣṇo dvādaśyoḥ śuklayoraham /
mriyeyadyantarāle tu vratabhaṅgo na me bhavet // GarP_1,122.4 //
hariṃ yajottriṣavaṇasnāyī gandhādibhirvratī /
gātrābhyaṅgaṃ gandhalepaṃ devatāyatane tyajet // GarP_1,122.5 //
dvādaśyāmatha saṃpūjya pradadyāddvijabhojanam /
tataśca pāraṇaṃ kuryāddharermāsopavāsakṛt // GarP_1,122.6 //
dugdhādiprāśanaṃ kuryādvratastho mūrchito 'ntarā /
dugdhādyairna vrataṃ naśyedbhuktimuktimavāpnuyāt // GarP_1,122.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe māsopavāsavrataṃ nāma dvāviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 123
brahmovāca /
vratāni kārtike vakṣye snātvā viṣṇuṃ prapūjayet /
ekabhaktena naktena māsaṃ vāyācitena vā // GarP_1,123.1 //
dugdhaśākaphalādyairvā upavāsena vā punaḥ /
sarvapāpavinirmuktaḥ prāptakāmo hariṃ vrajet // GarP_1,123.2 //
sadā harervrataṃ śreṣṭhaṃ tataḥ syāddakṣiṇāyane /
cāturmāsye tatastasmātkārtike bhīṣmapañcakam // GarP_1,123.3 //
tataḥ śreṣṭhavrataṃ śuklasyaikādaśyāṃ samācaret /
snātvā trikālaṃ pitrādīnyavādyairarcayeddharim // GarP_1,123.4 //
yajenmaunī ghṛtādyaiśca pañcagavyena vāribhiḥ /
snāpayitvātha karpūramukhaiścaivānulepayet // GarP_1,123.5 //
ghṛtāktaguggulairdhūpaṃ dvijaḥ pañcadinaṃ dahet /
naivadyaṃ paramānnaṃ tu japedaṣṭottaraṃ śatam // GarP_1,123.6 //
oṃ namo vāsudevāya ghṛtavrīhitilādikam /
aṣṭākṣareṇa mantreṇa svāhāntena tu homayet // GarP_1,123.7 //
prathame 'hni hareḥ pādau yajetpadmairdvitayika /
bilvapatrairjānudeśaṃ nābhi gandhena cāpare // GarP_1,123.8 //
skandhā bilvajavābhiśca pañcame 'hni śiror'cayat /
mālatyā bhūmiśāyī syādgomayaṃ prāśayetkramāt // GarP_1,123.9 //
gomūtraṃ ca dadhi kṣīraṃ pañcame pañcagavyakam /
naktaṃ kuryātpañcadaśyāṃ vratī syādbhuktimuktibhāk // GarP_1,123.10 //
ekādaśīvrataṃ nityaṃ tatkuryātpakṣayordvayoḥ /
aghaughanarakaṃ hanyātsarvadaṃ viṣṇulokadam // GarP_1,123.11 //
ekādaśī dvādaśī ca niśānte ca trayodaśī /
nityamekādaśī yatra tatra sannihito hariḥ // GarP_1,123.12 //
daśamyekādaśī yatra tatrasthāścāsurādayaḥ /
dvādaśyāṃ pāraṇa kuryātsūtake mṛtake caret // GarP_1,123.13 //
caturdaśīṃ pratipadaṃ pūrvamiśrāmupāvaset /
paurṇamāsyā mamāvāsyāṃ pratipanmiśritāṃ mune // GarP_1,123.14 //
dvitīyāṃ tṛtīyāmiśrāṃ tṛtīyāñcāpyupāvaset /
caturthyā saṅgatāṃ nityaṃ caturthoñcanayā yutām /
pañcamīṃṣaṣṭhyasaṃyuktāṃ ṣaṣṭhyā yuktāñca saptamīm // GarP_1,123.15 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhīṣmapañcakādivrataṃ nāma trayoviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 124
brahmovāca /
śivarātrivrataṃ vakṣye kathāṃ vai sarvakāmadām /
yathā ca gaurī bhūteśaṃ pṛcchati sma paraṃ vratam // GarP_1,124.1 //
īśvarauvāca /
māghaphālgunayormadhye kṛṣṇā yā tu caturdaśī /
tasyāṃ jāgaraṇādrudraḥ pūjito bhuktimuktidaḥ // GarP_1,124.2 //
kāmayukto haraḥ pūjyo dvādaśyāmi keśavaḥ /
upoṣitaiḥ pūjitaḥ sannarakāttarayattathā // GarP_1,124.3 //
niṣādaścarbude rājā pāpī sundarasenakaḥ /
sa kukruraiḥ samāyukto mṛgānhantuṃ vanaṃ gataḥ // GarP_1,124.4 //
mṛgādi kamasaṃprāpya kṣutpipāsārdito girau /
rātrau taḍāgatīreṣu nikuñje jāgradāsthitaḥ // GarP_1,124.5 //
tatrāsti liṅgaṃ svaṃ rakṣañcharīraṃ cākṣipattataḥ /
parṇāni cāpatanmūrdhni liṅgasyaiva na jānataḥ // GarP_1,124.6 //
tena dhūlinirodhāya kṣiptaṃ nīraṃ ca liṅgake /
śaraḥ pramādenaikastu pracyutaḥ karapallavāt // GarP_1,124.7 //
jānubhyāmavanīṃ gatvā liṅgaṃ spṭaṣṭvā gṛhītavān /
evaṃ snānaṃ sparśanaṃ ca pūjanaṃ jāgaro 'bhavat // GarP_1,124.8 //
prātargṛhāgato bhāryādattānnaṃ bhuktavānsa ca /
kāle mṛto yamabhaṭaiḥ pāśairbaddhvā tu nīyate // GarP_1,124.9 //
tadā mama gaṇairyuddhe jitvā muktīkṛtaḥ sa ca /
kukkureṇa sahaivābhūdgaṇo matpārśvago 'malaḥ // GarP_1,124.10 //
evamajñānataḥ puṇyañjñānātpuṇyamathākṣayam /
trayodaśyāṃ śivaṃ pūjya kuryātta niyamaṃ vratī // GarP_1,124.11 //
prātardeva ! caturdaśyāṃ jāgariṣyāmyahaṃ niśi /
pūjāṃ dānaṃ tapo homaṃ kariṣyāmyātmaśaktitaḥ // GarP_1,124.12 //
caturdaśyāṃ nirāhāro bhūtvā śambho pare 'hani /
bhokṣye 'haṃ bhuktimuktyarthaṃ śaraṇaṃ me bhaveśvara // GarP_1,124.13 //
pañcagavyāmṛtaiḥ snāpya tatkāle guruṃ śritaḥ /
oṃ namo namaḥ śivāya gandhādyaḥ pūjayeddharam // GarP_1,124.14 //
tilataṇḍulavrīhīṃśca juhuyātsaghṛtaṃ carum /
hutvā pūrṇāhutiṃ dattvā śṛṇuyādgītasatkathām // GarP_1,124.15 //
ardharātre triyāme ca caturthe ca punayarjat /
mūlamantraṃ tathā japtvā prabhāte tu kṣamāpayet // GarP_1,124.16 //
avighnena vrataṃ deva ! tvatprasadānmayārcitam /
kṣamasva jagatāṃ nātha ! trailokyādhipate hara ! // GarP_1,124.17 //
yanmayādya kṛtaṃ puṇyaṃ yadrudrasya niveditam /
tvatprasādānmayā deva ! vratamadya samāpitam // GarP_1,124.18 //
prasanno bhava me śrīman gṛhaṃ prati ca gamyatām /
tvadālokanamātreṇa pavitro 'smi na saṃśayaḥ // GarP_1,124.19 //
bhojayeddhyānaniṣṭhāṃśca vastracchatrādikaṃ dadet /
devādideva bhūteśa lokānugrahakāraka // GarP_1,124.20 //
yanmayā śraddhayā dattaṃ prīyatāṃ tena me prabhuḥ /
iti kṣamāpya ca vratī kuryādvādaśavārṣikam // GarP_1,124.21 //
kīrtiśrīputrarājyādi prāpya śaivaṃ puraṃ vrajet /
dvādaśeṣvapi māseṣu prakuryādiha jāgaram // GarP_1,124.22 //
vratī dvādaśa saṃbhojya dīpadaḥ svargamāpnuyāt // GarP_1,124.23 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śivarātrivrataṃ nāma caturviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 125
pitāmaha uvāca /
māndhātā cakravartyāsīdupoṣyaikādaśīṃ nṛpaḥ /
ekādaśyāṃ na bhuñjīta pakṣayorubhayārapi // GarP_1,125.1 //
daśamyekādaśīmiśrā gāndhāryā samupoṣitā /
tasyāḥ putraśataṃ naṣṭaṃ tasmāttāṃ parivarjayet // GarP_1,125.2 //
dvādaśyekādaśī yatra tatra sannihito hariḥ /
daśamyekādaśī yatra tatra sannihito 'suraḥ /
bahuvākyavirodhena sandeho jāyate yadā // GarP_1,125.3 //
dvādaśī tu tadā grāhyā trayodaśyāntu pāraṇam /
ekādaśī kalāpisyādupoṣyā dvādaśī tathā // GarP_1,125.4 //
ekādaśī dvādaśī ca viśeṣeṇa trayodaśī /
trimiśrā sā tithirgrāhyā sarvapāpaharā śubhā // GarP_1,125.5 //
ekādaśīmupoṣyaivadvādaśīma thavā dvija ! /
trimiśrāṃ caiva kurvīta na daśamyā yutāṃ kracit // GarP_1,125.6 //
rātrau jāgaraṇaṃ kurvanpurāṇaśravaṇaṃ nṛpaḥ /
gadādharaṃ pūjayaṃśca upoṣyaikā daśīdvayam /
rukmāṅgado yayau mokṣamanye caikādaśīvratam // GarP_1,125.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekādaśīmāhātmyaṃ nāma pañcaviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 126
brahmovāca /
yenārcanena vai loko jagāma paramāṃ gatim /
tamarcanaṃ pravakṣyāmi bhuktimuktikaraṃ param // GarP_1,126.1 //
sāmānyamaṇḍalaṃ nyasya dhātāraṃ dvāradeśataḥ /
vidhātāraṃ tathā gaṅgāṃ yamunāṃ ca mahānadīm // GarP_1,126.2 //
dvāraśriyaṃ ca daṇḍaṃ ca pracaṇḍaṃ vāstupūruṣam /
madhye cādhāraśaktiṃ ca kūrmaṃ cānantamarcayet // GarP_1,126.3 //
bhūmiṃ dharmaṃ tathā jñānaṃ vairagyaiśvaryameva ca /
adharmādīṃśca caturaḥ kandaṃ nālaṃ ca paṅkajam // GarP_1,126.4 //
karṇikāṃ kesaraṃ sattvaṃ rājasaṃ tāmasaṃ guṇam /
suryādimaṇḍalānyeva vimalādyāśca śaktayaḥ // GarP_1,126.5 //
durgāṃ gaṇaṃ sarasvatīṃ kṣetrapālaṃ ca koṇake /
āsanaṃ mūrtimabhyarcya vāsudevaṃ balaṃ smaran // GarP_1,126.6 //
aniruddhaṃ mahātmānaṃ nārāyaṇamathārcayet /
hṛdayādīni cāṅgāni śaṅkhādīnyāyudhāni ca // GarP_1,126.7 //


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 127
brahmovāca /
māghamāse śuklapakṣe sūryarkṣeṇa yutā purā /
ekādaśī tathā caikā bhīmena samupoṣitā // GarP_1,127.1 //
āścarya tu vrataṃ kṛtvā pitṝṇāmanṛṇo 'bhavat /
bhīmadvādaśī vikhyātā prāṇināṃ puṇyavardhinī // GarP_1,127.2 //
nakṣatreṇa vināpyeṣā brahmahatyādi nāśayet /
vinihanti mahāpāpaṃ kunṛpo viṣayaṃ yathā // GarP_1,127.3 //
kuputtrastu kulaṃ yadvatkubhāryā ca patiṃ yathā /
adharmaṃ ca yathā dharmaḥ kumantrī ca yathā nṛpam // GarP_1,127.4 //
ajñānena yathā jñānaṃ śaucamāśaucakaṃ yathā /
aśraddhayā yathā śraddhā satyañcaivānṛtairyathā // GarP_1,127.5 //
himaṃ yathoṣṇamāhanyādanarthaṃ cārthasaṃcayaḥ /
yathā prakartināddānaṃ tapo vai vismayādyathā // GarP_1,127.6 //
aśikṣayā yathā putro gāvo dūragatairyathā /
krodhena ca yathā śāntiryathā vittamavaddhanāt // GarP_1,127.7 //
jñānenaiyathā vidyā niṣkāmena yathā phalam /
tathaiva pāpanāśāya prokteyaṃ dvādaśī śubhā // GarP_1,127.8 //
brahmahatyā surā pāna steyaṃ gurvaṅganāgamaḥ /
yugapattuprajātānihanti tripuṣkaram // GarP_1,127.9 //
na cāpi naimiṣaṃ kṣetraṃ kurukṣetraṃ prabhāsakam /
kālindī yamunā gaṅgā na caiva na sarasvatī // GarP_1,127.10 //
caiva sarvatīrthāni ekādaśyāḥ samāni hi /
na dānaṃ na japo homo na cānyatsukṛtaṃ kracit // GarP_1,127.11 //
ekataḥ pṛthivīdānamekato harivāsaraḥ /
tato 'pyekā mahāpuṇyā iyamekādaśī varā // GarP_1,127.12 //
asminvarāhapuruṣaṃ kṛtvā devaṃ tu hāṭakam /
ghaṭopari nave pātre kṛtvā vai tāmrabhājane // GarP_1,127.13 //
sarvabījabhṛte viprāḥ sitavastrāvagaṇṭhite /
sahiraṇyapradīpādyaiḥ kṛtvā pūjāṃ prayatnanaḥ // GarP_1,127.14 //
varāhāya namaḥ pādau kroḍākṛtaye namaḥ kaṭim /
nābhiṃ gaṃbhīraghoṣayā uraḥ śrīvatsadhāriṇe // GarP_1,127.15 //
bāhuṃ sahasraśirase grīvāṃ sarveśvarāya ca /
mukhaṃ sarvātmane pūjyaṃ lalāṭaṃ prabhavāya ca // GarP_1,127.16 //
keśāḥ śatamayūkhāya pūjyā devasya cakriṇaḥ /
vidhinā pūjayitvā tu kṛtvā jāgaraṇaṃ niśi // GarP_1,127.17 //
śrutvā purāṇaṃ devasya māhātmyapratipādakam /
prātarviprāya dattvā ca yācakāya śubhāya tat // GarP_1,127.18 //
kanakakroḍasahitaṃ sannivedya paricchadam /
paścāttu pāraṇaṃ kuryānnātitṛptaḥ sakṛdvrataḥ // GarP_1,127.19 //
evaṃ kṛtvā naro vidyānna bhūya stanapo bhavet /
upoṣyaikādaśīṃ puṇyāṃ mucyate vai ṛṇatrayāt /
mano 'bhilaṣitāvāptiḥ kṛtvā sarvavratādikam // GarP_1,127.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekādaśīmāhātmyaṃ nāma saptaviṃśatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 128
brahmovāca /
vratāni vyāsa vakṣyāmi yaistuṣṭaḥ sarvado hariḥ /
śāstrodito hi niyamo vrataṃ tacca tapo matam // GarP_1,128.1 //
niyamāstu viśeṣāḥ syuḥ vratasyāsya damādayaḥ /
nityaṃ triṣavaṇaṃ snāyādadhaḥ śayī jitendriyaḥ // GarP_1,128.2 //
strīśūdrapatitānāṃ tu varjayedabhibhāṣaṇam /
pavitrāṇi ca pañcaiva juhuyāccaiva śaktitaḥ // GarP_1,128.3 //
kṛcchrāṇyetāni sarvāṇi caretsukṛtavānnaraḥ /
keśānāṃ rakṣaṇārthaṃ tu dviguṇaṃ vratamācaret // GarP_1,128.4 //
kāṃsyaṃ māṣaṃ masūraṃ cacaṇakaṃ koradūṣakam /
śākaṃ madhu parānnaṃ ca varjayedupavāsavān // GarP_1,128.5 //
puṣpālaṅkāravastrāṇi dhūpagandhānulepanam /
upavāsena duṣyettu dantadhāvanamañjanam // GarP_1,128.6 //
dantakāṣṭhaṃ pañcagavyaṃ kṛtvā prātarvrataṃ caret /
asakṛjjalapānācca tāmbūlasya ca bhakṣaṇāt // GarP_1,128.7 //
upavāsaḥ praduṣyeta divāsvapnā kṣamaithunāt /
kṣamā satyaṃ dayā dānaṃ śaucamindriyanigrahaḥ // GarP_1,128.8 //
devapūjāgnihavane santoṣosteyameva ca /
sarvavrateṣvayaṃ dharmaḥ sāmānyo daśadhāsmṛtaḥ // GarP_1,128.9 //
nakṣatradarśanānnaktamanaktaṃ niśi bhojanam /
gomūtraṃ ca pala dadyādardhāṅguṣṭhaṃ tu gomayam // GarP_1,128.10 //
kṣīraṃ saptapalaṃ dadyāddadhnaścaiva palatrayam /
ghṛtamekaphalaṃ dadyātpalamekaṃ kuśodakam // GarP_1,128.11 //
gāyattryā caiva gandheti āpyāyasva dṛ dadhigrahaḥ /
tejo 'sīti ca devasya brahmakūrcavrataṃ caret // GarP_1,128.12 //
agnyādhānaṃ pratiṣṭhāṃ tu yajñadānavratāni ca /
vedavratavṛṣotsargacūḍākaraṇamekhalāḥ // GarP_1,128.13 //
māṅgalyamabhiṣekaṃ ca malamāse vivarjayat /
darśāddarśasya cāndraḥ syāttriṃśāhobhistu sāvanaḥ // GarP_1,128.14 //
ravisaṃkramaṇātsauro nākṣatraḥ saptaviṃśatiḥ /
sauro māso vivāhāya yajñādau sāvanasthitiḥ // GarP_1,128.15 //
yugmāgniyugabhūtāni ṣaṇmunyorvasurandhrayoḥ /
rudreṇa dvādaśī yuktā caturdaśyātha pūrṇimā // GarP_1,128.16 //
pratipadyapyamāvāsyā tithyormasyaṃ mahāphalam /
etadvyastaṃ mahāghoraṃ hanti puṇyaṃ purā kṛtam // GarP_1,128.17 //
prārabdhatapasā strīṇāṃ rajo hanyādvrataṃ na hi /
anyairdānādikaṃ kuryātkāyikaṃ svayameva ca // GarP_1,128.18 //
krodhātpramādāllobhādvā vratabhaṅgo bhavedyadi /
dinatrayaṃ na bhuñjīta śiraso muṇḍanaṃ bhavet // GarP_1,128.19 //
asāmarthye śarīrasya putrādīnkārayedvratam /
vratasthaṃ mūrchitaṃ vipraṃ jalādīnyanupāyayet // GarP_1,128.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vrataparibhāṣā nāmāṣṭāviṃśatyuttaraśatatamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 129
brahmovāca /
vakṣye pratipadādīni vratāni vyāsa śṛṇvatha /
vāśvānarapadaṃ yāti śikhivratamidaṃ smṛtam // GarP_1,129.1 //
pratipadyekabhaktāśī samāpte kapilāpradaḥ /
caitrādau kārayeccaiva brahmapūjāṃ yathāvidhi /
gandhapuṣpārcanairdānairmālyādyaiśca manoramaiḥ // GarP_1,129.2 //
sahomaiḥ pūjayeddevaṃ sarvānkāmānavāpnuyāt /
kārtike ta site 'ṣṭamyāṃ puṣpahārī ca vatsaram // GarP_1,129.3 //
puṣpādidātā rūpeṇa rūpabhāgī bhavennaraḥ /
kṛṣṇapakṣe tṛtīyāyāṃ śrāvaṇe śrīdharaṃ śriyā // GarP_1,129.4 //
yajedaśūnyaśayyāyāṃ phalaṃ dadyāddvijātaye /
śayyāṃ dattvā prārthayecca śrīdharāya namaḥ śriyai // GarP_1,129.5 //
umāṃśivaṃ hutāśaṃ ca tṛtīyāyāṃ ca pūjayet /
haviṣyamanna naivedya deya damanakaṃ tathā // GarP_1,129.6 //
caitrādau phalamāpnoti umayā me prabhāṣitam /
phālgunāditṛtīyāyāṃ lavaṇaṃ yastu varjayet // GarP_1,129.7 //
samāpte śayanaṃ dadyādgṛhaṃ copaskarānvitam /
saṃpūjya vipramithanaṃ bhavānī prīyatāmiti // GarP_1,129.8 //
gaurīloke vasennityaṃ saubhāgyakaramuttamam /
gaurī kālī umā bhadrā durgā kāntiḥ sarasvatī // GarP_1,129.9 //
maṅgalā vaiṣṇavī lakṣmīḥ śivā nārāyaṇī kramāt /
mārgetṛtīyāmārabhya aviyogādimāpnuyāt // GarP_1,129.10 //
caturthyāṃ sitamāghādau nirāhāro vratānvitaḥ /
dattvā tilāṃstu viprāya svayaṃ bhuṅkte tilodakam // GarP_1,129.11 //
varṣadvaye samāptiśca nirvighnādiṃ samāpnuyāt /
gaḥ svāhā mūlamantro 'yaṃ praṇavena samanvitaḥ // GarP_1,129.12 //
glaiṃ glāṃhṛdaye gāṃ gīṃ hūṃ hrīṃ hrīṃ śiraḥ śikhā /
gūṃ varma goṃ ca gaiṃ netraṃ goṃ ca āvāhanādiṣu // GarP_1,129.13 //
āgaccholkāya ganandholkaḥ puṣpolko dhūpakolkakaḥ /
dīpolkāya maholkāya baliścātha visa (mār) janam // GarP_1,129.14 //
sidedholkāya ca gāyattrī (tra) nyāsoṃguṣṭhādirīritaḥ /
oṃ mahākarṇāya vidmahe--vakratuṇḍāya dhīmahi--tanno dantiḥ pracodayāt // GarP_1,129.15 //
pūjayottilahomaiśca ete pūjyā gaṇāstathā /
gaṇāya gaṇapataye svāhā kūṣmāṇḍakāya ca // GarP_1,129.16 //
amogholkāyaikadantāya tripurāntakarūpiṇe /
oṃ śyāma (va) dantavikarālāsyāhavepāya vai namaḥ // GarP_1,129.17 //
padmadaṃṣṭāya svāhānte mudrā vai nartanaṃ gaṇe /
hastatālaśca hasanaṃ saubhāgyādiphalaṃ bhavet // GarP_1,129.18 //
mārgaśīrṣe tathā śuklacaturthyāṃ pūjayedgaṇa /
abdaṃ prāpnoti vidyāśrīkīrtyāyuḥ putrasantatim // GarP_1,129.19 //
somavāre caturthyāṃ ca samupoṣyārcayedgaṇam /
japañjuhvatsmaranvidyā svargaṃ nirvāṇatāṃ vrajet // GarP_1,129.20 //
yajecchuklacaturthyāṃ yaḥ khaṇḍalaḍḍukamoda (maṇḍa) kaiḥ /
vighnācanena sarvānsa kāmānsaubhāgyamāpnuyāt // GarP_1,129.21 //
putrādikaṃ damanakairdamanākhyā caturthyapi /
āṃ gaṇapataye namaḥ caturthyantaṃ yajedgaṇam // GarP_1,129.22 //
māse tu yasminkasmiṃścijjuhuyādvā japetsmaret /
sarvānkāmānavāpnoti sarvavighnavināśanam // GarP_1,129.23 //
vināyakaṃ mūrtikādyaṃ yajedebhiśca nāmabhiḥ /
so 'pi sadgatimāpnoti svargamokṣasukhāni ca // GarP_1,129.24 //
gaṇapūjyo vakratuṇḍa ekadaṃṣṭrī triyambakaḥ /
nīlagrīvo lambodaro vikaṭo vighnarājakaḥ // GarP_1,129.25 //
dhūmravarṇo bhālacandro daśamasta vināyakaḥ /
gaṇapatirhastimukho dvādaśāre yajedgaṇam // GarP_1,129.26 //
pṛthak samastaṃ madhāvī sarvānkāmāna vāpnuyāt /
śrāvaṇe cāśvine bhādre pañcamyāṃ kāttika śubhe // GarP_1,129.27 //
vāsukistakṣakaścaiva kālīyo maṇibhadrakaḥ /
airāvato dhṛtarāṣṭaḥ karkoṭakadhanañjayau // GarP_1,129.28 //
ghṛtādyaiḥ snāpitā hyete āyurārogyasampadaḥ /
anantaṃ vāsukiṃ śaṅkhaṃ padmaṃ kambalameva ca // GarP_1,129.29 //
tathā karkāṭakaṃ nāgaṃ dhṛtarāṣṭraṃ ca śaṅkhakam /
kālīyaṃ takṣakaṃ caiva piṅgalaṃ māsimāsi ca // GarP_1,129.30 //
yajedbhādrasite nāgānaṣṭau muktiṃ divaṃ vrajet /
dvārasyobhayato lekhyāḥ śrāvaṇe tu site yajet // GarP_1,129.31 //
pañcamyāṃ pūjayennāgānanantāndyānmahoragān /
kṣīraṃ sarpiśca naivedyaṃ deyaṃ sarvaviṣāpaham /
nāgā abhayahastāśca daṣṭoddhārātu pañcamī // GarP_1,129.32 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe daṣṭoddhārapañcamavritaṃ nāmaikonatriṃśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 130
brahmovāca /
evaṃ bhādrapade māsi kārtikeyaṃ prapūyet /
snānadānādikaṃ sarvamasyāmakṣayyamucyate // GarP_1,130.1 //
saptamyāṃ prāśayeccapi bhojyaṃ viprānraviṃ yajet /
oṃ khakholkāyamṛtatvaṃ (tantaṃ) priyasaṅgamo bhava sada svāhā // GarP_1,130.2 //

aṣṭamyāṃ pāraṇaṃ kuryānmarīcaṃ prāśya svargabhāk
saptamyāṃ niyataḥ snātvā pūjayitvā divākaram // GarP_1,130.3 //
dadyātphalāni viprebhyo mārtaṇḍaḥ prīyatāmiti /
kharjūraṃ nārikelaṃ vā prāśayenmātuluṅgakam // GarP_1,130.4 //
sarve bhavantu saphalā mama kāmāḥ samantataḥ /
(iti phalasaptamī)
saṃpūjya devaṃ saptamyāṃ pāyasenātha bhojayet // GarP_1,130.5 //
viprāṃśca dakṣiṇāṃ dattvā svayaṃ cātha payaḥ pibet /
bhakṣyaṃ coṣyaṃ tathā lehyaṃ odanaṃ ceti kīrtitam // GarP_1,130.6 //

dhanaputrādikāmastu tyajedetadanodanaḥ
vāyvāśī vijayetkṣucca kuryādvijayasaptamīm /
adyādarkaṃ ca kāmecchurupavāse tarenmadam // GarP_1,130.7 //
godhūmamāṣayavaṣaṣṭikakāṃsyapātraṃ pāṣāṇapiṣṭamadhumaiṣunamadyamāṃsam /
abhyañjanāñjanatilāṃśca vivarjayedyaḥ tasyeṣitaṃ bhavati saptasu saptamīṣu // GarP_1,130.8 //
(iti vijayasaptamīvratam) /

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe saptamīvratanirūpaṇaṃ nāma triṃśottaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 131
brahmovāca /
brahman bhādrapade māsi śuklāṣṭamyāmupoṣitaḥ /
dūrvāṃ saurīṃ gaṇeśaṃ ca phalapuṣpaiḥ śivaṃ yajet // GarP_1,131.1 //
phalavrīhyādibhiḥ sarvaiḥ śambhavenamaḥ śivāya ca /
tvaṃ dūrve 'mṛjanmāsi hyaṣṭamī sarvakāmabhāk // GarP_1,131.2 //
anagnipakramaśrīyānmucyate brahmahatyayā /
(iti dūrvāṣṭamīvratam) /
kṛṣṇāṣṭamyāṃ ca rohiṇyāmardharātrer'canaṃ hareḥ // GarP_1,131.3 //
kāryā viddhāpi saptamyā hanti pāpaṃ trijanmanaḥ /
upoṣitor'cayenmantraistithi bhānte ca pāraṇam // GarP_1,131.4 //
yogāya yogapataye yogeśvarāya yogasambhavāya govindāya namonamaḥ /
(snānamantraḥ( yajñāya yajñeśvarāya yajñapataye govindāya namonamaḥ // GarP_1,131.5 //
(arcanadṛ)--viśvāya viśveśvarāya viśvapataye govindāya namonamaḥ /
(śayanadṛ)--sarvāya sarveśvarāya sarvetāya sarvasambhavāya govindāya namonamaḥ // GarP_1,131.6 //
sthaṇḍile pūjayeddevaṃ sacandrāṃ rohiṇīṃ tathā /
śaṅkhe toyaṃ samādāya sapuṣpaphalacandanam // GarP_1,131.7 //
jānubhyāmavanīṃ gatvā candrāyārghyaṃ nivedayet /
kṣirodārṇavasaṃbhūta ! atrinetrasamudbhava ! // GarP_1,131.8 //
gṛhāṇārghyaṃ śaśāṅkeśa (maṃ) rohiṇyā sahito mama /
śriyai ca vasude vāya nandāya ca balāya ca // GarP_1,131.9 //
yaśodāyai tato dadyādarghyaṃ phalasamanvitam /
anantaṃ (ghaṃ) vāmanaṃ śauriṃ vaikuṣṭhaṃ puruṣottamam // GarP_1,131.10 //
vāsudevaṃ hṛṣīkeśaṃ mādhavaṃ madhusūdanam /
varāhaṃ puṇḍarīkākṣaṃ nṛsiṃhaṃ daityasūdanam // GarP_1,131.11 //
dāmodaraṃ padmanābhaṃ keśavaṃ gāruḍadhvajam /
govindamacyutaṃ devamanantama parājitam // GarP_1,131.12 //
adhokṣajaṃ jagadvījaṃ sargasthityantakāraṇam /
anādinidhanaṃ viṣṇuṃ trilokeśaṃ trivikramam // GarP_1,131.13 //
nārāyaṇaṃ caturbāhuṃ śaṅkhacakragadādharam /
pītambaradharaṃ divyaṃ vanamālāvibhūṣitam // GarP_1,131.14 //
śrīvatsāṅkaṃ jagaddhāma śrīpatiṃ śrīdharaṃ harim /
yaṃ devaṃ devakī devī vasudevādajījanat // GarP_1,131.15 //
bhaumasya brahmaṇo guptyai tasmai brahmātmane namaḥ /
nāmānyetāni saṃkīrtya gatyarthaṃ prārthayetpunaḥ // GarP_1,131.16 //
trāhi māṃ devadeveśa ! hare ! saṃsārasāgarāt /
trāhi māṃ sarvapāpaghna ! duḥ khaśokārṇavātprabho ! // GarP_1,131.17 //
devakīnandana ! śrīśa ! hare ! saṃsārasāgarāt /
durvṛttāṃstrāyase viṣṇo ! ye smaranti sakṛtsakṛt // GarP_1,131.18 //
so 'haṃ devātidurvṛttastrāhi māṃ śokasāgarāt /
puṣkarākṣa ! nimagno 'haṃ mahtayajñānasāgare // GarP_1,131.19 //
trāhi māṃ devadeveśa ! tvāmṛte 'nyo na rakṣitā /
svajanma vāsudevāpa gobrāhmaṇahitāya ca // GarP_1,131.20 //
jagaddhitāya kṛṣṇāya govindāya namonamaḥ /
śāntirastu śivaṃ cāstu dhanavikhyātirājyabhāk // GarP_1,131.21 //
(iti kṛṣṇāṣṭamīvratam) /

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe kṛṣṇāṣṭamīvratanirūpaṇaṃ nā maikatriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 132
brahmovāca /
naktāśī tvaṣṭamīṃ yāvadvarṣānte caiva dhenudaḥ /
paurandarapadaṃ yāti sadgativratamucyate ! // GarP_1,132.1 //
śuklāṣṭabhyāṃ pauṣamāse mahārudreti sādhu vai /
matprītaye kṛtaṃ devi śathasāhasrikaṃ phalam // GarP_1,132.2 //
aṣṭamī budhavāreṇa pakṣayorubhayoryadā /
bhaviṣyati tadā tasyāṃ vratametatkathā parā // GarP_1,132.3 //
tasyāṃ niyamakartāro na syuḥ khaṇḍitasampadaḥ /
taṇḍulasyāṣṭamuṣṭīnāṃ varjayitvāṅgulidvayam // GarP_1,132.4 //
bhaktaṃ sadbhaktiśraddhābhyāṃ muktikāmī hi mānavaḥ /
āmra patrapuṭe kṛtvā yo bhuḍkte kuśavoṣṭite // GarP_1,132.5 //
kalambikāmlikopetaṃ kāmyaṃ tasya phalaṃ bhave (labhe) t /
budhaṃ pañcopacāreṇa pūjayitvā jalāśaye // GarP_1,132.6 //
śaktito dakṣiṇaṃ dadyātkarkarīṃ taṇḍulānvitām /
buṃ budhāyeti bījaṃ syātsvāhāntaḥ kamalādikaḥ // GarP_1,132.7 //
bāṇacāpadharaṃśyāmaṃ dale cāṅgani madhyataḥ /
budhāṣṭamīkathā puṇyā śrotavyā kṛtibhirdhruvam // GarP_1,132.8 //
pure pāṭaliputrākhye vīro nāma dvijottamaḥ /
rambhā bhāryā tasya cāsītkauśikaḥ putra uttamaḥ // GarP_1,132.9 //
duhitā vijayānāmnī va (dha) napālo vṛṣo 'bhavat /
gṛhītvā kauśikastaṃ ca grīṣme gaṅgāṃ gato 'ramat // GarP_1,132.10 //
gopālakairvṛṣaścauraiḥ krīḍāsthopahṛto balāt /
gaṅgātaḥ sa ca utthāya vanaṃ babhrāma duḥ khitaḥ // GarP_1,132.11 //
jalārthaṃ vijayā cāgādbhrā(nmā) trā sārdhaṃ ca sāpyagāt /
pipāsito mṛṇālārtho āgato 'tha sarovaram // GarP_1,132.12 //
divyastrīṇāṃ ca pūjādīndṛṣṭvā cāpyatha vismitaḥ /
sa tā gatvā yayāce 'nnaṃ sānujo 'haṃ bubhukṣitaḥ // GarP_1,132.13 //
striyo 'bruvanvrataṃ kartuṃ dāsyāmaśca kuru vratam /
patnyarthaṃ dhanapānā (lār) thaṃ pūjayāmāsaturbudham // GarP_1,132.14 //
puṭadvayaṃ gṛhītvānnaṃ bubhujāte pradattakam /
striyo gatāstau dhanadau dhanapānamapaśyatām // GarP_1,132.15 //
caurairdattaṃ gṛhītvātha pradoṣe prāptavān gṛham /
vīraṃ ca duḥ khitaṃ natvā rātrau supto yathāsukham // GarP_1,132.16 //
kanyāṃ ca yuvatīṃ dṛṣṭvā kasmai deyā sutā mayā /
yamāyetyabravīdduḥ khātsācārādvratasatphalāt // GarP_1,132.17 //
svargaṃ gatau ca pitarau vrataṃ rājyāya kau śikaḥ /
cakre 'yodhyāmahārājyaṃ dattvā ca bhaginīṃ yame // GarP_1,132.18 //
yamo 'pi vijayāmāha gṛhasthā bhava me pure /
noddhāṭayānyatragate yame sā na tathākarot /
apaśyanmātaraṃ svāṃ sā pāśayātanayā sthitām // GarP_1,132.19 //
athodvignā kośikoktaṃ jñātvā muktipradaṃ vratam /
cakre ca sā tato muktā mātā tasmāccaredvratam // GarP_1,132.20 //
vtapuṇyaprabhāveṇa svargaṃ gatvāvasatsukham // GarP_1,132.21 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe budhāṣṭamīvratanirūpaṇaṃ nāma dvātriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 133
brahmovāca /
aśokakalikā hyaṣṭau ye pibanti punarvasau /
caitre māsi sitāṣṭamyāṃ na te śokamavāpnuyuḥ // GarP_1,133.1 //
tvāmaśoka ! harābhīṣṭa ! madhumāsasamudbhava /
pibāmi śokasantapto māmaśokaṃ sadā kuru // GarP_1,133.2 //
(ityaśokāṣṭamīvratam) /
brahmovāca /
śuklāṣṭamyāmāśvayuje uttarāṣāḍhayā yutā /
sā mahānavamītyuktā snānadānādi cākṣayam // GarP_1,133.3 //
navamī kevalā cāpi durgāṃ caiva tu pūjayet /
mahāvrataṃ mahāpuṇyaṃ śaṅkarādyairanuṣṭhitam // GarP_1,133.4 //
ayācitādi ṣaṣṭhyādau rājā śatrujayāyā ca /
japahomasamāyuktaḥ kanyāṃ vā bhojayetsadā // GarP_1,133.5 //
durgedurge rakṣiṇi svāhā mantro 'yaṃ pūjanādiṣu /
dīrghākārādimātrābhirnava devyo namo 'ntikāḥ // GarP_1,133.6 //
ṣaḍbhiḥ padairnamaḥ svāhā vaṣaḍādihṛdādikam /
aṅguṣṭhādikaniṣṭhāntaṃ nyasya vai pṛjayecchivām // GarP_1,133.7 //
aṣṭamyāṃ nava gehāni dārujānyekameva vā /
tasmindevī prakartavyā haimī vārājatāpi vā // GarP_1,133.8 //
śūle khaṅge pustake vā paṭe vā maṇḍale (pe) yajet /
kapālaṃ kheṭakaṃ ghaṇṭāṃ darpaṇaṃ tarjanīṃ dhanaḥ // GarP_1,133.9 //
dhvajaṃ ḍamarukaṃ pāśaṃ vāmahasteṣu bibhratī /
śaktiṃ ca mudgaraṃ śūlaṃ vajraṃ khaṅgaṃ tathāṅkuśam // GarP_1,133.10 //
śaraṃ cakraṃ śalākāṃ ca durgāmāyudhasaṃyutām /
śeṣāḥ ṣoḍaśahastāṃ syurañjanaṃ ḍamaruṃ vinā // GarP_1,133.11 //
rudracaṇḍā pracaṇḍā ca caṇḍogrā caṇḍanāyikā /
caṇḍā caṇḍavatī caiva caṇḍarūpāticaṇḍikā // GarP_1,133.12 //
navamī cogracaṇḍā ca madhyamāgniprabhākṛtiḥ /
rocanā tvaruṇā kṛṣṇā nīlaṃ dhūmrā ca śukrakā // GarP_1,133.13 //
pātā ca pāṇḍurā proktā ālīḍhaṃ haritaṃ tathā /
ma (mā) hiṣo 'sya sa khaḍgāgraprakacagrahamuṣṭikaḥ // GarP_1,133.14 //
japtvā daśākṣarīṃ vidyāṃ nāsau kenāpi badhyate /
pañca (ñcā) daśāṅgulaṃ khaḍgaṃ triśūlaṃ ca tato yajet /
liṅgasyāṃ pūjayedvāpi pāduke 'tha jale 'pi vā // GarP_1,133.15 //
vicitrāṃ rakṣayetpūjāmaṣṭamyāmupavāsayet /
pañcābdaṃ mahiṣaṃ bastaṃ rātriśeṣe ca ghātayet // GarP_1,133.16 //
vidhivatkālikālīti taduttharudhirādikam /
nerṛtyāṃ pūtanāṃ caiva vāyavyāṃ pāparākṣasīm // GarP_1,133.17 //
dadyāccarakyai caiśānyāmāgneyyāṃ ca vidārikām // GarP_1,133.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe mahānavamīvrataṃ nāma trayastriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 134
brahmovāca /
mahākauśikamantraśca kathyate 'tra mahāphalaḥ // GarP_1,134.1 //
(mahākauśikamantraḥ)-oṃ mahākauśikāya namaḥ /
oṃ hūṃ hūṃ prasphura lala lala kulva kulva culva culva khalla khalla mulva mulva gulva gulva tulva pulla pulla dhalva dhulva dhuma dhuma dhamadhama māraya māraya dhakadhaka vajñāpayajñāpaya vidārayavidāraya kampakampa kampayakampaya pūrayapūraya āveśayāveśaya oṃ hrīṃ oṃ hrīṃ haṃ vaṃ vaṃ huṃ taṭataṭa madamada hrīṃ oṃ hūṃ nairṛtāyā namaḥ nirṛtaye dātavyam /
mahākauśikamantreṇa mantritaṃ balimarpayet // GarP_1,134.2 //
tasyāgrato nṛpaḥ snāyācchatraṃ kṛtvā ca paiṣṭikam /
khaḍgena ghātayitvā tu dadyātskandaviśākhayoḥ // GarP_1,134.3 //
mātṝṇāṃ caiva devīnāṃ pūjā kāryā tathā niśi /
brahmāṇī caiva māheśī kaumārī vaiṣṇavī tathā // GarP_1,134.4 //
vārāhī caiva māhendrī cāmuṇḍā caṇḍikā tathā /
jayantī maṅgalā kālī bhadrakālī kapālinī // GarP_1,134.5 //
durgā kṣamā śivā dhātrī svāhā svadhā namo 'stu te /
kṣīrādyaiḥ snāpayeddevīṃ kanyakāḥ pramadāstathā // GarP_1,134.6 //
dvijātī (dī) natha pāṣaṇḍānannadānena pūjayet /
dhvajapatrapatākādyai rathayātrāsu vastrakaiḥ /
mahānavamyāṃ pūjeyaṃ jayarājyādidāyikā // GarP_1,134.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe mahānavamyāṃ mahākauśikamantrakṛtyādivivaraṇaṃ nāma catustriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 135
brahmovāca /
navamyāmāśvine śukle ekabhaktena pūjayet /
devīṃ vipraṃllakṣamekañjapedvīraṃ vratī naraḥ // GarP_1,135.1 //
(ti vīranavamīvratam) /
brahmovāca /
caitre śuklanavamyāṃ ca devīṃ damanakairyajet /
āyurārogyasaubhāgyaṃ śatrubhiścāparājitaḥ // GarP_1,135.2 //
(iti damanakanavamīvratam) /
brahmovāca /
daśamyāmekabhaktāśī samānte daśadhenudaḥ /
diśaśca kāñcanīrdattvā brahmāṇḍādhipatirbhavet // GarP_1,135.3 //
(iti digdaśamīvratam) brahmovāca /
ekādaśyāmṛṣipūjā kāryā sarvopakārikā /
dhanavānputravāṃścānte ṛṣiloke mahīyate // GarP_1,135.4 //
marīciratryaṃ girasau pulasatyaḥ pulahaḥ kratuḥ /
pracetāśca vasiṣṭhaśca bhṛgurnārada eva ca // GarP_1,135.5 //
caitrādau kārayetpūjāṃ mālyaiśca damanodbhavaiḥ /
aśokākhyāṣṭamīproktā vīrākhyā navamītathā // GarP_1,135.6 //
damanākhyā digdaśamī navamyekādaśī tathā // GarP_1,135.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ṛṣyekādaśīvrataṃ nāma pañcatriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 136
brahmovāca /
śravaṇadvādaśoṃ vakṣye bhuktimuktipradāyinīm /
ekādaśī dvādaśī ca śravaṇena ca saṃyutā // GarP_1,136.1 //
vijayā sā tithiḥ proktā haripūjādi cākṣayam /
eka bhaktena naktena tathaivāyācitena ca // GarP_1,136.2 //
upavāsena bhaikṣyeṇa naivādbādaśiko bhavet /
kāsyaṃ māṃsaṃ tathā kṣaudraṃ lobhaṃ vitathabhāṣaṇam // GarP_1,136.3 //
vyāyāmaṃ ca vyavāyaṃ ca divāsvapnamathāñjanam /
śilāṣiṣṭaṃ masūraṃ ca dvādaśyāṃ varjayennaraḥ // GarP_1,136.4 //
māsī bhādrapade śuklā dvādaśī śravaṇānvitā /
mahatī dvādaśī jñeyā upavāse mahāphalā // GarP_1,136.5 //
saṃgama saritāṃ snānaṃ budhayuktā mahāphalā /
kuṃbhe saratne sajale yajetsvarṇaṃ tu vāmanam // GarP_1,136.6 //
sitavastrayugacchannaṃ chatropānadyugānvitam /
oṃ namo vāsudevāya śiraḥ saṃpūjayettataḥ // GarP_1,136.7 //
śrīdharāya mukhaṃ tadvatkaṇṭhaṃ kṛṣṇāya vai namaḥ /
namaḥ śrīpataye vakṣo bhujau sarvāstradhāriṇe // GarP_1,136.8 //
vyāpakāya namaḥ kukṣau keśavāyodaraṃ budhaḥ /
trailokyapataye meḍhraṃ jaṅghe sarvabhṛte namaḥ // GarP_1,136.9 //
sarvātmane namaḥ pādau naivedyaṃ ghṛtapāyasam /
kumbhāṃśca modakāndadyājjāgaraṃ kārayenniśi // GarP_1,136.10 //
snātvācāntor'cayitvā tu kṛtapuṣpāñjalirvadet /
namonamaste govinda budha śravaṇasaṃjñaka ! // GarP_1,136.11 //
aghaughasaṃkṣayaṃ kṛtvā sarvasaukhyaprado bhava /
prīyatāṃ devadeveśo viprebhyaḥ kalaśāndadet /
nadyastīre 'yaḥ vā kuryātsarvānkāmānavāpnuyāt // GarP_1,136. 12 //

iti śrīgāruḍe mahāpurāṇe purvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śravaṇadvādaśīvratanirūpaṇaṃ nāma ṣaṭtriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 137
brahmovāca /
kāmadevatrayodaśyāṃ pūjyo damanakādibhiḥ /
ratiprītisamāyukto hyasoko maṇibhūṣitaḥ // GarP_1,137.1 //
(iti madanakatrayodaśīvratam) /
caturdaśyāṃ tathāṣṭabhyāṃ pakṣyoḥ śuklakṛṣṇayoḥ /
yo 'bdamekaṃ na bhuñjīta muktibhāk śivapūjanāt // GarP_1,137.2 //
(iti śivacaturdaśyaṣṭamīvratam) /
trirātropoṣito dadyātkārtikyāṃ bhavanaṃ śubham /
sūryalokamavāpnoti dhāmavratamidaṃ śubham // GarP_1,137.3 //
amāvasyāṃ pitṝṇāṃ ca dattaṃ jalāditadakṣayam /
naktābhyāśī vāranāmnā yajanvārāṇi sarvabhāk // GarP_1,137.4 //
(iti vāravratāni) /
dvādaśarkṣāṇi viprarṣe ! pratimāsaṃ tu yāni vai /
tannāmnānte 'tacyutaṃ teṣu samyak saṃpūjayennaraḥ // GarP_1,137.5 //
keśavaṃ mārgaśīrṣe tu ityādau kṛtikādike (kā) /
ghṛtahomaścaturmāsaṃ kṛsarañca nivedayet // GarP_1,137.6 //
āṣāḍhādau pāyasaṃ tu viprāṃstenaiva bhojayet /
pañcāvyajalasnānanaivedyairnaktamācaret // GarP_1,137.7 //
arvāgvisarjanāddravyaṃ naivedyaṃ sarvamucyate /
visarjite jagannāthe nirmālyaṃ bhavati kṣaṇāt // GarP_1,137.8 //
pāñcarātravido mukhyā naivedyaṃ bhuñjate svayam /
evaṃ saṃvatsarasyānte viśeṣeṇa prapūjayet // GarP_1,137.9 //
namonamaste 'cyuta ! saṃkṣayo 'stu pāpasya vṛddhiṃ samupaitu puṇyam /
aiśvaryavittādi sadākṣayaṃ me tathāstu me santatirakṣayaiva // GarP_1,137.10 //
yathācyuta !tvaṃ parataḥ parasmātsa brahmabhūtaḥ parataḥ parasmāt /
tathācyutaṃ me kuru vāñchitaṃ sadā mayā kṛtaṃ pāpaharāprameya // GarP_1,137.11 //
acyutānanta ! govinda ! prasīda yadabhīpsitam /
tadakṣayamameyātmankuruṣva puruṣottama // GarP_1,137.12 //
kuryādvai sapta varṣāṇi āyuḥ śrīsadgatīrnaraḥ /
upoṣyaikādaśībdamaṣṭamīṃ ca caturdaśīm // GarP_1,137.13 //
saptamīṃ pūjayedviṣṇuṃ durgāṃ śambuṃ raviṃ kramāt /
teṣāṃ lokaṃ samāpnoti sarvakāmāṃśca nirmalaḥ // GarP_1,137.14 //
ekabhaktena naktena tathaivāyācitena ca /
upavāsena śākādyaiḥ pūjayantasarvadevatāḥ // GarP_1,137.15 //
sarvaḥ sarvāsu tithiṣu bhuktiṃ muktimavāpnuyāt /
dhanado 'gniḥ pratipadi nāsatyo dastra arcitaḥ // GarP_1,137.16 //
śrīryamaśca dvitīyāyāṃ pañcamyā pārvatī śriyā /
nāgāḥ ṣaṣṭhyāṃ kārtikeyaḥ saptamyāṃ bhāskaror'thadaḥ // GarP_1,137.17 //
durgāṣṭamyāṃ mātaraśca navamyāmatha takṣakaḥ /
indro daśamyāṃ dhanada ekādaśyāṃ munīśvarāḥ // GarP_1,137.18 //
dvādaśyāṃ ca hariḥ kāmastrayodaśyāṃ maheśvaraḥ /
caturdaśyāṃ pañcadaśyāṃ brahmā ca pitaro 'pare // GarP_1,137.19 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe tithivāranakṣatrādivratanirūpaṇaṃ nāma saptatriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 138
(iti vratāni samāptāni) /
hariruvāca /
rājñāṃ vaṃśānpravakṣyāmi vaṃśānucaritāni ca /
viṣṇunābhyabjato brahmā dakṣo 'ṅguṣṭhācca tasya vai // GarP_1,138.1 //
tato 'pitarvivasvāṃśca tataḥ sūnurvivasvataḥ manurikṣvākuśaryātī nṛgo dhṛṣṭaḥ praṣadhrakaḥ // GarP_1,138.2 //
nariṣyantaśca nābhāgo diṣṭaḥ śaśaka eva ca /
manorāsīdilā kanyā sudyumno 'sya suto 'bhavat // GarP_1,138.3 //
ilāyāṃ tu budhājjāto rājā rudra purūravāḥ /
sutāstrayaśca sudyumnādutkalo vinato gayaḥ // GarP_1,138.4 //
abhṛcchradro govadhāttu pṛṣadhrastu manoḥ sutaḥ /
karūṣātkṣattriyā jātā kārūṣā iti viśrutāḥ // GarP_1,138.5 //
diṣṭaputrastu nābhāgo vaiśyātāmagamatsa ca /
tasmādbhalandanaḥ putro vatsaprītirbhalandanāt // GarP_1,138.6 //
tataḥ pāṃśuḥ khanitro 'bhūdbhūpastasmāttataḥ kṣupaḥ /
kṣupādviṃśo 'bhavatputro viṃśājjāto viviṃśakaḥ // GarP_1,138.7 //
viviṃśācca khanīnetro vibhūtistatsutaḥ smṛtaḥ /
karandhamo vibhūtestu tato jāto 'pyavikṣitaḥ // GarP_1,138.8 //
marutto 'vikṣitasyāpi nariṣyantastataḥ smṛtaḥ /
nariṣyantāttamo jātastatobhūdrājavardhanaḥ // GarP_1,138.9 //
rājavardhātsudhṛtiśca naro 'bhūtsudhṛteḥ sutaḥ /
narācca kevalaḥ putraḥ kevalāddhundhumānapi // GarP_1,138.10 //
dhundhumato vegavāṃśca budho vegavataḥ sutaḥ /
tṛṇabindurbudhājjātaḥ kānyā cailavilā tathā // GarP_1,138.11 //
viśālaṃ janayāmāsa tṛṇabindostvalambusā /
viśālāddhemacandro 'bhūddhema candrācca candrakaḥ // GarP_1,138.12 //
dhūmrāśvaścaiva candrāttu dhūmrāśvātsṛñjayastathā /
sañjayātsahadevo 'bhūtkṛśāśvastatsuto 'bhavat // GarP_1,138.13 //
kṛśāśvātsomadattastutato 'bhūjjanamejayaḥ /
tatputraśca sumantiśca ete vaiśālakā nṛpāḥ // GarP_1,138.14 //
śaryātestu sukanyābūtsā bhāryā cyavanasya tu /
ananto nāma śāryate ranantādrevato 'bhavat // GarP_1,138.15 //
raivato revatasyāpi raivatādrevatī sutā /
dhṛṣṭasya dhārṣṭar (ta) kaṃ kṣetraṃ vaiṣṇavaṃ (śyakaṃ) tadvabhūva ha // GarP_1,138.16 //
nābhāgaputro neṣṭho hyambarīṣo 'pi tatsutaḥ /
ambarīṣādvirūpo 'bhūtpṛṣadaśvo virūpataḥ // GarP_1,138.17 //
rathīnaraśca tatputro vāsudevaparāyaṇaḥ /
ikṣvākostu trayaḥ putrāḥ vikukṣinimidaṇḍakāḥ // GarP_1,138.18 //
ikṣvākujo vikukṣistu śaśādaḥ śaśabhakṣaṇāt /
purañjayaḥ śaśādācca kakutsthākhyo 'bhavatsutaḥ // GarP_1,138.19 //
anenāstu kakutsathācca pṛthuḥ putrastvanenasaḥ /
viśvarātaḥ pṛthoḥ putra ārdre 'bhūdviśvarātataḥ // GarP_1,138.20 //
yuvanāśvo 'bhavaccārdrācchāvasto yuvanāśvataḥ /
bṛhadaśvastuśāvastāttatputraḥ kuvalāśvakaḥ // GarP_1,138.21 //
dhundhumāro hi vikyāto dṛḍhaśvaścatato 'bhavat /
candrāśvaḥ kapilāśvaśca haryaśvaśca dṛḍhaśvataḥ // GarP_1,138.22 //
haryaśvācca nikumbo 'bhūddhitāśvaśca nikumbhataḥ /
pūjāśvaśca hitāśvācca tatsato yuvanāśvakaḥ // GarP_1,138.23 //
yuvanāśvācca māndhātā bindumatyāstato 'bhavat /
mucukundo 'mbarīṣaśca purukutsastrayaḥ sutāḥ // GarP_1,138.24 //
pañcāśatkanyakāścaiva bhāryāstāḥ saubharermuneḥ /
yuvanāśvo 'mbarīṣācca harito yuvanāśvataḥ // GarP_1,138.25 //
purukutsānnarmadāyāṃ trasadasyurabūtsutaḥ /
anaraṇyastato jāto haryaśvo 'pyanaraṇyataḥ // GarP_1,138.26 //
tatputro 'bhūdvasumanāstridhanvā tasya cātmajaḥ /
trayyāruṇastasya putrastasta satyarataḥ sutaḥ // GarP_1,138.27 //
yastriśaṅkuḥ samākhyāto hariścandro 'bhavattataḥ /
hariścandrādrohitāśvo harito rohitāśvataḥ // GarP_1,138.28 //
haritasya sutaścañcuścañcośca vijayaḥ sutaḥ /
vijayādruruko jajñe rurukāttu vṛkaḥ sutaḥ // GarP_1,138.29 //
vṛkādbāhurnṛpo 'bhūcca bāhostu sagaraḥ smṛtaḥ /
ṣaṣṭiḥ putra sahasrāṇi sumatyāṃ sagarāddhara // GarP_1,138.30 //
keśinyāmeka evāsāvasamañjasasaṃjñakaḥ // GarP_1,138.31 //
tasyāṃśumānsuto vidvāndilīpastatsuto 'bhavat /
bhagīratho dilīpācca yo gaṅgāmānayadbhuvam // GarP_1,138.32 //
śruto bhagīrathasuto nābhagaśca śrutātkila /
nābhāgādambarīṣo 'bhūtsindudvīpo 'mbarīṣataḥ // GarP_1,138.33 //
sindudvīpasyāyutāyurṛtuparṇastadātmajaḥ /
ṛtuṣarṇātsarvakāmaḥ sudāso 'bhūttadātmajaḥ // GarP_1,138.34 //
sudāsasya ca saudāso nāmnā mitrasahaḥ smṛtaḥ /
kalmāṣa pādasaṃjñaśca damayantyāṃ tadātmajaḥ // GarP_1,138.35 //
aśvakākhyo 'bhavatputro hyaśvakānmūla(nmṛccha) ko 'bhavat /
tato daśaratho rājā tasya cailavilaḥ sutaḥ // GarP_1,138.36 //
tasya viśvasahaḥ putraḥ khaṭvāṅgaśca tadātmajaḥ /
khaṭvāṅgaddīrghabāhuśca dīrghabāhorhyajaḥ sutaḥ // GarP_1,138.37 //
tasya puttro daśarathaścatvārastatsutāḥ smṛtāḥ /
rāmalakṣmaṇaśatrughnabharatāśca mahābalāḥ // GarP_1,138.38 //
rāmātkuśalavau jātau bharatāttārkṣapuṣkarau /
citrāṅgadaścandraketurlakṣmaṇātsaṃbabhūvatuḥ // GarP_1,138.39 //
subāhuśūrasenau ca śatrughnātsaṃbabhūvatuḥ /
kuśasya cātithiḥ putro niṣadho hyatitheḥ sutaḥ // GarP_1,138.40 //
niṣadhasya nalaḥ putro nalasya ca nabhāḥ smṛtaḥ /
nabhasaḥ puṇḍarīkastukṣemadhanvā tadātmajaḥ // GarP_1,138.41 //
devānīkastasya putro devānīkādahīnakaḥ /
ahīnakādrururyajñe pāriyātro ruroḥ sutaḥ // GarP_1,138.42 //
pāriyātrāddalo yajñe dala putraśchalaḥ smṛtaḥ /
chalādukthastato hyukthādvajranābhastato gaṇaḥ // GarP_1,138.43 //
uṣitāśvo gaṇājjajñe tato viśvasaho 'bhavat /
hiraṇyanābhastatputrastatputraḥ puṣpakaḥ smṛtaḥ // GarP_1,138.44 //
dhruvasandhirabhūtpuṣpāddhruvasandheḥ sudarśanaḥ /
sudarśanādagnivarṇaḥ padmavaṇo 'gnivarṇataḥ // GarP_1,138.45 //
śīghrastu padmavarṇāttu śīghrātputro marustvabhūt /
maroḥ prasuśrutaḥ putrastasya codāvasuḥ sutaḥ // GarP_1,138.46 //
udāvasornandivardhanaḥ suketurnandivardhanāt /
suketordevarāto 'bhūdvṛhadukthastataḥ sutaḥ // GarP_1,138.47 //
bṛhadukthānmahāvīryaḥ sudhṛtistasya cātmajaḥ /
sudhṛterdhṛṣṭaketuśca haryaśvo dhṛṣṭaketutaḥ // GarP_1,138.48 //
haryaśvāttu marurjāto maroḥ pratīndhako 'bhavat /
pratīndhakātkṛtiratho devamīḍhastadātmajaḥ // GarP_1,138.49 //
vibudho devamīḍhāttu vibudhāttu mahādhṛtiḥ /
mahādhṛteḥ kīrtirāto mahāromā tadātmajaḥ // GarP_1,138.50 //
mahāromṇaḥ svarṇaromā hrasvaromā tadātmajaḥ /
sīradhvajo hrasvaromṇaḥ tasya sītābhavatsutā // GarP_1,138.51 //
bhrātā kuśadhvajastasya sīradhvajāttu bhānumān /
śatadyumno bhānumataḥ śatadyumnācchuciḥ smṛtaḥ // GarP_1,138.52 //
ūrjanāmā śuceḥ putraḥ sanadvājastadātmajaḥ /
sanadvājātkulirjāto 'nañjanastu kuleḥ sutaḥ // GarP_1,138.53 //
anañjanācca kulajittasyāpi cādhinemikaḥ /
śrutāyustasya putro 'bhūtsupārśvaśca tadātmajaḥ // GarP_1,138.54 //
supārśvātsṛṃjayo jātaḥ kṣemāriḥ sṛjayātsamṛtaḥ /
kṣemāri tastvanenāśca tasya rāmarathaḥ smṛtaḥ // GarP_1,138.55 //
satyaratho rāmarathāttasmādupaguruḥ smṛtaḥ /
upagurorupaguptaḥ svāgataścopaguptataḥ // GarP_1,138.56 //
svanaraḥ svāgatājjajñe suvarcāstasya cātmajaḥ /
suvarcasaḥ supārśvastu suśrutaśca supārśvataḥ // GarP_1,138.57 //
jayastu suśrutājjajñe jayāttu vijayo 'bhavat /
vijayasya ṛtaḥ putraḥ ṛtasya sunayaḥ sutaḥ // GarP_1,138.58 //
sunayādvītahavyastu vītahavyāddhatiḥ smṛtaḥ /
bahulāśvo dhṛteḥ putro bahulāśvātkṛtiḥ smṛtaḥ // GarP_1,138.59 //
janakasya dvaye vaṃśe ukto yogasamāśrayaḥ // GarP_1,138.60 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sūryavaṃśavarṇanaṃ nāmāṣṭatriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 139
hariruvāca /
sūryasya kathito vaṃśaḥ somavaṃśaṃ śṛṇuṣva me /
nārāyaṇasuto brahmā brahmaṇo 'treḥ samudbhavaḥ // GarP_1,139.1 //
atreḥ somastasya bhāryā tārā suraguroḥ priyā /
somāttarā budhaṃ jajñe budhaputraḥ purūravāḥ // GarP_1,139.2 //
budhaputrādathorvaśyāṃ ṣaṭ putrāstu śrutātmakaḥ /
viśvāvasuḥ śatāyuśca āyurdhomānamāvasuḥ // GarP_1,139.3 //
amāvasorbhomanāmā bhīmaputraśca kāñcanaḥ /
kāñcanasya suhotro 'bhūjjahruścābhūtsuhotrataḥ // GarP_1,139.4 //
jahnoḥ sumanturabhavatsumantorapajāpakaḥ /
balākāśvastasya putro balākāśvāt kuśaḥ smṛtaḥ // GarP_1,139.5 //
kuśāśvaḥ kuśanābhaścāmūrtarayo vasuḥ kuśāt /
gādhiḥ kuśāśvātsaṃjajñe viśvāmitrastadātmajaḥ // GarP_1,139.6 //
kanyā satyavatī dattā ṛcīkāya dvijāya sā /
ṛcīkājjamadāgniśca rāmastasyābhavatsutaḥ // GarP_1,139.7 //
viśvāmitrāddevarātamaducchandādayaḥ sutāḥ /
āyuṣo nahuṣastasmādanenā rajirambhakau // GarP_1,139.8 //
kṣattravṛddhaḥ kṣattravṛddhātsuhotraścābhavannṛpaḥ /
kāśyakāśaugṛtsamadaḥ suhotrādabhavaṃstrayaḥ // GarP_1,139.9 //
gṛtsamadācchauna ko 'bhūtkāśyāddīrghatamāstathā /
vaidyo dhanvantaristasmātketumāṃśca tadātmajaḥ // GarP_1,139.10 //
bhīmarathaḥ ketumato divodāsastadātmajaḥ /
divodāsātpratardanaḥ śatrujitso 'tra viśrutaḥ // GarP_1,139.11 //
ṛtadhvajastasya putro hyalarkaśca ṛtadhvajāt /
alarkātsannatirjajñe sunītaḥ sannateḥ sutaḥ // GarP_1,139.12 //
satyaketuḥ sunītasya satyaketorvibhuḥ sutaḥ /
vibhostu suvibhuḥ putraḥ suvibhoḥ sukumārakaḥ // GarP_1,139.13 //
sukumārāddhṛṣṭaketurvotihotrastadātmajaḥ /
vītihotrasya bhargo 'bhūdbhargabhūmistadātmajaḥ // GarP_1,139.14 //
vaiṣṇavāḥ syurmahātmāna ityete kāśayo nṛpāḥ /
pañcaputraśatānyāsanrajeḥ śakreṇa saṃhṛtāḥ // GarP_1,139.15 //
pratikṣattraḥ kṣattravṛddhātsaṃjayaśca ta dātmajaḥ /
vijayaḥ saṃjayasyāpi vijayasya kṛtaḥ sutaḥ // GarP_1,139.16 //
kṛtādvṛṣadhanaścābhūtsahadevastadātmajaḥ /
sahadevādadīno 'bhūjjayatseno 'pyadīnataḥ // GarP_1,139.17 //
jayatsenātsaṃkṛtiśca kṣattradharmā ca saṃkṛteḥ /
yatiryayātiḥ saṃyātirayātirvikṛtiḥ kramāt // GarP_1,139.18 //
nahuṣasya sutāḥ khyātā yayāternṛpatestathā /
yaduṃ ca turvasuṃ caiva devayānī vyajāyata // GarP_1,139.19 //
druhyuṃ cānuṃ ca pūruñca śarmiṣṭhā vārṣapārvaṇī /
sahasrajītkroṣṭumanā raghuścaiva yadoḥ sutāḥ // GarP_1,139.20 //
sahasrajitaḥ śatajittasmādvai hayahaihayau /
anaraṇyo hayātputro dharmo haihayato 'bhavat // GarP_1,139.21 //
dharmasya dharmanetro 'būtkuntirvai dharmanetrataḥ /
kunterbabhūta sāhañjirmahiṣmāṃśca tadātmajaḥ // GarP_1,139.22 //
bhadraśreṇyastasya puttro bhadraśreṇayasya durdamaḥ /
dhanako durdamāccaiva kṛtavīryaśca jānakiḥ // GarP_1,139.23 //
kṛtāgniḥ kṛtakarmā ca kṛtaujāḥ sumahābalaḥ /
kṛtavīryādarjuno 'bhūdarjunācchūrasenakaḥ // GarP_1,139.24 //
jayadhvajo madhuḥ śūro vṛṣaṇaḥ pañca savratāḥ /
jayadhvajāttālajaṅgho bharatastālajaṅgataḥ // GarP_1,139.25 //
vṛṣaṇasya madhuḥ puttro madhorvṛṣṇyādivaṃśakaḥ /
kroṣṭorvijajñivānputtra āhistasya mahātmanaḥ // GarP_1,139.26 //
āheruśaṅkuḥ saṃjajñetasya citrarathaḥ sataḥ /
śaśabinduścitrarathātpatnyo lakṣañca tasya ha // GarP_1,139.27 //
daśalakṣañca putrāṇāṃ pṛthukīrtyādayo varāḥ /
pṛthukīrtiḥ pṛthujayaḥ pṛthudānaḥ pṛthuśravāḥ // GarP_1,139.28 //
pṛthuśravaso 'bhūttama uśanāstamaso 'bhavat /
tatputraḥ śitagurnāma śrīrukmakavacastataḥ // GarP_1,139.29 //
rukmaśca pṛthurukmaśca jyāmaghaḥ pālito hariḥ /
śrīrukmakavacasyaite vidarbho jyāmaghāttathā // GarP_1,139.30 //
bhāryāyāñcaiva śaibyāyāṃ vidarbhātkrathakauśikau /
romapādo romapādādbabhrurbabhrordhṛtistathā // GarP_1,139.31 //
kauśikasya ṛciḥ putraḥ tataścaidyo nṛpaḥ kila /
kuntiḥ kilāsya putro 'bhūtkuntervṛṣṇiḥ sutaḥ smṛtaḥ // GarP_1,139.32 //
vṛṣṇeśca nivṛtiḥ putro daśārhe nivṛtestathā /
daśārhasya suto vyomā jīmūtaśca tadātmajaḥ // GarP_1,139.33 //
jīmūtādvikṛtirjajñe tato bhīmaratho 'bhavat /
tato madhuratho jajñe śakunistasya cātmajaḥ // GarP_1,139.34 //
karambhiḥ śakuneḥ putrastasya vai devavānsmṛtaḥ /
devakṣattro devanato devakṣattrānmadhuḥ smṛtaḥ // GarP_1,139.35 //
kuruvaṃśo madhoḥ putro hyanuśca kuruvaṃśataḥ /
puruhotro hyanoḥ putro hyaṃśuśca puruhotrataḥ // GarP_1,139.36 //
sattvaśrutaḥ sutaścāṃśostato vai sāttvato nṛpaḥ /
bhajino bhajamānaśca sātvatādandhakaḥ sutaḥ // GarP_1,139.37 //
mahābhojo vṛṣṇi divyāvanyo devāvṛdho 'bhavat /
nimivṛṣṇī bhajamānādayutājittathaiva ca // GarP_1,139.38 //
śatajicca sahasrājidbabhrurdevo bṛhaspatiḥ /
mahābhojāttu bhojo 'bhūttadvṛṣṇeśca sumitrakaḥ // GarP_1,139.39 //
svadhājitsaṃjñakastasmādanamitrāśinī tathā /
anamitrasya nighno 'bhūnnighnācchatrājito 'bhavat // GarP_1,139.40 //
prasenaścāparaḥ khyāto hyanamitrācchibistathā /
śibestu satyakaḥ putraḥ satyakātsātyakistathā // GarP_1,139.41 //
sātyakeḥ sañjayaḥ putraḥ kuliścaiva tadātmajaḥ /
kuleryugandharaḥ putraste śaibeyāḥ prakīrtitāḥ // GarP_1,139.42 //
anamitrānvaye vṛṣṇiḥ śvaphalkaścitrakaḥ sutaḥ /
śvaphalkāccaivagāndinyāmakrūro vaiṣṇavo 'bhavat // GarP_1,139.43 //
upamadgurathākrūrāddevadyotastataḥ sutaḥ /
devavānupadevaśca hyakrūrasya sutau smṛtau // GarP_1,139.44 //
pṛthurvipṛthuścitrasya tvandhakasya śuciḥ smṛtaḥ /
kukuro bhajamānasya tathā kambalabarhiṣaḥ // GarP_1,139.45 //
dhṛṣṭastu kukurājjajñe tasmātkāpotaromakaḥ /
tadātmajo vilomā ca vilomnastumburuḥ sutaḥ // GarP_1,139.46 //
tasmāccadundubhirjajñe punarvasurataḥ smṛtaḥ /
tasyāhukaścāhukī ca kanyā caivāhukasya tu // GarP_1,139.47 //
devakaścograsenaśca devakāddevakī tvabhūt /
vṛkadevopadevāca sahadevā surakṣitā // GarP_1,139.48 //
śrīdevī śāntidevī ca vasudeva uvāha tāḥ /
devavānupadevaśca sahadevāsutau smṛtau // GarP_1,139.49 //
ugrasenasya kaṃso 'bhūtsunāmā ca vaṭādayaḥ /
vidūratho bhajamānācchūraścābhūdvidūrathāt // GarP_1,139.50 //
vidūrathasutasyātha sūrasyāpi śamī sutaḥ /
pratikṣattraśca śaminaḥ svayambhojastadātmajaḥ // GarP_1,139.51 //
hṛdikaśca svayambhojātkṛtavarmā tadātmajaḥ /
devaḥ śatadhanuścaiva śūrādvai devamīḍhuṣaḥ // GarP_1,139.52 //
daśa putrā māriṣāyāṃ vasudevādayo 'bhavan /
pṛthā ca śrutadevī ca śrutakīrtiḥ śrutaśravāḥ // GarP_1,139.53 //
rājādhidevo śūrācca pṛthāṃ kunteḥ sutāmadāt /
sā dattā kuntinā pāṇḍostasyāṃ dharmānilendrakaiḥ // GarP_1,139.54 //
yudhiṣṭhiro bhīmapārtho nakulaḥ sahadevakaḥ /
mādrayāṃ nāsatyadastrābhyāṃ kuntyāṃ karṇaḥ purābhavat // GarP_1,139.55 //
śrutadevyāṃ dantavakro jajñe vai yuddhadurmadaḥ /
santardanādayaḥ pañca śrutakīrtyāñca kaikayāt // GarP_1,139.56 //
rājādhidevyāṃ jajñāte vindaścaivānuvindakaḥ /
śrutaśravā damaghoṣātprajajñe śiśupālakam // GarP_1,139.57 //
pauravī rohīṇā bhāryā madirānakadundubheḥ /
devakīpramukhā bhadrā rohiṇyāṃ balabhadrakaḥ // GarP_1,139.58 //
sāraṇādyāḥ śaṭhaścaiva revatyāṃ balabhadrataḥ /
niśaṭhaścolmuko jāto devakyāṃ ṣaṭ ca jajñire // GarP_1,139.59 //
kīrtimāṃśca suṣeṇaśca hyudāryo bhadrasenakaḥ /
ṛjudāso bhadradevaḥ kaṃsa evāvadhīcca tān // GarP_1,139.60 //
saṃkarṣaṇaḥ saptamo 'bhūdaṣṭamaḥ kṛṣṇa eva ca /
ṣoḍaśastrīsahasrāṇi bhāryāṇāñcābhavanhareḥ // GarP_1,139.61 //
rukmiṇī satyabhāmā ca lakṣmaṇā cāruhāsinī /
śreṣṭhā jāmbavatī cāṣṭau jajñire tāḥ sutānbahūn // GarP_1,139.62 //
pradyumnaścārudeṣṇaśca pradhānāḥ sāmba eva ca /
pradyumnādaniruddho 'bhūtkakudminyāṃ mahābalaḥ // GarP_1,139.63 //
aniruddhātsubhadrāyāṃ vajro nāma nṛpo 'bhavat /
pratibāhurvajrasutaścārustasya suto 'bhavat // GarP_1,139.64 //
vahnistu turvasorvaṃśe vahnerbhargo 'bhavatsutaḥ /
bhargādbhānurabhūtputro bhānoḥ putraḥ karandhamaḥ // GarP_1,139.65 //
karandhamasya maruto druhyorvaṃśaṃ nibodha me /
drahyostu tanayaḥ seturāraddhaśca tadātmajaḥ // GarP_1,139.66 //
āraddhasyaiva gāndha ro gharmo gāndhārato 'bhavat /
ghṛtastu gharmaputro 'bhūddurgamaśca ghṛsya tu // GarP_1,139.67 //
pracetā durgamasyaiva anorvaṃśaṃ śṛṇuṣva me /
anoḥ sabhānaraḥ putrastasmā kālañjayo 'bhavat // GarP_1,139.68 //
kālañjayātsṛñjayo 'bhūtsṛñjayāttu puruñjayaḥ /
janamejayastu tatputro mahāśālastadātmajaḥ // GarP_1,139.69 //
mahāmanā mahāśāladuśīnara iha smṛtaḥ /
aśīnarācchibirjajñe vṛṣadarbhaḥ śiveḥ sutaḥ // GarP_1,139.70 //
mahāmanojāttitikṣoḥ putro 'bhūcca ruṣadrathaḥ /
hemo ruṣadrathājjajñe sutapā hemato 'bhavat // GarP_1,139.71 //
baliḥ sutapaso jajñe hyaṅgavaṅgakaliṅgakāḥ /
andhaḥ paiṇḍraśca bāleyā hyanapānastathāṅgataḥ // GarP_1,139.72 //
anapānāddivirathastato dharmaratho 'bhavat /
romapādo dharmarathāccaturaṅgastadātmajaḥ // GarP_1,139.73 //
pṛthulākṣastasya putraścampo 'bhūtpṛthulākṣataḥ /
campaputraśca haryaṅgastasya bhadrarathaḥ sutaḥ // GarP_1,139.74 //
bṛhatkarmā sutastasya bṛhadbhānustato 'bhavat /
buhanmanā bṛhādbhānostasya putro jayadrathaḥ // GarP_1,139.75 //
jayajrathasya vijayo vijayasya dhṛtiḥ sutaḥ /
dhṛterdhṛvrataḥ putraḥ satyadharmā dhṛtavratāt // GarP_1,139.76 //
tasya putrastvadhirathaḥ karṇastasya suto 'bhavat // GarP_1,139.77 //
vṛrṣasenastu karṇasya puruvaṃśyāñchaṇuṣva me // GarP_1,139.78 //

iti śrīgāruḍe mahupārāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe candravaṃśavarṇanaṃ nāmaikonacatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 140
hariruvāca /
janamejayaḥ puroścābhūnnamasyurjanamejayāt /
tasya putraścābhayadaḥ sudyuścābhayadādabhūt // GarP_1,140.1 //
sudyorbahugatiḥ putraḥ saṃjātistasya cātmajaḥ /
vatsajātiśca sañjāteḥ raudrāśvaśca tadātmajaḥ // GarP_1,140.2 //
ṛteyuḥ sthaṇḍileyuśca kakṣeyuśca kṛteyukaḥ /
jaleyuḥ santateyuśca rodrāśvasya sutā varāḥ // GarP_1,140.3 //
ratināra ṛteyośca tasya pratirathaḥ sutaḥ /
tasya medhātithiḥ putrastatputraścainilaḥ smṛtaḥ // GarP_1,140.4 //
ainilasya tu duṣyanto bharatastasya cātmajaḥ /
śakuntalāyāṃ saṃjajñe vitatho bharatādabhūt // GarP_1,140.5 //
vitathasya suto manyurmanyoścaiva naraḥ smṛtaḥ /
narasya saṃkṛtiḥ putro gargo vai saṃkṛteḥ sutaḥ // GarP_1,140.6 //
gargādamanyuḥ putro vai śiniḥ putro vyajāyata /
manyuputrānmahāvīryātsuto 'bhavadurukṣayaḥ // GarP_1,140.7 //
urukṣayāttrayyāruṇirvyūhakṣatrācca manyujāt /
suhotrastasya hastī ca ajamīḍhadvimīḍhakau // GarP_1,140.8 //
hastinaḥ purumīḍhaśca kaṇvo 'bhūdajamīḍhataḥ /
kaṇvānmedhātithirjajñe yataḥ kāṇvāyanā dvijāḥ // GarP_1,140.9 //
ajamīḍhādvṛhadiṣustatputraśca bṛhaddhanuḥ /
bṛhatkarmā tasya putrastasya putro jayadrathaḥ // GarP_1,140.10 //
jayadrathādviśvajicca senajicca tadātmajaḥ /
rucirāśvaḥ senajitaḥ pṛthusenastadātmajaḥ // GarP_1,140.11 //
pārastu pṛthusenasya pārāddvīpo 'bhavannṛpaḥ /
nṛpasya sṛmaraḥ putraḥ sukṛtiśca pṛthoḥ sutaḥ // GarP_1,140.12 //
vibhrājaḥ sukṛteḥ putro vibhrājādaśvaho 'bhavat /
kṛtyāṃ tasmādbrahmadatto viṣvaksenastadātmajaḥ // GarP_1,140.13 //
yavīnaro dvimīḍhasya dhṛtimāṃśca yavīnarāt /
dhatimataḥ satyadhṛtirdṛḍhanemistadātmajaḥ // GarP_1,140.14 //
dṛḍhanemeḥ supārśvo 'bhūt supārśvātsannatistathā /
kṛstu sannateḥ putraḥ kṛtādugrāyudho 'bhavat // GarP_1,140.15 //
ugrāyudhācca kṣemyau'bhūtsudhīrastu tadātmajaḥ /
purañjayaḥ sudhīrācca tasya putro vidūrathaḥ // GarP_1,140.16 //
ajamīḍhānnalinyāñca nīlo nāma nṛpo 'bhavat /
nīlācchāntirabhūtputraḥ suśāntistasya cātmajaḥ // GarP_1,140.17 //
suśānteśca pururjāto hyarkastasya suto 'bhavat /
arkasya caiva haryaśvo haryaśvānmukulo 'bhavat // GarP_1,140.18 //
yavīnaro bṛhadbhānuḥ kampillaḥ sṛñjayastathā /
pāñcālānmukulājjajñe śaradvānvaiṣṇavo mahān // GarP_1,140.19 //
divodāso dvitīyo 'sya hyahalyāyāṃ śaradvataḥ /
śatānando 'bhavatputrastasya satyadhṛtiḥ sataḥ // GarP_1,140.20 //
kṛpaḥ kṛpī satyadhṛterurvaśyāṃ vīryahānitaḥ /
droṇapatnī kṛpī jajñe aśvatthāmānamuttamam // GarP_1,140.21 //
divodāsānmitrayuśca mitrayoścyavano 'bhavat /
sudāsaścyavanājjajñe saudāsastasya jātmajaḥ // GarP_1,140.22 //
sahadevastasya putraḥ sahadevāttu somakaḥ /
jantustu somakājjajñe pṛṣataścāparo mahān // GarP_1,140.23 //
pṛṣatāddrupado jajñe dhṛṣṭadyumnastato 'bhavat /
dhṛṣṭadyumnāddhṛṣṭaketurṛkṣo 'bhūtajamīḍhataḥ // GarP_1,140.24 //
ṛkṣātsaṃvaraṇo jajñe kuruḥ saṃvaraṇādabhūt /
sudhanuśca pīkṣicca jahnuścaiva kuroḥ sutāḥ // GarP_1,140.25 //
sudhanuṣaḥ suhotro 'bhūccyavano 'bhūtsuhotrataḥ /
cyavanātkṛtako jajñe tathoparicaro vasuḥ // GarP_1,140.26 //
bṛhadrathaśca pratyagraḥ satyādyāśca vasoḥ sutāḥ /
bṛhadrathātkuśāgraśca kuśāgrādṛṣabho 'bhavat // GarP_1,140.27 //
ṛṣabhātpuṣpavāṃstasmājjajñe satyahito nṛpaḥ /
satyahitātsudhanvābhūjjahruścava sudhanvanaḥ // GarP_1,140.28 //
bṛhadrathājjarāsandhaḥ sahadevastadātmajaḥ /
sahadevācca ca somāpiḥ somāpeḥ śrutavānsutaḥ // GarP_1,140.29 //
bhīmasenograsenau ca śrutaseno 'parājitaḥ /
janamejayastathānyo 'bhūjjahnostu suratho 'bhavat // GarP_1,140.30 //
vidūrathastu surathātsārvabhaumo vidūrathāt /
jayasenaḥ sārvabhaumādāvadhītastadātmajaḥ // GarP_1,140.31 //
ayutāyustasya putrastasya cākrodhanaḥ sutaḥ /
akrodhanasyātithiśca ṛkṣo 'bhūdatitheḥ sutaḥ // GarP_1,140.32 //
ṛkṣācca bhīmaseno 'bhūddilīpo bhīmasenataḥ /
pratīpo 'bhūddilīpācca devāpistu pratīpataḥ // GarP_1,140.33 //
śantanuścaiva bāhlīkastrayaste bhrātaro nṛpāḥ /
bāhlīkātsomadatto 'bhūdbhūrirbhūriśravāstataḥ // GarP_1,140.34 //
śalaśca śantanorbhoṣmo gaṅgāyāṃ dhārmiko mahān /
citrāṅgadavicitrau tu satyavatyāntu śantanoḥ // GarP_1,140.35 //
bhārye vicitravīryasya tvambikāmbālike tayoḥ /
dhṛrāṣṭraṃ ca pāṇḍuñca taddāsyāṃ vidurantathā // GarP_1,140.36 //
vyāsa utpādayāmāsa gāndhāgī dhṛtarāṣṭrataḥ /
śataputraṃ duryodhanādyaṃ pāṇḍoḥ pañca prajajñire // GarP_1,140.37 //
pratibindhyaḥ śrutasomaḥ śrutakīrtistathārjunāt /
śatānīkaḥ śrutakarmā draupadyāṃ pañca vai kramāt // GarP_1,140.38 //
yaudheyī ca hiḍimbā ca kauśī caiva subhadrikā /
vijayā vai reṇumatī pañcabhyastu sutāḥ kramāt // GarP_1,140.39 //
devako ghacotkacaśca hyabhimanyuśca sarvagaḥ /
suhotro niramitraśca parīkṣidabhimanyujaḥ // GarP_1,140.40 //
janamejayo 'sya tato bhaviṣyāṃśca nṛpāñchṛṇu // GarP_1,140.41 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe candravaṃśavarṇanaṃ nāma catvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 141
hariruvāca /
śatānīko hyaśvamedhadattaścāpyadhisomakaḥ /
kṛṣṇo 'niruddhaścāpyuṣṇastataścitraratho nṛpaḥ // GarP_1,141.1 //
śucidratho vṛṣṇimāṃśca supeṇaśca sunīthakaḥ /
nṛcakṣuśca mukhābāṇaḥ medhāvī ca nṛpañjayaḥ // GarP_1,141.2 //
pāriplavaśca munayo medhāvī ca nṛpañjayaḥ /
bṛhadratho haristigmo śatānīkaḥ sudānakaḥ // GarP_1,141.3 //
udāno 'hninaraścaiva daṇḍapāṇirnimittakaḥ /
kṣemakaśca tataḥ śūdraḥ pitā pūrvastataḥ sutaḥ // GarP_1,141.4 //
bṛhadbalāstu kathayante nṛpoścaikṣvākuvaṃśajāḥ /
bṛhadbalādurukṣayo vatsavyūhastataḥ paraḥ // GarP_1,141.5 //
vatsavyūhāttataḥ sūryaḥ sahadevastadātmajaḥ /
bṛhadaśvo bhānurathaḥ pratīcyaśca pratītakaḥ /
manudevaḥ sunakṣatraḥ kinnaraścāntarikṣakaḥ // GarP_1,141.6 //
suparṇaḥ kṛtajiccaiva bṛhadbhrājaśca dhārmikaḥ /
kṛtañjayo dhanañjayaḥ saṃjayaḥ śākya eva ca // GarP_1,141.7 //
śuddhodano bāhulaśca senajitkṣudrakastathā /
sumitraḥ kuḍavaścātaḥ sumitrānmāgadhāñchaṇu // GarP_1,141.8 //
jarāsandhaḥ sahadevaḥ somāpiśca śrutaśravāḥ /
ayutāyurniramitraḥ sukṣatro bahukarmakaḥ // GarP_1,141.9 //
śrutañjayaḥ senajicca bhūriścaiva śucistathā /
kṣemyaśca suvrato dharmaḥ śmaśrulo dṛḍhasenakaḥ // GarP_1,141.10 //
sumatiḥ subalo nīto satyajidviśvajittathā /
iṣuñjayaśca ityete nṛpā bārhadrathāḥ smṛtāḥ // GarP_1,141.11 //
adharmiṣṭhāśca śūdrāśca bhaviṣyanti nṛpāstataḥ /
svargādikṛddhi bhagavānsākṣānnārāyaṇo 'vyayaḥ // GarP_1,141.12 //
naimittikaḥ prākṛtikastathaivātyantiko layaḥ /
yāti bhūḥ pralayaṃ cāpsu hyāpastejasi pāvakaḥ // GarP_1,141.13 //
vāyau vāyuśca viyati tvākāśau yātyahaṅkṛtau /
ahaṃ buddhau matirjove jīvo 'vyakte tadātmani // GarP_1,141.14 //
ātmā pareśvaro viṣṇureko nārāyaṇo naraḥ /
avināśyaparaṃ sarvaṃ jagatsvargādi nāśi hi // GarP_1,141.15 //
nṛpādayo gatā nāśamataḥ pāpaṃ vivarjayet /
dharmaṃ kuryātsthiraṃ yena pāpaṃ hitvā hariṃ vrajet // GarP_1,141.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhaviṣya rājavaṃśa dṛ nāmaikacatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 142
brahmovāca /
viṃśādīnpālayāmāsa hyavatīrṇo hariḥ prabhuḥ /
daityadharmasya nāśārthaṃ vedadharmādiguptaye // GarP_1,142.1 //
matsyādikasvarūpeṇa tvavatāraṃ karotyajaḥ /
matsyo bhūtvā hayagrīvaṃ daityaṃ hatvājikaṇṭakam // GarP_1,142.2 //
vedānānīya manvādīnpālayāmāsa keśavaḥ /
mandaraṃ dhārayāmāsa kūrmo bhūtvā hitāya ca // GarP_1,142.3 //
kṣīrodamathane vai dyo devo dhanvantarirhyarbhūt /
bibhratkamaṇḍaluṃ pūrṇamamṛtena samutthitaḥ // GarP_1,142.4 //
āyurvedamathāṣṭāṅgaṃ suśrutāya sa uktavān /
amṛtaṃ pāyayāmāsa strīrūpī ca surānhariḥ // GarP_1,142.5 //
avatīrṇo varāho 'tha hiraṇyākṣaṃ jaghāna ha /
pṛthivīṃ dhārayāmāsa pālayāmāsa devatāḥ // GarP_1,142.6 //
narasiṃho 'vartorṇo 'tha hiraṇyakaśipuṃripum /
daityānnihatavānvedadharmādīnabhyapālayat // GarP_1,142.7 //
tataḥ paraśurāmo 'bhūjjamadagnerjagatprabhuḥ /
triḥ saptakṛtvaḥ pṛthivīṃ cakre niḥ kṣattriyāṃ hariḥ // GarP_1,142.8 //
kārtavīryaṃ jaghānājau kaśyapāya mahīṃ dadau /
yāgaṃ kṛtvā mahābāhurmahendre parvate sthitaḥ // GarP_1,142.9 //
tato rāmo bhaviṣṇuśca caturdhā duṣṭarmadanaḥ /
putro daśarathājjajñe rāmaśca bharato 'nujaḥ // GarP_1,142.10 //
lakṣmaṇaścātha śatrughno rāmabhāryā ca jānakī /
rāmaśca pitṛsatyārthaṃ mātṛbhyo hitamācaran // GarP_1,142.11 //
śṛṅgaveraṃ citrakūṭaṃ daṇḍakāraṇyamāgataḥ /
nāsāṃ śūrpaṇakhāyāśca cchittvātha kharadūṣaṇam // GarP_1,142.12 //
hatvā sa rākṣasaṃ sītāpahārirajanīcaram /
rāvaṇaṃ cānujaṃ tasya laṅkāpuryāṃ vibhīṣaṇam // GarP_1,142.13 //
rakṣorājye ca saṃsthāpya sugrīvanumanmukhaiḥ /
āruhya puṣpakaṃ sārdhaṃ sītayā patibhaktayā // GarP_1,142.14 //
lakṣmaṇenānukūlena hyayodhyāṃ svapurīṃ gataḥ /
rājyaṃ cakāra devādīnpālayāmāsa sa prajāḥ // GarP_1,142.15 //
dharmasaṃrakṣaṇaṃ cakre hyaśvamedhādikānkratūn /
sā mahīpatinā reme rāmeṇaiva yathāsukham // GarP_1,142.16 //
rāvaṇasya gṛhe sītā sthitā bheje na rāvaṇam /
karmaṇā manasā vācā sā gatā rāghavaṃ sadā // GarP_1,142.17 //
pativratā tu sā sītā hyanasūyā yathaiva tu /
pativratāyā māhātmyaṃ śṛṇu tvaṃ kathayāmyaham // GarP_1,142.18 //
kauśiko brāhmaṇaḥ kuṣṭhī pratiṣṭhāne 'bhavatpurā /
taṃ tathā vyādhitaṃ bhāryā patiṃ devamivārcayat // GarP_1,142.19 //
nirbhartsitāpi bhartāraṃ tamamanyata daivatam /
bhartroktā sānayadveśyāṃ śulkamādāya cādhikam // GarP_1,142.20 //
pathi sūle tadā protamacauraṃ cauraśaṅkayā /
māṇḍavyamatiduḥ khārtamandhakāre 'tha sa dvijaḥ // GarP_1,142.21 //
patnīskandhasamārūḍhaścālayāmāsa kauśikaḥ /
pādāvamarśaṇatkruddho māṇḍavyastamuvāca ha // GarP_1,142.22 //
sūryodaye mṛtistasya yenāhaṃ cālitaḥ padā /
tacchrutvā prāha tadbhāryā sūryo nodayameṣyati // GarP_1,142.23 //
tataḥ sūryodayābhāvāda bhavatsatataṃ niśā /
bahūnyabdapramāṇāni tato devā bhayaṃ yayuḥ // GarP_1,142.24 //
brahmāṇaṃ śaraṇaṃ jagmustāmūce padmasambhavaḥ /
praśāmyate tejasaiva tapastejastvanena vai // GarP_1,142.25 //
pativratāyā māhātmyānnodgacchati divākaraḥ /
tasya cānudayāddhānirmartyānāṃ bhavatāṃ tathā // GarP_1,142.26 //
tasmātpativratāmatreranasūyāṃ tapasvinīm /
prasādayata vai patnīṃ bhānorudayakāmyayā // GarP_1,142.27 //
taiḥ sā prasāditā gatvā hyanasūyā pativratā /
kṛtvādityodayaṃ sā ca taṃ bhartāramajīvayat /
pativratānasūyāyāḥ sītābhūdadhikā kila // GarP_1,142.28 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe daśāvatāradṛ nāma dvicatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 143
brahmovāca /
rāmāyaṇamato vakṣye śrutaṃ pāpavināśanam /
viṣṇunābhyabjato brahmā marīcistatsuto 'bhavat // GarP_1,143.1 //
marīceḥ kaśyapastasmādravistasmānmanuḥ smṛtaḥ /
manorikṣvākurasyābhūdvaṃśe rājā raghuḥ smṛtaḥ // GarP_1,143.2 //
raghorajastato jāto rājā daśaratho balī /
tasya putrāstu catvāro mahābalaparākramāḥ // GarP_1,143.3 //
kausalyāyāma bhūdrāmo bharataḥ kaikayīsutaḥ /
sutau lakṣmaṇaśakṣughnau sumitrāyāṃ babhūvatuḥ // GarP_1,143.4 //
rāmo bhaktaḥ piturmāturviśvāmitrādavāptavān /
astragrāmaṃ tato yakṣīṃ tāṭakāṃ prajaghāna ha // GarP_1,143.5 //
viśāvamitrasya yajñe vai subāhuṃ nyavadhīdbalī /
janakasya kratuṃ gatvā upayeme 'tha jānakīm // GarP_1,143.6 //
ūrmilāṃ lakṣmaṇo vīro bharato māṇḍavīṃ sutām /
śatrughno vai kīrtimatīṃ kuśadhvajasute ubhe // GarP_1,143.7 //
pitrādibhirayodhyāyāṃ gatvā rāmādayaḥ sthitāḥ /
yudhājitaṃ mātulañca śatrughnabharatau gatau // GarP_1,143.8 //
gatayornṛpavaryo 'sau rājyaṃ dātuṃ samudyataḥ /
sa rāmāya tatputrāya kaikeyyā prārthitastadā // GarP_1,143.9 //
caturdaśasamāvāso vanerāmasya vāñchitaḥ /
rāmaḥ pitṛhitārthañca lakṣmaṇena ca sītayā // GarP_1,143.10 //
rājyañca tṛṇavattyaktvā śṛṅgaverapuraṃ gataḥ /
rathaṃ tyaktvā prayāgañca citrakūṭagiriṃ gataḥ // GarP_1,143.11 //
rāmasya tu viyogena rājā svargaṃ samāśritaḥ /
saṃskṛtya bharataścāgādrāmamāha balānvitaḥ // GarP_1,143.12 //
ayodhyāntu samāgatya rājyaṃ kuru mahāmate /
sa naicchatpāduke dattvā rājyāya bharatāya tu // GarP_1,143.13 //
visarjito 'tha bharato rāmarājyamapālayat /
nandigrāme sthito bhakto hyayodhyāṃ nāviśadvratī // GarP_1,143.14 //
rāmo 'pi citrakūṭācca hyatrerāśramamāyayau /
natvā sutīkṣṇaṃ cāgastyaṃ daṇḍakāraṇyamāgataḥ // GarP_1,143.15 //
tatra śūrpaṇakhā nāma rākṣasī cāttumāgatā /
nikṛtya karṇo nāse ca rāmeṇāthāpavāritā // GarP_1,143.16 //
tatpreritaḥ kharaścāgāddūṣaṇastriśirāstathā /
caturdaśasahasreṇa rakṣasāntu balena ca // GarP_1,143.17 //
rāmo 'pi preṣayāmāsa bāṇairyamapurañca tān /
rākṣasyā prerito 'bhyāgādrāvaṇo haraṇāya hi // GarP_1,143.18 //
mṛgarūpaṃ sa mārīcaṃ kṛtvāgre 'tha tridaṇḍadhṛk /
sītayā prerito rāmo mārīcaṃ nijaghāna ha // GarP_1,143.19 //
mriyamāṇaḥ sa ca prāha hā sīte ! lakṣmaṇoti ca /
sītokto lakṣmaṇo 'thāgādrāmaścānudadarśa tam // GarP_1,143.20 //
uvāca rākṣasī māyā nūnaṃ sītā hṛteti saḥ /
rāvaṇo 'ntaramāsādya hyaṅkenādāya jānakīm // GarP_1,143.21 //
jaṭāyuṣaṃ vinirbhidya yayau laṅkāṃ tato balī /
aśokavṛkṣacchāyāyāṃ rakṣitāṃ tāmadhārayat // GarP_1,143.22 //
āgatya rāmaḥ sūnyāñca parṇaśālāṃ dadarśa ha /
śokaṃ kṛtvātha jānakyā mārgaṇaṃ kṛtavānprabhuḥ // GarP_1,143.23 //
jaṭāyuṣañca saṃskṛtya tadukto dakṣiṇāṃ diśam /
gatvā sakhyaṃ tataścakre sugrīveṇa ca rāghavaḥ // GarP_1,143.24 //
sapta tālānvinirbhidya śareṇānataparvaṇā /
vālinañca vinirbhidya kiṣkindhāyāṃ harīśvaram // GarP_1,143.25 //
sugrīvaṃ kṛtavānrāma ṛśyamūke svayaṃ sthitaḥ /
sugrīvaḥ preṣayāmāsa vānarānparvatopamān // GarP_1,143.26 //
sītāyā mārgaṇaṃ kartuṃ pūrvādyāśāsu sotsavān /
pratīcīmuttarāṃ prācīṃ diśaṃ gatvā samāgatāḥ // GarP_1,143.27 //
dakṣiṇāntu diśaṃ ye ca mārgayanto 'tha jānakīm /
vanāni parvatāndvīpānnadīnāṃ pulināni ca // GarP_1,143.28 //
jānakīnte hyapaśyanto maraṇe kṛtaniścayāḥ /
sampātivacanājjñātvā hanūmānkapikuñjaraḥ // GarP_1,143.29 //
śatayojanavistīrṇaṃ pupluve makarālayam /
apaśyajjānakīṃ tatra hyaśokavanikāsthitām // GarP_1,143.30 //
bhartsitāṃ rākṣasībhiśca rāvaṇena ca rakṣasā /
bhava bhāryeti vadatā cintayantīñca rāghavam // GarP_1,143.31 //
aṅgulīyaṃ kapirdattvā sītāṃ kauśalyamabravīt /
rāmasya tasya dūto 'haṃ śokaṃ mā kuru maithili // GarP_1,143.32 //
svābhijñānañca me dehi yena rāmaḥ smariṣyati /
tacchrutvā pradadau sītā veṇīratnaṃ hanūmate // GarP_1,143.33 //
yathā rāmo nayecchīghraṃ tathā vācyaṃ tvayā kape /
tathetyuktvā tu hanumānvanaṃ divyaṃ babhañja ha // GarP_1,143.34 //
hatvākṣaṃ rākṣasāṃścānyānbandhanaṃ svayamāgataḥ /
sarvairindrajito bāṇairdṛṣṭvā rāvaṇamabravīt // GarP_1,143.35 //
rāmadūto 'smi hanumāndehi rāmāya maithilīm /
etacchrutvā prakupito dīpayāmāsa pucchakam // GarP_1,143.36 //
kapirjvalitalāṅgūlo laṅkāṃ dehe' mahābalaḥ /
dagdhvā laṅkāṃ samāyāto rāmapārśvaṃ sa vānaraḥ // GarP_1,143.37 //
jagdhvā phalaṃ madhuvane dṛṣṭā sītatyavedayat /
veṇīratnañca rāmāya rāmo laṅkāpurrī yayau // GarP_1,143.38 //
sasugrīvaḥ sa hanumānsāṃgadaśca salakṣmaṇaḥ /
vibhīṣaṇo 'pi samprāptaḥ śaraṇaṃ rāghavaṃ prati // GarP_1,143.39 //
laṅkaiśvaryeṣvabhyaṣiñcadrāmastaṃ rāvaṇānujam /
rāmo nalena setuñca kṛtvābdhau cottatāra tam // GarP_1,143.40 //
suvelāvasthitaścaiva purīṃ laṅkāṃ dadarśaha /
atha te vānarā vīrā nīlāṅgadanalādayaḥ // GarP_1,143.41 //
dhūmradhūmrākṣavīrendrā jāmbavatpramukhāstadā /
maindadvividamukhyāste purīṃ laṅkāṃ babhañjire // GarP_1,143.42 //
rākṣasāṃśca mahākāyānkālāñjanacayopamān /
rāmaḥ salakṣmaṇo hatvā sakapiḥ sarvarākṣasān // GarP_1,143.43 //
vidyujjihvañca dhūmrākṣaṃ devāntakanarānta kau /
mahodaramahāpārśvāvatikāyaṃ mahābalam // GarP_1,143.44 //
kumbhaṃ nikumbhaṃ mattañca makarākṣaṃ hyakampanam /
prahastaṃ vīramunmattaṃ kumbhakarṇaṃ mahābalam // GarP_1,143.45 //
rāvaṇiṃ lakṣmaṇo 'cchinta hyastrādyai rāghavo balī /
nikṛtya bāhucakrāṇi rāvaṇantu nyapātayan // GarP_1,143.46 //
sītāṃ śuddhāṃ gṛhītvātha vimāne puṣpake sthitaḥ /
savānaraḥ samāyāto hyayodhyāṃ pravarāṃ purīm // GarP_1,143.47 //
tatra rājyaṃ cakārātha puttravatpālayanprajāḥ /
daśāśvamedhānāhṛtya gayāśirasi pātanam // GarP_1,143.48 //
piṇḍānāṃ vidhivatkṛtvā dattvā dānāni rāghavaḥ /
putrau kuśalavau dṛṣṭvā tau ca rājye 'bhyaṣecayat // GarP_1,143.49 //
ekādaśasahasrāṇi rāmo rājyamakārayat /
śatrughno lavaṇaṃ jaghne śailūṣaṃ bhatastataḥ // GarP_1,143.50 //
agastyādīnmunīnnatvā śrutvotpattiñca rakṣasām /
svargaṃ gato janaiḥ sārdhamayodhyāsthaiḥ kṛtārthakaḥ // GarP_1,143.51 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe rāmāyaṇavarṇanaṃ nāma tricatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 144
brahmovāca /
harivaṃśaṃ pravakṣyāmi kṛṣṇamāhātmyamuttamam /
vasudevāttu devakyāṃ vāsudevo balo 'bhavat // GarP_1,144.1 //
dharmādirakṣaṇārthāya hyadharmādivinaṣṭaye /
kṛṣṇaḥ pītvā stanau gāḍhaṃ pūtanāmanayatkṣayam // GarP_1,144.2 //
śakaṭaḥ parivṛtto 'tha bhagnau ca yamalārjunau /
damitaḥ kāliyo nāgo dhenuko vinipātitaḥ // GarP_1,144.3 //
dhṛto govardhanaḥ śaila indreṇa paripūjitaḥ /
bhārāvataraṇaṃ cakre pratijñāṃ kṛtavānhariḥ // GarP_1,144.4 //
rakṣaṇāyārjunādeśca hyariṣṭādirnipātitaḥ /
keśī vinihato daityo gopādyāḥ paritoṣitāḥ // GarP_1,144.5 //
cāṇūro muṣṭiko mallaḥ kaṃso mañcānnipātitaḥ /
rukmiṇīsatyabhāmādyāḥ hyaṣṭau patnyo hareḥ parāḥ // GarP_1,144.6 //
ṣoḍhaśa strīsahasrāṇi hyanyānyāsa mahātmanaḥ /
tāsāṃ putrāśca pautrādyāḥ śataśo 'tha sahasraśaḥ // GarP_1,144.7 //
rukmiṇyāñcaiva pradyumno nyavadhīcchaṃbarañca yaḥ /
tasya putro 'niruddho 'bhūduṣābāṇasutāpatiḥ // GarP_1,144.8 //
hariśakarayoryatra mahāyuddhaṃ babhūva ha /
bāṇabāhusahasrañca cchinnaṃ bāhudvayaṃ hyabhūt // GarP_1,144.9 //
narako nihato yena pārijātaṃ jahāra yaḥ /
balaśca śisupālaśca hataśca dvividaḥ kapiḥ // GarP_1,144.10 //
aniruddhādabhūdvajraḥ sa ca rājā gate harau /
sandīpaniṃ guruñcakre saputrañca cakāra saḥ /
mathurāyāṃ cograsenaṃ pālanaṃ ca divaukasām // GarP_1,144.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe harivaṃśavarṇanaṃ nāma catuścātvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 145
brahmovāca /
bhārataṃ saṃpravakṣyāmi bhārāvataraṇaṃ bhuvaḥ /
cakre kṛṣṇo yudhyamānaḥ pāṇḍavādinimittataḥ // GarP_1,145.1 //
viṣṇunābhyabjato brahmā brahmaputro 'triratritaḥ /
somastato budhastasmādilāyāṃ ca purūravāḥ // GarP_1,145.2 //
tasyāyustatra vaṃśe 'bhūdyayātirbharataḥ kuruḥ /
śantanustasya vaṃśe 'bhūdgaṅgāyāṃ śantanoḥ sutaḥ // GarP_1,145.3 //
bhīṣmaḥ sarvaguṇaiyukto brahmavaivartapāragaḥ // GarP_1,145.4 //
śantanoḥ satyavatyāṃ ca dvau putrau saṃbabhūvatuḥ /
citrāṅgadantu gandharvaḥ putraṃ citrāṅgado 'vadhīt // GarP_1,145.5 //
anyo vicitravīryo 'bhūtkāśīrājasutāpatiḥ /
vicitravīrye svaryāte vyāsāttatkṣetrato 'bhavat // GarP_1,145.6 //
dhṛtarāṣṭo 'mbikāputraḥ pāṇḍurāmbālikāsutaḥ /
bhujiṣyāyāntu viduro gāndhāryāṃ dhṛtarāṣṭrataḥ // GarP_1,145.7 //
duryodhanapradhānāstu śatasaṃkhyā mahābalāḥ /
pāṇḍoḥ kuntyāñca mādyāṃ ca pañca putrāḥ prajajñire // GarP_1,145.8 //
yudhiṣṭhiro bhīmaseno hyarjuno nakulastathā /
sahadevaśca pañcaite mahābalaparākramāḥ // GarP_1,145.9 //
kurupāṇḍavayorvairaṃ daivayo gādbabhūva ha /
duryodhanenādhīreṇa pāṇḍavāḥ samupadrutāḥ // GarP_1,145.10 //
dagdhā jatugṛhe vīrāste muktāḥ svadhiyāmalāḥ // GarP_1,145.11 //
tatastadekacakrāyāṃ brāhmaṇasya niveśane /
viviśuste mahātmāno nihatya bakarākṣasam // GarP_1,145.12 //
tataḥ pāñcālaviṣayedraupadyāste svayaṃvaram /
vijñāya vīryaśulkāntāṃ pāṇḍavā upayemire // GarP_1,145.13 //
droṇabhīṣmānumatyā tu dhṛtarāṣṭraḥ samānayat /
ardvarājyaṃ tataḥ prāptā indraprasthe purottame // GarP_1,145.14 //
rājasūyantataścakruḥ sabhāṃ kṛtvā yatavratāḥ /
arjuno dvāravatyāntu subhadrāṃ prāptavānpriyām /
vāsudevasya bhaginīmanumatyā muradviṣaḥ // GarP_1,145.15 //
nandighoṣaṃ rathaṃ divyamagnerghanuranuttamam /
gāṇḍīvaṃ nāma taddivyaṃ triṣu lokeṣu viśrutam /
akṣayānsāyakāṃścaiva tathābhedyañca daṃśanam // GarP_1,145.16 //
sa tena dhanuṣā vīraḥ pāṇḍavo jātavedasam /
kṛṣṇadvitīyo bībhatsuratarpayata vīryavān // GarP_1,145.17 //
nṛpāndigvijaye jitvā ratnānyādāya vai dadau /
yudhiṣṭhirāya mahate bhrātre nītivide mudā // GarP_1,145.18 //
yudhiṣṭhiro 'pi dharmātmā bhrātṛbhiḥ parivāritaḥ /
jito duryodhanenaiva māyādyūtena pāpinā /
karṇaduḥ śāsanamate sthitena śakunermate // GarP_1,145.19 //
atha dvādaśa varṣāṇi vane tepurmahattapaḥ /
sadhaumyā draupadīṣaṣṭhā munivṛndābhisaṃvṛtāḥ // GarP_1,145.20 //
yayurvirāṭanagaraṃ guptarūpeṇa saṃśritāḥ /
varṣamekaṃ mahāprājñā gograhāttamapālayan // GarP_1,145.21 //
tate yātāḥ svakaṃ rāṣṭraṃ prārthayāmāsurādṛtāḥ /
pañcagrāmānardharājyādvīrā duryodhanaṃ nṛpam // GarP_1,145.22 //
nāptavantaḥ kurukṣetre yuddhañcakrurbalānvitāḥ /
akṣauhiṇībhirdivyābhiḥ saptabhiḥ parivāritāḥ // GarP_1,145.23 //
ekādaśabhirudyuktā yuktā duryodhanādayaḥ /
āsīdyuddhaṃ saṃkulaṃ ca devāsuraraṇopamam // GarP_1,145.24 //
bhīṣmaḥ senāpatirabhūdādau dauryodhane bale /
pāṇḍavānāṃ śikhaṇḍī ca tayoryuddhaṃ babhūva ha /
śastrāśastri mahāghoraṃ dhasarātraṃ śarāśari // GarP_1,145.25 //
śikhaṇḍyarjunabāṇaiśca bhīṣmaḥ śaraśataiścitaḥ /
uttarāyaṇamāvīkṣya dhyātvā devaṃ gadādharam // GarP_1,145.26 //
uktvā dharmānbahuvidhāṃstarpayitvā pitṝnbahūn /
ānande tu pade līno vimale muktakilbiṣe // GarP_1,145.27 //
tato droṇo yayau yoddhuṃ dhṛṣṭadyumnena bīryavān /
dināni pañca tadyuddhamāsītparamadāruṇam // GarP_1,145.28 //
yatra te pṛthivīpālā hatāḥ pārthena saṃgare /
śokasāgaramāsādya droṇo 'pi svargamāptavān // GarP_1,145.29 //
tataḥ karṇā yayau yoddhumarjunena mihātmanā /
dinadvayaṃ mahāyuddhaṃ kṛtvā pārthāstrasāgare /
nimagnaḥ sūryalokantu tataḥ prāpa sa vīryavān // GarP_1,145.30 //
tataḥ śalyo yayau yoddhuṃ dharmarājena dhīmatā /
dinārdhena hataḥ śalyo bāṇairjvalanasannibhaiḥ // GarP_1,145.31 //
duryodhano 'tha vegena gadāmādāya vīryavān /
abhyadhāvata vai bhībhaṃ kālāntakayamopamaḥ // GarP_1,145.32 //
atha bhīmena vīreṇa gadayā vinipātitaḥ /
aśvatthāmā gato drauṇiḥ suptasainyaṃ tato niśi // GarP_1,145.33 //
jaghāna bāhuvīryeṇa piturvadhamanusmaran /
dhṛṣṭadyumnaṃ jaghānātha draupadeyāṃśca vīryavān // GarP_1,145.34 //
draupadyāṃ rudyamānāyāmaśvatthāmnaḥ śiromaṇim /
aiṣikāstreṇa taṃ jitvā jagrāhārjuna uttamam // GarP_1,145.35 //
yudhiṣṭhiraḥ samāśvāsya strījanaṃ śokasaṃkulam /
snātvā santarpya devāṃśca pitṝnatha pitāmahān // GarP_1,145.36 //
āśvāsito 'tha bhīṣmeṇa rājyañcaivākaronmahat /
viṣṇumīje 'śvamedhena vidhivaddakṣiṇāvatā // GarP_1,145.37 //
rājye parīkṣitaṃ sthāpya yādavānāṃ vināśanam /
śrutvā tu mausale rājā japtvā nāmasahasrakam // GarP_1,145.38 //
viṣṇoḥ svargaṃ jagāmātha bhīmādyairbhrātṛbhiryutaḥ /
vāsudevaḥ punarbuddha-saṃmohāya suradviṣām // GarP_1,145.39 //
kalkirviṣṇuśca bhavitā śaṃbhalagrāmake punaḥ /
aśvārūḍho 'khilāṃllokāṃstadā bhasmīkariṣyati // GarP_1,145.40 //
devādīnāṃ rakṣaṇāya hyadharmahāraṇāya ca /
duṣṭānāñca vadhārthāya hyavatāraṃ karoti ca // GarP_1,145.41 //
yathā dhanvantarirvaṃśe jātaḥ kṣīrodamanthane /
devādīnāṃ jīvanāya hyāyurvedamuvāca ha // GarP_1,145.42 //
viśvāmitrasutāyaiva śuśrutāya mahātmane /
bhāratāṃścāvatārāṃśca śrutvā svargaṃ vrajennaraḥ // GarP_1,145.43 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe bhāratādivarṇanaṃ nāma pañcacatvāriṃśaduttaraśatatamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 146
dhanvantariruvāca /
sarvaroganidānañca vakṣye suśruta tattvataḥ /
ātreyādyairmunivarairyathā pūrvamudīritam // GarP_1,146.1 //
rogaḥ pāpmā jvaro vyādhirvikāro duṣṭa āmayaḥ /
yakṣmātaṅkagadā bādhāḥ śabdāḥ paryāyavācinaḥ // GarP_1,146.2 //
nidānaṃ pūrvarūpāṇi rūpāṇyupaśayastathā /
saṃprāptiścaiti vijñānaṃ rogāṇāṃ pañcadhā smṛtam // GarP_1,146.3 //
nimittahetvāyatanapratyayotthānakāraṇaiḥ /
nidānamāhuḥ paryāyaiḥ prāgrūpaṃ yena lakṣyate // GarP_1,146.4 //
utpitsurāmayo doṣaviśeṣeṇānadhiṣṭhitaḥ /
liṅgamavyaktamalpatvādvyādhīnāṃ tadyathāyatham // GarP_1,146.5 //
tadeva vyaktatāṃ yātaṃ rūpamityabhidhīyate /
saṃsthānāṃ vyañjanaṃ liṅgaṃ lakṣaṇaṃ cihnamākṛtiḥ // GarP_1,146.6 //
hetuvyādhiviparyastaviparyastārthakāriṇām /
auṣadhānnavihārāṇāmupayogaṃ sukhāvaham // GarP_1,146.7 //
vidyādupaśayaṃ vyādheḥ sa hi sātmyamiti smṛtaḥ /
viparīto 'nupaśayo vyādhyasātmyetisaṃjñitaḥ // GarP_1,146.8 //
yathā duṣṭena doṣeṇa yathā cānuvisarpatā /
nirvṛttirāmayasyāsau saṃprāptirabhidhīyate // GarP_1,146.9 //
saṃkhyāvikalpaprādhānyabalakālaviśeṣataḥ /
sā bhidyate yathātraiva vakṣyante 'ṣṭau jvarā iti // GarP_1,146.10 //
doṣāṇāṃ samavetānāṃ vikalpośāṃśakalpanā /
svātantryapāratantryābhyāṃ vyādheḥ prādhānyamādiśet // GarP_1,146.11 //
hetvādikārtsnyāvayavairbalābalaviśeṣaṣaṇam /
naktandinārdhabhuktāṃśairvyādhikālo yathāmalam // GarP_1,146.12 //
iti prokto nidānārthaḥ sa vyāsenopadekṣyate /
sarveṣāmeva rogāṇāṃ nidānaṃ kupitā malāḥ // GarP_1,146.13 //
tatprakopasya tu proktaṃ vividhāhitasevanam /
ahitastrividho yogastrayāṇāṃ prāgudāhṛtaḥ // GarP_1,146.14 //
tiktoṣaṇakaṣāyāmlarūkṣāpramitayojanaiḥ /
dhāvanodīraṇaniśājāgarātyuccabhāṣaṇaiḥ // GarP_1,146.15 //
kriyābhiyogabīśokacintāvyāyāmamaithunaiḥ /
grīṣmāhorātrabhuktyante prakupyati samīraṇaḥ // GarP_1,146.16 //
pittaṃ kaṭvālatīkṣṇoṣṇakaṭukrodhavidāhibhiḥ /
śaranmadhyāhnarātryardhavidāhasamayeṣu ca // GarP_1,146.17 //
svādvamlalavaṇasnigdhagurvabhiṣyandiśītalaiḥ /
āsyāsvapnasukhājīrṇadivāsvapnādibṛṃhaṇaiḥ // GarP_1,146.18 //
pricchardanādyayogena bhuktānnasyāpyajīrṇake /
pūrvāhne pūrvarātre ca śleṣmā vakṣyāmi saṅkarān // GarP_1,146.19 //
miśrībhāvātsamastānāṃ sannipātastathā punaḥ /
saṃkīrṇājīrṇaviṣamaviruddhādyaśanādibhiḥ // GarP_1,146.20 //
vyāpannamadyapānīyaśuṣkaśākāmamūlakaiḥ /
piṇyākamṛtyavasarapūtiśuṣkakṛśamiṣaiḥ // GarP_1,146.21 //
doṣatrayakaraistaistaistathānnaparivartataḥ /
dhātorduṣṭātpuro vātāddvigrahāveśaviplavāt // GarP_1,146.22 //
duṣṭāmānnairatiślaiṣmagrahairjanmarkṣapīḍanāt /
mithyāyogācca vividhātpāpānāñca niṣevaṇāt /
strīṇāṃ prasavavaiṣamyāttathā mithyopacārataḥ // GarP_1,146.23 //
pratirogamiti kruddhā rogavidhyanugāminaḥ /
rasāyanaṃ prapadyāśu doṣā dehe vikurvate // GarP_1,146.24 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākye ācārakāṇḍe sarvaroganidānaṃ nāma ṣaṭcatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 147
dhanvantariruvāca /
vakṣye jvaranidānaṃ hi sarvajvaravibuddhaye /
jvaro rogapatiḥ pāpmā mṛtyurājo 'śano 'ntakaḥ /
kruddhadakṣādhvaradhvaṃsirudrordhvanayanodbhavaḥ // GarP_1,147.1 //
tatsantāpo mohamayaḥ santāpātmāpacārajaḥ /
vividhairnāmabhiḥ krūro nānāyoniṣu vartate // GarP_1,147.2 //
pākalo gajeṣvabhitāpo vājiṣvalarkaḥ kukrureṣu /
indramado jaladeṣvapsu nīlikā jyotiroṣadhīṣu bhūmyāmūṣaro nāma // GarP_1,147.3 //
hṛllāsaśchardanaṃ kāsaḥ staṃbhaḥ śaitya tvagādiṣu /
aṅgeṣu ca samudbhūtāḥ piḍakāśca kaphodbhave // GarP_1,147.4 //
kāle yathāsvaṃ sarveṣāṃ pravṛttirvṛddhireva vā /
nidānoktonupaśayo viparītopaśāyitā // GarP_1,147.5 //
aruciścāvipākaśca staṃbhamālasyameva ca /
hṛddāhaśca vipākaśca tandrā cālasyameva ca /
vastirvimardāvanayā doṣāṇāmapravartanam // GarP_1,147.6 //
lālāpraseko hṛllāsaḥ kṣunnāśo rasadaṃ mukham /
svacchamuṣṇagurutvañca gātrāṇāṃ bahumūtratā /
na vijīrṇaṃ na ca mlānirjvarasyāmasya lakṣaṇam // GarP_1,147.7 //
kṣutkṣāmatā laghutvaṃ ca gātrāṇāṃ jvaramārdavam /
doṣapravṛttiraṣṭāhānnirāmajvaralakṣaṇam // GarP_1,147.8 //
yathā svaliṅgaṃ saṃsarge jvarasaṃsargajo 'pi vā /
śirortimūrchāvamidehadāhakaṇṭhāsyaśoṣāruciparvabhedāḥ /
unnidratā saṃbhramaromaharṣā jṛṃbhātivāktvaṃ pavanātsapittāt // GarP_1,147.9 //
tāpahānyaruciparvaśirorukṣṭhīvanaśvasanakāsavivarṇāḥ /
śītajāḍyatimirabhramitandrāśleṣmavātajanitajvaraliṅgam // GarP_1,147.10 //
śītastambhasvedadāhāvyavasthāstṛṣṇā kāsaḥ śleṣmapittapravṛttiḥ /
mohastandrāliptatiktāsyatā ca jñeyaṃ rūpaṃ śleṣmapittajvarasya // GarP_1,147.11 //
sarvajo lakṣaṇaiḥ sarvairdāho 'tra ca muhurmuhuḥ /
taducchītaṃ mahā nidrā divā jāgaraṇaṃ niśi // GarP_1,147.12 //
sadā vā naiva vā nidrā mahāsvedo hi naiva vā /
gītanartanahāsyādiḥ prakṛtehāpravartanam // GarP_1,147.13 //
sāśruṇī kaluṣe rakte bhugne lulitapakṣmaṇī /
akṣiṇī piṇḍikāpārśvaśiraḥ parvāsthirugbhramaḥ // GarP_1,147.14 //
sasvanau sarujau karṇau mahāśītau hi naiva vā /
paridagdhā kharā jihvā gurustrastāṅgasandhitā // GarP_1,147.15 //
ṣṭhīvanaṃ raktapittasya loṭhanaṃ śiraso 'titṛṭ /
koṣṭhānāṃ śyāvaraktānāṃ maṇḍalānāṃ ca darśanam // GarP_1,147.16 //
hṛdvyathā malaṃsasargaḥ pravṛttirvālpaśo 'ti vā /
snigdhāsyatā balabhraṃśaḥ svarasādaḥ pralāpitaḥ // GarP_1,147.17 //
doṣapākaściraṃ tandrā pratataṃ kaṇṭhakūjanam /
sannipātamabhinyāsaṃ taṃ brūyācca hataujasam // GarP_1,147.18 //
vāyunā kaṇṭharuddhena pittamantaḥ supīḍitam /
vyavāyitvācca saukhyācca bahirmargaṃ prapadyate /
tena hāridranetratvaṃ sannipātodbhavejvare // GarP_1,147.19 //
doṣe vivṛddhe naṣṭe 'gnau sarvasaṃpūrṇalakṣaṇaḥ /
sānnipātajvaro 'sādhyaḥ kṛcchrasādhyastato 'nyathā // GarP_1,147.20 //
anyatra sannipātotthaṃ yatra pittaṃ pṛthaksthitam /
tvaci koṣṭhe ca vā dāhaṃ vidadhāti puro 'nu vā // GarP_1,147.21 //
tadvadvātakaphe śītaṃ dāhādirdustarastayoḥ /
śītādau tatra pittena kaphe syānditaśoṣite // GarP_1,147.22 //
pitte śānte 'tha vai mūrchā madastṛṣṇā ca jāyate /
dāhādau punaranteṣu tandrālasye vamiḥ kramāt // GarP_1,147.23 //
āganturabhigātābhiṣaṅgaśāpābhicārataḥ /
caturdhā tu kṛtaḥ svedo dāhādyairabhighātajaḥ // GarP_1,147.24 //
śramācca tasminpavanaḥ prāyo raktaṃ pradūṣayan /
savyathāśokavaivarṇyaṃ sarujaṃ kurute jvaram // GarP_1,147.25 //
grahāveśauṣadhiviṣakrodhabhīśokakāmajaḥ // GarP_1,147.26 //
abhiṣaṅgagraho 'pyasminnakasmādvāsarodane /
oṣadhīgandhaje mūrchā śirorugvamathuḥ kṣayaḥ // GarP_1,147.27 //
viṣānmūrchātisāraśca śyāvatā dāhakṛdbhramaḥ /
krodhātkampaḥ śirorukca pralāpo bhayaśokaje // GarP_1,147.28 //
kāmādbhramo 'rucirdāho hrīnidrādhīdhṛtikṣayāḥ /
grahādau sannipātasya rūpādau marutastayoḥ // GarP_1,147.29 //
kopātkope 'pi pittasya yau tu śāpābhicārajau /
sannipātajvarau ghorau tāvasahyatamau matau // GarP_1,147.30 //
tantrā bhicārikairmantrairdūyamānañca tapyate /
pūrvañcaitastato dehastato visphoṭadigbhramaiḥ // GarP_1,147.31 //
sadāhamūrchāgrastasya pratyahaṃ vardhate jvaraḥ /
iti jvaro 'ṣṭadhā dṛṣṭaḥ samāsāddvibidhastu saḥ // GarP_1,147.32 //
śārīro mānasaḥ saumyastīkṣṇoṃntarbahirāśrayaḥ /
prākṛto vaikṛtaḥ sādhyo 'sādhyaḥ sāmo nirāmakaḥ // GarP_1,147.33 //
pūrvaṃ śarire śarīre tāpo manasi mānase /
pavanairyogavāhitvācchītaṃ śleṣmayute bhavet // GarP_1,147.34 //
dāhaḥ pittayute miśraṃ miśre 'ntaḥ saṃśraye punaḥ /
jvare 'dhikaṃ vikārāḥ syurantaḥ kṣobho malagrahaḥ // GarP_1,147.35 //
bahireva bahirvege tāpo 'pi ca sa sādhitaḥ /
varṣāśaradvasanteṣu vātādyaiḥ prakṛtaḥ kramāt // GarP_1,147.36 //
vaikṛto 'nyaḥ sa duḥ sādhyaḥ prāyaśca prākṛto 'nilāt /
varṣāsu māruto duṣṭaḥ pittaśleṣmānvitaṃ jvaram // GarP_1,147.37 //
kuryācca pittaṃ śaradi tasya cānucaraḥ kaphaḥ /
tatprakṛtyā visargācca tatra nānaśanādbhayam // GarP_1,147.38 //
kapho vasante tamapi vātapittaṃ bhavedanu /
balavatsvalpadoṣeṣu jvaraḥ sādhyo 'nupadravaḥ // GarP_1,147.39 //
sarvathā vikṛtijñāne prāgasādhya udāhṛtaḥ /
jvaropadravatīkṣṇatvaṃ mandāgnirbahumūtratā // GarP_1,147.40 //
na pravṛttirna vijīrṇā na kṣutsāmajvarākṛtiḥ /
jvaravego 'dhikastṛṣṇā pralāpaḥ śvasanaṃ bhramaḥ // GarP_1,147.41 //
malapravṛttirutkleśaḥ pacyamānasya lakṣaṇam /
jīrṇatāmaviparyāsātsaptarātraṃ ca laṅghanam // GarP_1,147.42 //
jvaraḥ pañcavidhaḥ prokto malakālabalābalāt /
prāyaśaḥ sannipātena bhūyasāmupadiśyate // GarP_1,147.43 //
santataḥ satato 'nyedyustṛtīyakacaturthakau /
dhātumūtraśakṛdvāhisnota sāṃ vyāpino malāḥ // GarP_1,147.44 //
tāpayantastanuṃ sarvāṃ tulyadṛṣṭyādivardhitāḥ /
balino guravastasyāviśeṣeṇa rasāśritāḥ // GarP_1,147.45 //
satataṃ niṣpratidvandvājvaraṃ kuryuḥ suduḥ saham /
malaṃ jvaroṣṇadhātūnvā sa śīghraṃ kṣapayettataḥ // GarP_1,147.46 //
sarvākāraṃ rasādīnāṃ śuddhyāsuddhyāpi vā kramāt /
vātapittakaphaiḥ saptada śadvādaśavāsarāt // GarP_1,147.47 //
prāyo 'nuyāti maryādāṃ mokṣāya ca vadhāya ca /
ityagniveśasya mataṃ hārītasya punaḥ smṛtiḥ // GarP_1,147.48 //
dviguṇā saptamī yā ca navamyekādaśī tathā /
eṣā tridoṣamaryādā mokṣāya ca vadhāya ca // GarP_1,147.49 //
śuddhyāśuddhyā jvaraḥ kālaṃ dīrghamapyatra vartate /
kṛśānāṃ vyādhiyuktānāṃ mithyāhārādisevinām // GarP_1,147.50 //
alpo 'pi doṣo duṣṭyāderlabdhvānyatamato balam /
sa pratyanīko viṣamaṃ yasmādvṛddhikṣayānvitaḥ // GarP_1,147.51 //
savikṣepo jvaraṃ kuryādviṣamakṣayavṛddhibhāk /
doṣaḥ pravartate teṣāṃ sve kāle jvarayanbalī // GarP_1,147.52 //
nivartate punaścaiva pratyanīkabalābalaḥ /
kṣīṇadoṣo jvaraḥ sūkṣmo rasādiṣveva līyate // GarP_1,147.53 //
līnatvātkārśyavaivarṇyajāḍyādīnāṃ dadhāti saḥ /
āsannavikṛtāsyatvātsrotasāṃ rasavāhinām // GarP_1,147.54 //
āśu sarvasya vapuṣo vyāptidoṣo na jāyate /
santaḥ satatastena viparīto viparyayāt // GarP_1,147.55 //
viṣamo viṣamārambhaḥ kṣapākālena saṅgavān /
doṣo raktāśrayaḥ prāyaḥ karoti santataṃ jvaram // GarP_1,147.56 //
ahorātrasya sandhau syātsakṛdanyedyurāśritaḥ /
tasminmāṃsavahā nāḍī medonāḍī tṛtīyake // GarP_1,147.57 //
grāhī pittānilānmūrdhnastrikasya kaphapittataḥ /
sapṛṣṭhasyānilakaphātsa caikāhāntaraḥ smṛtaḥ // GarP_1,147.58 //
caturthako malairmedomajjāsthyanyatare sthitaḥ /
majjāstha eva hyaparaḥ prabhāvamanudarśayet // GarP_1,147.59 //
dvidhā kaphoṇijaṅghābhyāṃ sa pūrvaṃ śirasānilāt /
asthimajjorupagataścaturthakaviparyayaḥ // GarP_1,147.60 //
tridhā tryahaṃ jvarayati dinamekantu muñcati /
balā balena doṣaṇāmanyaceṣṭādijanmanām // GarP_1,147.61 //
pakrānāmaviparyāsātsaptarātrañca laṅghayet /
jvaraḥ syānmanasastadvatkarmaṇaśca tadātadā // GarP_1,147.62 //
gambhīradhātucāritvātsannipātena sambhavāt /
tulyocchrayācca doṣāṇāṃ duścikitsyaścaturthakaḥ // GarP_1,147.63 //
sūkṣāmātsūkṣmajvareṣveṣu dūraddūratareṣu ca /
doṣo raktādimārgeṣu śanairalpaścireṇa yat // GarP_1,147.64 //
yāti dehañca nāśeṣaṃ santāpādīnkarotyataḥ /
kramo yatnena vicchinnaḥ satāpo lakṣyate jvaraḥ // GarP_1,147.65 //
viṣamo viṣamārambhaḥ kṣapākālānusāravān /
yathottaraṃ mandagatirmandaśaktiryathāyatham // GarP_1,147.66 //
kālenāpnoti sadṛśānsa rasādīṃstathātathā /
doṣo jvarayati kruddhaścirācciratareṇa ca // GarP_1,147.67 //
bhūmau sthitaṃ jalaiḥ siktaṃ kālaṃ naiva pratīkṣate /
aṅkurāya yathā bījaṃ doṣabījaṃ bhavettathā // GarP_1,147.68 //
vegaṃ kṛtvāviṣaṃ yadvadāśaye nayate balam /
kupyatyāptabalaṃ bhūyaḥ kāladoṣaviṣantathā // GarP_1,147.69 //
evaṃ jvarāḥ pravartante viṣamāḥ satatādayaḥ /
utkleśo gauravaṃ dainyaṃ bhaṅgo 'ṅgānāṃ vijṛmbhaṇam // GarP_1,147.70 //
arocako vamiḥ śvāsaḥ sarvasminrasage jvare /
raktaniṣṭhīvanaṃ tṛṣṇā rūkṣoṣṇaṃ pīḍakodyamaḥ // GarP_1,147.71 //
dāharāgabhramamadapralāpo raktasaṃśrite /
tṛḍglāniḥ spṛṣṭavarcaskamantardāho bhramastamaḥ // GarP_1,147.72 //
daurgandhyaṃ gātravikṣepo māṃsasthe medasi sthite /
svedo 'titṛṣṇā vamanaṃ daurgandhyaṃ vā sahiṣṇutā // GarP_1,147.73 //
pralāpo glānirarucirasthige tvasthibhedanam /
doṣapravṛttirudbodhaḥ śvāsāṃgakṣepakūjanam // GarP_1,147.74 //
antardāho bahiḥ śaityaṃ śvāso hikkā hi majjame /
tamaso darśanaṃ marmacchedanaṃ stabdhameḍhratā // GarP_1,147.75 //
śukrapravṛttau mṛtyustu jāyate śukrasaṃśraye /
uttarottaraduḥ sādhyāḥ pañcānye tu viparyaye // GarP_1,147.76 //
pralimpanniva gātrāṇi śleṣmaṇā gauraveṇa ca /
mandajvarapralāpastu saśītaḥ syātpralepakaḥ // GarP_1,147.77 //
nityaṃ mandajvaro rūkṣaḥ śītakṛcchreṇa gacchati /
stabdhāṅgaḥ śleṣmabhūyiṣṭho bhavedaṅgabalāśakaḥ // GarP_1,147.78 //
haridrābhedavarṇābhastadvallepaṃ pramehati /
sa vai hāridrako nāma jvarabhedo 'ntakaḥ smṛtaḥ // GarP_1,147.79 //
kaphavātau samau yatra hīnapittasya dehinaḥ /
tīkṣṇo 'tha vā divā mando jāyate rātrijo jvaraḥ // GarP_1,147.80 //
divākarārpitabale vyāyāmācca viśoṣite /
śarīre niyataṃ vātājjvaraḥ syātpaurvarātrikaḥ // GarP_1,147.81 //
āmāśaye yadātmasthe śleṣmapitte hyadhaḥ sthite /
tadardhaṃ śītalaṃ dehe hyardhaṃ coṣṇaṃ prajāyate // GarP_1,147.82 //
kāye pittaṃ yadā nyastaṃ śleṣmā cānte vyavasthitaḥ /
uṣṇatvaṃ tena dehasya śītatvaṃ karapādayoḥ // GarP_1,147.83 //
rasaraktāśrayaḥ sādhyo māṃsa medogataśca yaḥ /
asthimajjāgataḥ kṛcchrastaistaiḥ svāṅgairhataprabhaḥ // GarP_1,147.84 //
visaṃjño jravegārtaḥ sakrodha iva vīkṣate /
sadoṣamuṣṇañca sadā śakṛnmuñcati vegavat // GarP_1,147.85 //
deho laghurvyapagataklamamohatāpaḥ pāko mukhe karaṇasauṣṭhavamavyathatvam /
svedaḥ kṣuvaḥ prakṛtiyogimano 'nnalipsā kaṇḍūśca mūrdhni vigatjvaralakṣaṇāni // GarP_1,147.86 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jvaranidānādikaṃ nāma saptacatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 148
dhanvantariruvāca /
athāto raktapittasya nidānaṃ pravadāmyaham /
bhṛśoṣṇatiktakaṭvamlalavaṇādividāhibhiḥ // GarP_1,148.1 //
kodravoddālakaiścānyaistaduktairati sevitaiḥ /
kupitaṃ paittikaiḥ pittaṃ dravaṃ raktañca mūrchati // GarP_1,148.2 //
tairmithastulyarūpatvamāgamya vyāpnuvaṃstanum /
pittaraktasya vikṛteḥ saṃsargāddaṣaṇādapi // GarP_1,148.3 //
gandhavarṇānuvṛtteṣu raktena vyapadiśyate /
prabhavatyasṛjaḥ sthānātplīhato yakṛtaśca saḥ // GarP_1,148.4 //
śirogurutvamaruciḥ śītecchā dhūmako 'mlakaḥ /
chardhitaśchardibai bhatsyaṃ kāsaḥ śvāso bhramaḥ klamaḥ // GarP_1,148.5 //
lohito na hito matsyagandhāsyātvañca vijvare /
raktahāridraharitavarṇatā nayanādiṣu // GarP_1,148.6 //
nīlalohita pītānāṃ varṇānāmavivecanam /
svapne inmādadharmitvaṃ bhavatyasminbhaviṣyati // GarP_1,148.7 //
urdhvaṃ nāsākṣikarṇāsyairmeḍhrayonigudairadhaḥ /
kupitaṃ romakūpaiśca samastaistatpravartate // GarP_1,148.8 //
ūrdhvaṃ sādhyaṃ kaphādyasmāttadvirecanasādhitam /
bahvauṣadhāni pittasya vireko hi varauṣadham // GarP_1,148.9 //
anubandhī kapho yatra tatra tasyāpi śuddhikṛt /
kaṣāyāḥ svādavo yasya viśuddhau śleṣmalā hitāḥ // GarP_1,148.10 //
kaṭutiktakaṣāyā vā ye nisargātkaphāvahāḥ /
adho yāpyañca nāyuṣmāṃstatpracchardanasādhakam // GarP_1,148.11 //
alpauṣadhañca pittasya vamanaṃ nāvamauṣadham /
anubandhi balaṃ yasya śāntapittanarasya ca // GarP_1,148.12 //
kaṣāyaśca hitastasya madhurā eva kevalam /
kaphamārutasaṃspṛṣṭamasādhyamupanāmanam // GarP_1,148.13 //
asahyaṃ pratilomatvādasādhyādauṣadhasya ca /
na hi saṃśodhanaṃ kiñcidasya ca pratilominaḥ // GarP_1,148.14 //
śodhanaṃ pratilomañca raktapitte 'bhisarjitam /
evamevopaśamanaṃ saṃśodhanamiheṣyate // GarP_1,148.15 //
saṃsṛṣṭeṣu hi doṣeṣu sarvathā chardanaṃ hitam /
tatra doṣo 'tra gamanaṃ śivāstra iva lakṣyate // GarP_1,148.16 //
upadravāśca vikṛtiṃ phalatasteṣu sādhitam // GarP_1,148.17 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe raktapittanidānaṃ nāmāṣṭacatvāriṃśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 149
dhanvantariruvāca /
āśukārī yataḥ kāsaḥ sa evātaḥ pravakṣyate /
pañca kāsāḥ smṛtā vātapittaśleṣmakṣatakṣayaiḥ // GarP_1,149.1 //
kṣayāyopekṣitāḥ sarve balinaścottarottaram /
teṣāṃ bhaviṣyatāṃ rūpaṃ kaṇṭhe kaṇḍūrarocakaḥ // GarP_1,149.2 //
śuṣkakarṇāsyakaṇṭhatvaṃ tatrādhovihito 'nilaḥ /
ūrdhvaṃ pravṛttaḥ prāpyo rastasminkaṇṭhe ca saṃsṛjan // GarP_1,149.3 //
śirāsrotāṃsi saṃpūrya tato 'ṅgānyutkṣipanti ca /
kṣipannivākṣiṇī kliṣṭasvaraḥ pārśve ca pīḍayan // GarP_1,149.4 //
pravartate savakreṇa bhinnakāṃsyopamadhvaniḥ /
hṛtpārśveruśiraḥ śūlamohakṣobhasvarakṣayān // GarP_1,149.5 //
karoti śuṣkakāsañca mahāvegarujāsvanam /
soṃgaharṣo kaphaṃ śuṣkaṃ kṛchrānmuktvālpatāṃ vrajet // GarP_1,149.6 //
pittātpītākṣikatvaṃ ca tiktāsyatvaṃ jvaro bhramaḥ /
pittāsṛgvamanaṃ tṛṣṇā vaisvaryaṃ dhūmako madaḥ // GarP_1,149.7 //
pratataṃ kāsavege ca jyotiṣāmiva darśanam /
kaphāduro 'lparuṅmūrdhi hṛdayaṃ stimite guru // GarP_1,149.8 //
kaṇṭhe pralepamadajaṃ pīnasacchardyarocakāḥ /
romaharṣo dhanasnigdhaṃśleṣmaṇāñca pravartanam // GarP_1,149.9 //
yuddhādyaiḥ sāhasaistaistaiḥ sevitairayathābalam /
upasyantaḥ kṣato vāyuḥ pittenānugato balī // GarP_1,149.10 //
kupitaḥ kurute kāsaṃ kaphaṃ tena saśoṇitam /
pītaṃ śyāvañca śuṣkañca grathitaṃ kupitaṃ bahu // GarP_1,149.11 //
ṣṭhīvetkaṇṭhena rujatā vibhinnenaiva corasā /
sūcībhiriva tīkṣṇābhistudyamānena śūlinā // GarP_1,149.12 //
duḥ khasparśena śūlena bhedapīḍāhitāpinā /
parvabhedajvaraśvāsatṛṣṇāvaisvaryakampavān // GarP_1,149.13 //
pārāvata ivotkūjanpārśvaśūlī tato 'sya ca /
kaphādyairvamanaṃ paktibalavarṇañca hīyate // GarP_1,149.14 //
kṣīṇasya sāsṛṅmūtratvaṃ śvāsapṛṣṭakaṭigrahaḥ /
ṣāyupradhānāḥ kupitā dhāvato rājayakṣmaṇaḥ // GarP_1,149.15 //
karvanti yakṣmāyatane kāsaṃ ṣṭhīvatkaphaṃ tataḥ /
pūtipūyopamaṃ vītaṃ miśraṃ haritalohitam // GarP_1,149.16 //
supyate tudyata iva hṛdayaṃ pacatīva ca /
akasmāduṣṇaśītecchā bahvāśitvaṃ balakṣayaḥ // GarP_1,149.17 //
snigdhaprasannavakratvaṃ śrīmaddarśananetratā /
tato 'sya kṣayarūpāṇi sarvāṇyāvirbhavanti ca // GarP_1,149.18 //
ityeṣa kṣayajaḥ kāsa kṣīṇānāṃ dehanāśanaḥ /
yāpyau vā balināṃ tadvatkṣatajo 'pi navau tu tau // GarP_1,149.19 //
sidhyetāmapi sāmarthyātsādhyādau ca pṛthakkramaḥ /
miśrā yāpyāśca ye sarve jarasaḥ sthavirasya ca // GarP_1,149.20 //
kāsaśvāsakṣayacchardisvarasādādayo gadāḥ /
bhavantyupekṣayā yasmāttasmāttāstvarayā jayet // GarP_1,149.21 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe kāsanidānā nāmaikonapañcāśaduttaraśatatamodhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 150
dhanvantariruvāca /
athātaḥ śvāsarogasya nidānaṃ pravadāmyaham /
kāsavṛddhyā bhavecchvāsaḥ pūrvairvā doṣakopanaiḥ // GarP_1,150.1 //
āmātisāravamathuviṣapāṇḍujvarairapi /
rajodhūmānilairmarmaghātādapi himāmbunā // GarP_1,150.2 //
kṣudrakastamakaśchinno mahānūrdhvaśca pañcamaḥ /
kaphoparuddhagamanapavano viṣvagāsthitaḥ // GarP_1,150.3 //
prāṇodakānnavāhīni duṣṭasrotāṃsi dūṣayan /
uraḥ sthaḥ kurute śvāsamāmāśayasamudbhavam // GarP_1,150.4 //
prāgrūpaṃ tasya hṛtpārśvaśūlaṃ prāṇavilomatā /
ānāhaḥ śaṅkhabhedaśca tatrāyāso 'tibhojanaiḥ // GarP_1,150.5 //
preritaḥ prerayankṣudraṃ svayaṃ sa samalaṃ marut /
pratilomaṃ śirā gacchedudīrya pavanaḥ kapham // GarP_1,150.6 //
parigṛhyaśirogrīvamuraḥ pārśve ca pīḍayan /
kāsaṃ ghurghurakaṃ mohamarucimpīnasaṃ bhṛśam // GarP_1,150.7 //
karoti tīvravegañca śvāsaṃ prāṇopatāpinam /
pratāmyettasya vegenaṣṭhīvanānte kṣaṇaṃ sukhī // GarP_1,150.8 //
kṛcchrācchayānaḥ śvasiti niṣaṇṇaḥ svāsthyamarhati /
ucchritākṣo lalāṭena svidyatā bhṛśamārtimān // GarP_1,150.9 //
viśuṣkāsyo muhuḥ śvāsaḥ kāṅkṣatyuṣṇaṃ savepathuḥ /
meghāmbuśītaprāgvātaiḥ śleṣmalaiśca vivardhate // GarP_1,150.10 //
sa yāpyastamakaḥ sādhyo narasya balino bhavet /
jvaramūrchāvataḥ sītairna śāmyetprathamastu saḥ // GarP_1,150.11 //
kāsaśvasitavacchīrṇamarmacchedarujārditaḥ /
sasvedamūrchaḥ sānāho bastidāhavibodhavān // GarP_1,150.12 //
adhodṛṣṭiḥ śutākṣastu snihyadraktaikalocanaḥ /
śuṣkāsyaḥ pralapandīno naṣṭacchāyo vicetanaḥ // GarP_1,150.13 //
mahātāmahatā dīno nādena śvasiti krathan /
uddhūyamānaḥ saṃrabdho mattarṣabha ivāniśam // GarP_1,150.14 //
pranaṣṭajñānavijñāno vibhrāntanayanānanaḥ /
netre samākṣipanbaddhamūtravarcā viśīrṇavāk // GarP_1,150.15 //
śuṣkakaṇṭho muhuścaiva karṇaśaṅkhāśiro 'tiruk /
yo dīrghamucchvasityūrdhvaṃ na ca pratyāharatyadhaḥ // GarP_1,150.16 //
śleṣmāvṛtamukhaśrotraḥ kruddhagandhavahārditaḥ /
ūrdhvaṃ samīkṣate bhrāntamakṣiṇī paritaḥ kṣipan // GarP_1,150.17 //
marmasu cchidyamāneṣu paridevī niruddhavāk /
ete sidhyeyuravyaktāḥ vyaktāḥ prāṇaharā dhruvam // GarP_1,150.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe śvāsanidānā nāma pañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 151
dhanvantariruvāca /
hikrāroganidānañca vakṣye suśruta ! tacchṛṇu /
śvāsaikahetuḥ prāgrūpaṃ saṃkhyā prakṛtisaṃśrayā // GarP_1,151.1 //
hikrā bhakṣyodbhavā kṣudrā yamalā mahatīti ca /
gambhīrā ca maruttatra tvarayāyuktisevitaiḥ // GarP_1,151.2 //
rūkṣatīkṣṇakharāśāntairannapānaiḥ prapīḍitaḥ /
karoti hikrāṃ śvasanaḥ mandaśabdāṃ kṣudhānugām // GarP_1,151.3 //
samaṃ sandhyānnapānena yā prayāti ca sānnajā /
āyāsātpavanaḥ kruddhaḥ kṣudrāṃ hikrāṃ pravartayet // GarP_1,151.4 //
jatrumūlātparisṛtā mandavegavantī hi sā /
vṛddhimāyāsato yāti bhuktamātre ca mārdabam // GarP_1,151.5 //
cireṇa yamalairvegairyā hikrā saṃpravartate /
pariṇāmānmukhe vṛddhiṃ pariṇāme ca gacchati // GarP_1,151.6 //
kampayantī śiro grīvāṃ yamalāṃ tāṃ vinirdiśet /
pralāpacchardyatīsāranetraviplutajṛmbhitā // GarP_1,151.7 //
yamalā veginī hikrā pariṇāmavatī ca sā /
dhvastabhrūśaṅkhayugmasya śrutiviplutacakṣuṣaḥ // GarP_1,151.8 //
stambhayantī tanuṃ vācaṃ smṛtiṃ saṃjñāṃ ca muñcatī /
tudantī mārgamāṇasya kurvatī marmaghaṭṭanam // GarP_1,151.9 //
pṛṣṭhato namanaṃ sārṣyaṃ mahāhikrā pravartate /
mahāśūlā mahāśabdā mahāvegā mahābalā // GarP_1,151.10 //
pakrāśayācca nābhervā pūrvavatsā pravartate // GarP_1,151.11 //
tadrūpā sā mahatkuryāñjṛmbhaṇāṃ gaprasāraṇam /
gambhīreṇa nidānena gambhīrā tu susādhayet // GarP_1,151.12 //
ādye dve varjayedanye sarvaliṅgāṃ ca veginīm /
sarvasya saṃcitāmasya sthavirasya vyavāyinaḥ // GarP_1,151.13 //
vyādhibhiḥ kṣīṇadehasya bhaktacchedakṛśasya ca /
sarve 'pi rogā nāśāya na tvevaṃ śāghrakāriṇaḥ // GarP_1,151.14 //
hikrāśvāsau yathā tau hi mṛtyukāle kṛtālayau // GarP_1,151.15 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe hikrānidānā nāmaikapañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 152
dhanvantariruvāca /
athāto yakṣmarogasya nidānaṃ pravadāmyaham /
anekarogānugato bahurogapurogamaḥ // GarP_1,152.1 //
rājayakṣmā kṣayaḥ śoṣo rogarāḍiti kathyate /
nakṣatrāṇāṃ dvijānāñca rājño 'bhūdyadayaṃ purā // GarP_1,152.2 //
yacca rājā ca yakṣmā ca rājayakṣmā tato mataḥ /
dehauṣadhakṣayakṛteḥ kṣayastatsambhavācca saḥ // GarP_1,152.3 //
rasādiśoṣaṇācchoṣo rogarāḍiti rājavat /
sāhasaṃ vegasaṃrodhaḥ śukraujaḥ snehasaṃkṣayaḥ // GarP_1,152.4 //
annapānavidhityāgaścatvārastasyahetavaḥ /
tairudīrṇo 'nilaḥ pittaṃ vyarthaṃ codīrya sarvataḥ // GarP_1,152.5 //
śarirasandhimāviśya tāḥ śirāḥ pratipīḍayan /
mukhāni srotasāṃ ruddhvā tathaivātivisṛjya vā // GarP_1,152.6 //
madhyamūrdhvamadhastiryagavyathāṃ sañjanayeddhṛdaḥ /
rūpaṃ bhaviṣyatastasya pratiśyāyo bhṛśaṃ jvaraḥ // GarP_1,152.7 //
praseko mukhamādhuryaṃ mārdavaṃ vahnide hayoḥ /
laulyabhāvo 'nnapānādau śucāvaśucivīkṣaṇam // GarP_1,152.8 //
makṣikātṛṇakeśādipātaḥ prāyo 'nnapānayoḥ /
hṛllāsaśchardirarucirasnāte 'pi balakṣayaḥ // GarP_1,152.9 //
pāṇyoruvakṣaḥ pādāsyakukṣyakṣṇoratiśuklatā /
bāhvoḥ pratodo jihvāyāḥ kāye baibhatsyadarśanam // GarP_1,152.10 //
strīmadyamāṃsapriyatā ghṛṇitā mūrdhaguṇṭhanam /
nakhakeśāsthivṛddhiśca svapne cābhibhavo bhavet // GarP_1,152.11 //
patanaṃ kṛkalāsāhikapiśvāpadapakṣibhiḥ /
keśāsthituṣabhasmāditarau samadhirohaṇam // GarP_1,152.12 //
śūnyānāṃ grāmadeśānāṃ darśanaṃ śuṣyato 'mbhasaḥ /
jyotirdivi davāgnīnāṃ jvalatāṃ ca mahīruhām // GarP_1,152.13 //
pīnasaśvāsakāsaṃ ca svaramūrdharujo 'ruciḥ /
ūrdhvaniḥ śvāsasaṃśoṣāvadhaśchardiśca koṣṭhage // GarP_1,152.14 //
sthite pārśve ca rugbodhe sandhisthe bhavati jvaraḥ /
rūpāṇyaikādaśaitāni jāyante rājayakṣmaṇaḥ // GarP_1,152.15 //
teṣāmupadravānvidyātkaṇṭhadhvaṃsakarī rujāḥ /
jṛmbhāṅgamardaniṣṭhīvavahnimāndyāsyapūtitā // GarP_1,152.16 //
tatra vātācchiraḥ pārśvaśūlanaṃ sāṃgamardanam /
kaṇṭharodhaḥ svarabhraṃśaḥ pittātpādāṃsapāṇiṣu // GarP_1,152.17 //
dāho 'tisāro 'sṛk chardirmukhagandho jvaro madaḥ /
kaphādarocakacchardikāsā ardhvāṃ gagauravam // GarP_1,152.18 //
prasekaḥ pīnasaḥ śvāsaḥ svarabhedo 'lpavahnitā /
doṣairmandānalatvena śothalepakapholbaṇaiḥ // GarP_1,152.19 //
srotomukheṣu ruddheṣu dhātuṣu svalpakeṣu ca /
vidāho manasaḥ sthāne bhavantyanye hyupadravāḥ // GarP_1,152.20 //
pacyate koṣṭha evānnamamlayuktai rasairyutam /
prāyo 'sya kṣayabhāgānāṃ naivānnaṃ cāṅgapuṣṭaye // GarP_1,152.21 //
raso hyasya na raktāya māṃsāya kurute tu tat /
upaṣṭabdhaḥ samantācca kevalaṃ vartate kṣayī // GarP_1,152.22 //
liṅgeṣvalpeṣvatikṣīṇaṃ vyādhau ṣaṭkaraṇakṣayam /
varjayetsādhayedeva sarveṣvapi tato 'nyathā // GarP_1,152.23 //
doṣairvyastaiḥ samastaiśca kṣayātsarvasya medasaḥ /
svarabhedo bhavettasya kṣāmo rūkṣaścalaḥ svaraḥ // GarP_1,152.24 //
śukavarṇābhakaṇṭhatvaṃ snigdhoṣṇopaśamo 'nilāt /
pittāttālugale dāhaḥ śoṣo bhavati santatam // GarP_1,152.25 //
limpanniva kaphaiḥ kaṇṭhaṃ mukhaṃ ghuraghurāyate /
svayaṃ viruddhaiḥ sarvaistu sarvāliṅgaiḥ kṣayo bhavet // GarP_1,152.26 //
dhūmāyatīva cātyarthamudeti śleṣmalakṣaṇam /
kṛcchrasādhyāḥ kṣayāścātra sarvairalpañca varjayet // GarP_1,152.27 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yakṣmanidānā nāma dvipañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 153 /
dhanvantarirudāca /
arocakanidānte vakṣye 'haṃ suśrutādhunā /
arocako bhaveddoṣairjihvāhṛdayasaṃśrayaiḥ // GarP_1,153.1 //
sannipātena manasaḥ santāpena ca pañcamaḥ /
kaṣāyatiktamadhuraṃ vātādiṣu mukhaṃ kramāt // GarP_1,153.2 //
sarvaṃ vītarasaṃ śokakrodhādiṣu yathā manaḥ /
chardidoṣaiḥ pṛthaksarvairduṣṭairanyaiśca pañcamaḥ // GarP_1,153.3 //
udāno 'dhikṛtāndoṣānsarvaṃ sandhyarhamasyati /
āśu kleśo 'sya lāvaṇyaprasekārucayaḥ kramāt // GarP_1,153.4 //
nābhipṛṣṭhaṃ rujatyāśu pārśve cāhāramutkṣipet /
tato vicchrinnalpālpakaṣāyaṃ phenilaṃ vamet // GarP_1,153.5 //
śabdodgarayutaḥ kṛcchramanukṛcchreṇa vegavat /
kāsāsyaśoṣakaṃ vātātsvarapīḍāsamanvitam // GarP_1,153.6 //
pittātkṣārodakanibhaṃ dhūmraṃ haritapītakam /
sāsṛgamlaṃ kaṭutiktaṃ tṛṇmūrchādāhapākavat // GarP_1,153.7 //
kaphātsnigdhaṃ ghanaṃ pītaṃ śleṣmatastu samākṣikam /
madhuraṃ lavaṇaṃ bhūri prasaktaṃ lomaharṣaṇam // GarP_1,153.8 //
makhaśvayathumādhuryatandrāhṛllāsakāsavān /
sarvairliṅgaiḥ samāpannastyājyo bhavati sarvathā // GarP_1,153.9 //
sarvaṃ yasya ca vidviṣṭaṃ darśanaśravaṇādibhiḥ /
vātādinaiva saṃkruddhakṛmiduṣṭānnaje gade /
śūlavepatuhṛllāso viśeṣātkṛmije bhavet // GarP_1,153.10 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe 'rocakanidānā nāma tripañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 154
dhanvantariruvāca /
hṛdrogādinidānaṃ te vakṣye 'haṃ suśrutādhunā /
kṛmihṛdrogaliṅgaiśca smṛtāḥ pañca tu hṛdgatāḥ // GarP_1,154.1 //
vātena śūnyātātyarthaṃ bhujyate rorudīti ca /
bhidyate śuṣyate stabdhaṃ hṛdayaṃ śūnyatā bhramaḥ // GarP_1,154.2 //
akasmāddīnatā śoko bhayaṃ śabde 'saiṣṇutā /
vepathurvepanānmohaḥ śvāsarodho 'lpanidratā // GarP_1,154.3 //
pittāttṛṣṇā śramo dāho svedo 'mlakaphajaḥ kramaḥ /
chardanaṃ hyamlapittasya dhūmakalpitako jvaraḥ // GarP_1,154.4 //
śleṣmaṇā hṛdayaṃ stabdhaṃ bhārikaṃ sāśmagarbhavat /
kāsāsthisādaniṣṭhīvanidrālasyārucijvarāḥ // GarP_1,154.5 //
hṛdroge hi tribhirdeṣaiḥ kṛmibhiḥ śyāvanetratā /
tamaḥ praveśo hṛllāsaḥ śothaḥ kaṇḍūḥ kaphastrutiḥ // GarP_1,154.6 //
hṛdayaṃ satataṃ cātra krakaceneva dīryate /
cikitsadāmayaṃ (raṃ) ghoraṃ tacchīghraṃ śīghramāriṇam // GarP_1,154.7 //
vātātpittātkaphāttṛṣṇā sannipātādbalakṣayaḥ /
ṣaṣṭhī syādupasargācca vātapitte ca kāraṇam // GarP_1,154.8 //
sarveṣu tatprakopo hi samyagdhātupraśoṣaṇāt /
sarvadehabhrāmotkampatāpahṛddāhamohakṛt // GarP_1,154.9 //
jihvāmūlagalaklomatālutoyavahāḥ śirāḥ /
saṃśoṣya tṛṣṇā jāyante tāsāṃ sāmānyalakṣaṇam // GarP_1,154.10 //
mukhaśoṣo jalātṛptirannadveṣaḥ svarakṣayaḥ /
kaṇṭhoṣṭhatālukārkaśyājjihvāniṣkramaṇe klamaḥ // GarP_1,154.11 //
pralāpaścittavibhraṃśo hyudgarāḍhyastathāmayaḥ /
mārutātkṣāmatādainyaṃ śaṅkhabhe (to) daḥ śiraubhramaḥ // GarP_1,154.12 //
gandhājñānāsyavairasyaśrutinidrābalakṣayāḥ /
śītāmlaphenavṛddhiśca pittānmūrchāsyatiktatā // GarP_1,154.13 //
raktekṣaṇatvaṃ satataṃ śoṣo dāho 'tidhūmakaḥ /
kapho rasādvikupitastoyavāhiṣu mārutaḥ // GarP_1,154.14 //
srotastu sakaphaṃ tena paṅkavacchoṣyate tataḥ /
śūkairivācitaḥ kaṇṭho nidrā madhuravakratā // GarP_1,154.15 //
ādhmānaṃ śiraso jāḍyaṃ staimityacchardyarocakam /
ālasyamavipākañca yaḥ sa syātsarvalakṣaṇaḥ // GarP_1,154.16 //
āmodbhavācca raktasya saṃrodhādvātapittatā /
uṣṇākrāntasya sahasā śītāmbho bhajatastṛṣā // GarP_1,154.17 //
uṣṇādūrdhvaṃ gataḥ koṣṭhaṃ kuryādvai pittajaivasā /
yā ca pānātipānotthā tīkṣṇāgre snehapākajā // GarP_1,154.18 //
snigdhakaṭvamlalavaṇabhojanena kaphodbhavā /
tṛṣṇārasakṣayoktena lakṣaṇena kṣayātmikā // GarP_1,154.19 //
śoṣamohajvarādyanyadīrgharogopasargataḥ /
yā tṛṣṇā jāyate tīvrā sopasargātmikā smṛtā // GarP_1,154.20 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe āmlapittanidānā nāma catuḥ pañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 155
dhanvantariruvāca /
vakṣye madātyayādeśca nidānaṃ munibhāṣitam /
tīkṣṇāmlarūkṣasūkṣmāmlavyavāyāsukaraṃ laghu // GarP_1,155.1 //
vikāśi viśadaṃ madyaṃ medaso 'smādviparyayaḥ /
tīkṣṇodayāśca divyuktāścittopaplavino guṇāḥ // GarP_1,155.2 //
jīvitāntāḥ prajāyante viṣeṇotkarṣavartinā /
tīkṣṇādibhirguṇairmadyaṃ māndyadīnojaso guṇān // GarP_1,155.3 //
daśabhirguṇaiḥ saṃkṣomyaṃ ceto nayati cākriyam /
ādye made dvitīye 'pi prama (mo) dāyatane sthitaḥ // GarP_1,155.4 //
durvikalpahato mūḍhaḥ sukhamityabhimucyate /
madhyamottamayoḥ sandhiṃ prāpya rājāsano madaḥ // GarP_1,155.5 //
niraṅkuśa iva vyālo na kiñcinnācarettataḥ /
iyaṃ bhūmiravācyānāṃ dauḥ śīlasyedamāspadam // GarP_1,155.6 //
eko 'yaṃ bahumārgāyāḥ durgar (ma) terdarśakaḥ param /
niśceṣṭaḥ sannavākśete tṛtīye 'tra made sthitaḥ // GarP_1,155.7 //
maraṇādapi pāpātmā gataḥ pāpatarāṃ daśām /
dharmādharmaṃ sukhaṃ duḥ khaṃ mānānarthaṃ hitāhitam // GarP_1,155.8 //
na veda śīkamohārtaṃ śoṣa (ka) mohādisaṃyutaḥ /
sonmādabhramamūrchāyāṃ sāpasmāraḥ patatyadhaḥ // GarP_1,155.9 //
nāti mādyanti balinaḥ kṛtāhārā mahāśanāḥ /
vātātpittātkaphātsarvairbhavedrogo madātyayaḥ // GarP_1,155.10 //
sāmānyalakṣaṇaṃ teṣāṃ pramoho hṛdayavyathā /
vibhedaṃ prasabhaṃ tṛṣṇā saumyo glānirjvaro 'ruciḥ // GarP_1,155.11 //
purovibandhastimiraṃ kāsaḥ śvāsaḥ prajāgaraḥ /
svedo 'timātraṃ viṣṭambhaḥ śvayathuścittavibhramaḥ // GarP_1,155.12 //
svapnenevābhibhavati na coktaśca sa bhāṣateḥ /
pittāddāhajvaraḥ svedo moho nityaṃ ca vibhramaḥ // GarP_1,155.13 //
śleṣmaṇaśchardirhṛllāso nidrā codaragauravam /
sarvaje sarvaliṅgatvaṃ jñātvā madyaṃ pibettu yaḥ // GarP_1,155.14 //
sahasā ruciraṃ cānyataradhvaṃsakaśoṣiṇau /
bhavetāṃ?mārutātkaṣṭādbhavetta sya viśeṣataḥ // GarP_1,155.15 //
dhvaṃsakaśleṣmaniṣṭhivāḥ kaṇṭhaśoṣo 'tinidratā /
śabdāsahatvaṃ taccittavikṣepo 'ṅge hi vātaruk // GarP_1,155.16 //
hṛtkaṇṭharogaḥ saṃmohaḥ śvāsatṛṣṇāvamijvarāḥ /
nivartedyastu madyebhyo jitātmā buddhipūrvakṛt // GarP_1,155.17 //
vikāraiḥ kliśyate jātu na sa śarīramānasaḥ /
rajomohahitāhārapāsya syustrayo gadāḥ // GarP_1,155.18 //
vasāsṛkkledanāvāhisrotorodhaḥ sudbhavāḥ /
madamūrchāpasaṃnyāsā yathottarabalodbhavāḥ // GarP_1,155.19 //
mado 'tra doṣaiḥ sarvaistu raktamadyaviṣairapi /
śaktyānantyādgatābhāsaścalaśchalitaveṣṭitaḥ // GarP_1,155.20 //
rūkṣaśyāmāruṇatanurmadye vātodbhave bhavet /
pittena krodhano raktapītābhaḥ kalahapriyaḥ // GarP_1,155.21 //
svapne 'sambaddhavākyādiḥ kaphāddhyānaparo hi saḥ /
sarvotthasannipātena raktastambhāṅgadūṣaṇam // GarP_1,155.22 //
pittaliṅgatvamādyena vikṛtehā svarājñatā /
visatkampotinidrā ca sarvebhyo 'bhyadhikaṃ śramaḥ // GarP_1,155.23 //
lakṣayellakṣaṇotkarṣādvātādīñchoṇitādiṣu /
aruṇaṃ nīlakṛṣṇaṃ vā sampraviśyanviśettamaḥ // GarP_1,155.24 //
śīghraṃ ca pratibudhyeta hṛtpīḍā vepathurbhramaḥ /
kāsaḥ śyāvāruṇā cchāyā mūrchāyāṃ mārutātmakaḥ // GarP_1,155.25 //
pittena raktaṃ pītaṃ vā nabhaḥ paśyanviśettamaḥ /
vibudhyeta ca sasvedo dāhatṛṣṇopapīḍitaḥ // GarP_1,155.26 //
bhinnavatpītanīlābho raktanīlākulekṣaṇaḥ /
kaphena meghasaṃkāśaṃ paśyatyākāśamāviśet // GarP_1,155.27 //
tamaścirācca budhye hṛduraḥ suprasekavān /
gurubhistimitai (rai) raṅge rājadharmāvabandhān (vat) // GarP_1,155.28 //
sarvākṛtistribhirdeṣairapasmāra ivāparaḥ /
pātayatyāśu niśceṣṭaṃ vinā bībhatsaceṣṭitaiḥ // GarP_1,155.29 //
doṣaistu madamūrchāyāṃ kṛtavegeṣu dehinām /
svayamevopaśāmyanti saṃnyāsenauṣadhairnivā // GarP_1,155.30 //
vāgdehamanasāṃ ceṣṭāmākṣipyātibalābalāḥ /
sasanyāsaṃ nipatitāḥ prāṇāghātanasaṃśrayāḥ // GarP_1,155.31 //
bhavanti tena puruṣāḥ kāṣṭhabhūtā mṛtopamāḥ /
mriyeta śīghraṃ śīghraṃ ceccikitsā na prayujyate // GarP_1,155.32 //
agādhe grāhabahule salilaugha ivārṇave /
saṃnyāse vinimajjantaṃ naramāśu nivartayet // GarP_1,155.33 //
madamānaroṣatoṣa pravṛttibhiritastataḥ /
yuktāyuktaṃ ca samaṃ yuktiṃ yuṅkte na madyena // GarP_1,155.34 //
balakāsadeśapātraṃ prakṛtisahatāmathavā vayāṃsi? /
pravibhajjyāttanurūpaṃ pibati tataḥ pibatyamṛta // GarP_1,155.35 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe madātyayādinidānaṃ nāma pañcapañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 156
dhanvantariruvāca /
athārśasāṃ nidānaṃ ca vyākhyāsyami ca suśruta ! /
sarvadā prāṇināṃ māṃse kīlakāḥ prabhavanti ye // GarP_1,156.1 //
arśāṃsi tasmāducyante gudamārganirodhanāt /
doṣastvaṅmāṃsamedāṃsi sandūṣya vividhākṛtīn // GarP_1,156.2 //
māṃsāṃkurānapānādau kurvantyarśāṃsi tāñjaguḥ /
sahajanmāntarotthena bhedo dvedhā samāsataḥ // GarP_1,156.3 //
śuṣkāgrāvāvibhedāśca gudasthānānusaṃśrayāḥ /
ardhapañcāṅgulistasmiṃstisro 'ghyardhāṅgulisthitāḥ // GarP_1,156.4 //
bālyapravāhiṇī tāsāmantramadhye visarjinī /
bāhyāsaṃvaraṇe tasyā gudādau bahiraṅgule // GarP_1,156.5 //
sārdhāṅgulapramāṇena romāṇyatra tataḥ param /
tatra hetuḥ sahotthānāṃ bālye bījopataptatā // GarP_1,156.6 //
arśasāṃ bījasṛṣṭistu mātāpitrapacārataḥ /
devatānāṃ prakope hi sānnipātasya cānyataḥ // GarP_1,156.7 //
asādhyā evamākhyātāḥ sarve rogāḥ kulodbhavāḥ /
sahajāni viśeṣeṇa rūkṣadurdarśanāni tu // GarP_1,156.8 //
antarmukhāni pāṇḍūni dāruṇopadravāṇi ca /
yojyāni ca pṛthogdoṣasaṃsarganicayātsvataḥ // GarP_1,156.9 //
śuṣkāṇi vātaśleṣmabhyāmārdrāṇi tvasya pittataḥ /
doṣaprakopahetustu prāguktevastrasādini // GarP_1,156.10 //
agnau male 'tinicite punaścāyaṃ (ti) vyavāyataḥ /
pānasaṃkṣobhaviṣamakaṭhinakṣudrakāśanāt // GarP_1,156.11 //
bastinetragalauṣṭhotthatalabhedādighaṭṭanāt /
bhṛśaśītāmbusaṃsparśapratatātipravāhaṇāt // GarP_1,156.12 //
gatamūtraśakṛdvegadhāraṇāttadudīraṇāt /
jugupsātīsārameva grahaṇī so 'pyupadravaḥ // GarP_1,156.13 //
karṣaṇādviṣamādeścaceṣṭābhyo yoṣitāṃ punaḥ /
āmagarbhaprapatanādgarbhavṛddhiprapīḍanāt // GarP_1,156.14 //
īdṛśaiścāparairvāyurapānaḥ kupito male /
pāyorvalīṣu sadravṛttibhāsvanniḥ pūrṇamūrtiṣu // GarP_1,156.15 //
jāyanter'śāṃsitu tatpūrvaṃ lakṣaṇaṃ vahnimandatā /
viṣṭambhaḥ sāsthisadanaṃ piṇḍi (ṣṭa) kodveṣṭanaṃ bhramaḥ // GarP_1,156.16 //
sāndrotthonetrayoḥ śothaḥ śakṛdbhavedo 'tha vā grahaḥ /
mārutaḥ purato mūḍhaḥ prāyo nābheradhaścaran // GarP_1,156.17 //
saraktaḥ parikṛntaṃśca kṛcchrādākuñcati śvasan /
antrakūjanamāṭopaḥ kṣāritodgārabhūritā // GarP_1,156.18 //
prabhūtamūtramalpā viḍaśraddhā dhūmrakoṣṭhakaḥ /
śiraḥ pṛṣṭhorasāṃ śūlamālasyaṃ bhinnavarcasam // GarP_1,156.19 //
indriyārtheṣu laulyaṃ ca krodho duḥ khopacārataḥ /
āśaṅkā grahaṇī śothaḥ pāṇḍugulmodareṣu ca // GarP_1,156.20 //
etānyeva vivardhante jāteṣvahatanāmasu /
nivartamāno māno hi tairadhomārgarodhataḥ // GarP_1,156.21 //
kṣobhayedanilānanyān sarvendriyaśarīgān /
tathā mūtraśakṛtpittakaphānvāyuśca śoṣayan // GarP_1,156.22 //
muṣṇātyagniṃ tataḥ sarve bhavanti prāyaśor'śasaḥ /
kṛśo bhṛśaṃ hatotsāho dīnaḥ kṣāmo 'tha niṣprabhaḥ // GarP_1,156.23 //
asārī vigatacchāyo jantudagdha ivadruma /
kṛcchrairugradravairgrasto yakṣmoktairmarmapīḍanaiḥ // GarP_1,156.24 //
tathā kāśapipāsāsyavairasyaśvāsapīnasaiḥ /
klamāṅgabhaṅgavamathukṣavathuśvayathujvaraiḥ // GarP_1,156.25 //
klaibyabādhiryastaimityaśarkarāparipīḍitaḥ /
kṣāmo bhinnasvaro dhyāyanmuhuḥ ṣṭhīvannarocakī // GarP_1,156.26 //
sarvaparvāsthihṛnnābhīpāyuvaṅkṣaṇaśūlavān /
gudenastravatā pittaṃ balākodarasannibham // GarP_1,156.27 //
viśuṣkaṃ caiva muktāgraṃ pakvāmaṃ cāntarāntaram /
pāṇḍupittaṃ haridrāktaṃ picchilaṃ copaveśyate // GarP_1,156.28 //
gudāṅkurā bahvanilāḥ śuṣkāścimacimānvitāḥ /
pīnāṅgārāruṇāḥ stabdhā viṣamāḥ paruṣākarāḥ // GarP_1,156.29 //
mitho visadṛśa vakrāstīkṣṇā visphuṭi(ri) tānanāḥ /
śimbīkharjṛrakarkandhūkārpāsaphalasannibhāḥ // GarP_1,156.30 //
kecitkadambapuṣpābhāḥ kecitsiddhārthakopamāḥ /
śiraḥ pārśvāṃsajaṅghoruvaṅkṣaṇādyadhikavyathāḥ // GarP_1,156.31 //
kṣavathūdgāraviṣṭambhahṛdgahārocakapradāḥ /
kāsaśvāsāgnivaiṣamyakarṇanādabhramāvahāḥ // GarP_1,156.32 //
tairārto grathitaṃ stokaṃ saśabdaṃ sapravāhikam /
rukphenapicchānugataṃ vibaddhamupaveśyate // GarP_1,156.33 //
kṛṣṇatvagbaddhaviṇmūtranetravaktraśca jāyate /
gulmaplīhodarāṣṭhīlāsaṃbhavastasya caiva hi // GarP_1,156.34 //
pittottarā nīlamukhā raktapītāsitaprabhāḥ /
tanvagrastrāviṇo viśrāstanavo mṛdavaḥ ślathāḥ // GarP_1,156.35 //
śukajihvā yakṛtkhaṇḍajalaukāvaktrasannibhāḥ /
dāhaśo (ṣa) kajvarasvedatṛṇmūrchārucimohadāḥ // GarP_1,156.36 //
soṣmāṇo dravanīloṣṇapītaraktāmavarcasaḥ /
yavamadhyā haritpītahāridratvaṅnakhādayaḥ // GarP_1,156.37 //
śleṣmolbaṇā mahāmūlā ghanā mandarujaḥ sitāḥ /
utsannopacitasnigdhastabdhavṛttagurusthirāḥ // GarP_1,156.38 //
picchilāḥ stimitāḥ ślakṣṇāḥ kaṇḍvāḍhyāḥ sparśanapriyāḥ /
karīrapanasāsthyābhāstathā gostanasannibhāḥ // GarP_1,156.39 //
vaṅkṣaṇānāhinaḥ puyubastinābhivikartanāḥ /
sakāśaśvāsahṛllāsaprasekārucipīnasāḥ // GarP_1,156.40 //
mahakṛcchraśirojāḍyaśiśirakṣārakāriṇaḥ /
klaibyāgnimārdavacchardyatīsārādivikāradāḥ // GarP_1,156.41 //
vasābhasakaphaprājyapurīṣāsṛkpravāhikāḥ /
na stravanti na bhidyante pāṇḍusnigdhatvagādayaḥ // GarP_1,156.42 //
saṃsṛṣṭaliṅgat saṃsarganicayātsarvalakṣaṇāḥ /
raktolbaṇā gude kīlāḥ pītākṛtisamanvitāḥ // GarP_1,156.43 //
vaṭaprasehasadṛśāḥ guñjāvidrumasannibhāḥ /
te 'tyarthaṃ duṣṭamuṣṇaṃ ca gāḍhaviṣṭaṃbhapīḍitāḥ // GarP_1,156.44 //
stravanti sahasā raktaṃ tasya cātipravṛttitaḥ /
kekābhaḥ pīḍyate duḥ khaiḥ śoṇitakṣayasambhavaiḥ // GarP_1,156.45 //
hīnavarṇabalotsāho hataujāḥ kaluṣendriyaḥ /
mudgakodravajaṃbīrakarīracaṇakādibhiḥ // GarP_1,156.46 //
rūkṣaiḥ saṃgrāhibhirvāyurviṭsthāne kupito balī /
adhovahāni srotāṃsi saṃrudhyādhaḥ praśoṣayan // GarP_1,156.47 //
purīṣaṃ vātaviṣṇūtrasaṃgaṃ kurvīta dāruṇam? /
tena tīvrā rujā koṣṭhapṛṣṭhahṛtpārśvagā bhavet // GarP_1,156.48 //
ādhmānamudare viṣṭhā hṛllāsaparikartane /
bastau ca sutarāṃ śūlo gaṇḍaśvayathusaṃbhavaḥ // GarP_1,156.49 //
pavanasyordhvagāmitvāttataśchardyarucijvarāḥ /
hṛdrogagrahaṇīdoṣamūtrasaṃgapravāhikāḥ // GarP_1,156.50 //
bādhiryātiśiraḥ śvāsaśirorukkāśapīnasāḥ? /
manovikārastṛṭśvāsapittagulmodarādayaḥ // GarP_1,156.51 //
ete ca vātajā rogā jāyante bhṛśadāruṇāḥ /
durnāmāmṛtyūdāvartaparamo 'yamupadravaḥ // GarP_1,156.52 //
vātābhibhūtakoṣṭhānāṃ tairvināpi vijāyate /
sahajāni tu doṣāṇi yāni cābhyantare valau // GarP_1,156.53 //
sthitāni tānyasādhyāni yāpyante 'gnibalādibhiḥ /
dvandvajāni dvitīyāyāṃ valā yānyāśritāni ca // GarP_1,156.54 //
kṛcchrasādhyāni tānyāhuḥ parisaṃvatsarāṇi ca /
bāhyāyāṃ tu valau jātānyekadoṣolbaṇāni ca // GarP_1,156.55 //
arśāṃsi sukhasādhyāni na cirotpattikāni ca /
meḍhrādiṣvapi vakṣyante yathāsvaṃ nābhijāni tu // GarP_1,156.56 //
gaṇḍūpadasya rūpāṇi picchilāni mṛdūni ca /
vyāno gṛhītvā śleṣmāṇaṃ karotyarśastvaco bahiḥ // GarP_1,156.57 //
kīlopamaṃ sthirakharaṃ carmakīlaṃ ca tadviduḥ /
vātena todaḥ pāruṣyaṃ pittādasitavaktratā // GarP_1,156.58 //
śleṣmaṇaḥ snigdhatā tasya grathitatvaṃ savarṇatā /
arśasāṃ praśame yatnamāśu kurvīta buddhimān /
tānyāśu hi gadandhā (kār) yya kuryurbaddhagudodaram // GarP_1,156.59 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍer'śonidānā nāma ṣaṭpañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 157
dhanvantariruvāca /
atīsāragrahaṇyośca nidānaṃ vacmi suśruta /
doṣairvyastaiḥ samastaiśca bhayācchokācca ṣaḍvidhaḥ // GarP_1,157.1 //
atīsāraḥ sa sutarāṃ jāyate 'tyambupānataḥ /
viśuṣkānnavasāsnehatilapiṣṭavirūḍhakaiḥ // GarP_1,157.2 //
madyarūkṣātimātrādirasātisnehavibhramāt /
kṛmighoṣavirodhācca tadvidheḥ kupitānilaḥ // GarP_1,157.3 //
vistraṃsayatyadhovātaṃ hatvā tenaiva cānalam /
vyāpāryānnaśakṛtkoṣṭhapurīṣadravatādayaḥ // GarP_1,157.4 //
prakalpate 'tīsārasya lakṣaṇaṃ tasya bhāvinaḥ /
bhedo hṛdgudakoṣṭheṣu gātrasvedo malagrahaḥ // GarP_1,157.5 //
ādhmānamavipākaśca tatra vātena vijvaram /
alpālpaṃ śabdaśūnyāḍhyaṃ viru (ba)ddhamupaveśyate // GarP_1,157.6 //
rūkṣaṃ saphenamacchaṃ ca gṛhītaṃ va muhurmuhuḥ /
tathādagdhagadābhāsaṃ picchilaṃ parikartayan // GarP_1,157.7 //
saśuṣkabhraṣṭapāyuśca hṛṣṭaromā viniśvasan /
pittena pītamaśitaṃ hāridraṃ śādvalaprabham // GarP_1,157.8 //
saraktamatidurgandhaṃ tṛṇmūrchāsvedadāhavān /
saśūlapāyusantāpapākavāñchleṣmaṇā ghanam // GarP_1,157.9 //
picchilaṃ tatrānusāramalpālpaṃ sapravāhikam /
saromaharpaḥ sekleśo gurubastigudodaraḥ // GarP_1,157.10 //
kṛte 'pyakṛtasaṅgaśca sarvātmā sarvalakṣaṇaḥ /
bhayena kṣubhite citte śāyite drāvayetsa (ccha) kṛt // GarP_1,157.11 //
vāyustato nivāryeta kṣipramuṣṇaṃ dravaṃ plavam /
vātapitte samaṃ liṅgamāhustadvacca śokataḥ // GarP_1,157.12 //
atīsāraḥ samāsena dvedhā sāmo nirāmakaḥ /
sāsṛgjātaṃ rasadrogo gauravādapsu muñcati? /
śakṛddurgandhamāṭopaviṣṭambhārtiprasekinaḥ // GarP_1,157.13 //
viparīto nirāmastu kaphātko 'pi na majjati /
atīsāreṣu yo nāti yatnavān grahaṇīgadaḥ // GarP_1,157.14 //
tasya syādagninirvāṇakāryairatyarthasañcitaiḥ /
sāmaṃ śakṛnnirāmaṃ vā jīrṇaṃ yenātisāryate // GarP_1,157.15 //
so 'tisāro 'tisaraṇā dāśukārīḥ svabhāvataḥ /
sāmaṃśīrṇamajīrṇena jīrṇe pakvaṃ tu naiva ca // GarP_1,157.16 //
cirakṛd grahaṇīdoṣaḥ sañcayāṃścopaveśayet /
akasmādvārasurvedhamakasmātsandhinīmuhuḥ? /
sa caturdhā pṛthagdoṣaiḥ sannipātācca jāyate // GarP_1,157.17 //
prāgrūpāṅgasya sadanaṃ cirātpavana alpakaḥ /
praseko vaktravairasyamarucistṛṭśramobhramaḥ // GarP_1,157.18 //
āba (na) ddhodaratā chardiḥ karṇake 'pyanukūjakam /
sāmānyalakṣaṇaṃ kārśyaṃ vamaka stamako jvaraḥ // GarP_1,157.19 //
mūrchā śiroruviṣṭambhaḥ śvayathuḥ karapādayoḥ /
tandrānilāttāluśoṣastimiraṃ karṇayoḥ svanaḥ // GarP_1,157.20 //
pārśvoruvaṅkṣaṇagrīvārujā tīkṣṇaviṣūcikā /
rugṇeṣu vṛddhiḥ sarvaṣu kṣuttṛṣṇāparihartrikā // GarP_1,157.21 //
jīrṇejīryati cādhmānaṃ bhukte svāsthyaṃ samaśnute /
vātāddhṛdrogagulmārśaḥplīhapāṇḍuraśaṅkitāḥ // GarP_1,157.22 //
cirādduḥ khaṃ dravaṃ śuṣkaṃ tundāraṃ śabdaphenavat /
punaḥ punaḥ sṛjedvarcaṃ pāyurucchvāsakāsavān // GarP_1,157.23 //
pītena pītanīlābhaṃ pītābhaṃ sṛjati dravam /
pūtyamlodgārahṛtkaṇṭhadāhārucitṛḍarditaḥ // GarP_1,157.24 //
śleṣmaṇā pacyate duḥkhe manaśchardirarocakaḥ /
āsyopadāhaniṣṭhīvakāsahṛllāsapīnasāḥ // GarP_1,157.25 //
hṛdayaṃ manyate styānamudaraṃ stimitaṃ guru /
udgāro duṣṭamadhuraḥ sadanaṃ sapraharṣaṇam // GarP_1,157.26 //
sambhinnaśleṣmasaṃśliṣṭagurucāmlaiḥ (varcaḥ) pravartacam /
akṛśasyāpi daurbalyaṃ sarvaje sarvadarśanam // GarP_1,157.27 //
vibhāge 'ṅgasya ye proktā pipāsādyāstrayo malāḥ /
te 'pyasya grahaṇīdoṣāḥ samanteṣvasti kāraṇam // GarP_1,157.28 //
vātavyādhyaśmarīkuṣṭhamehodarabhagandaram /
arśāṃsi grahaṇītyaṣṭau mahārogāḥ sudustarāḥ // GarP_1,157.29 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍetisāranidāna nāma saptañcāśaduttaraśatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 158
dhanvantariruvāca /
athāto mūtraghātasya nidānaṃ śṛṇu suśruta /
bastibastiśiromeḍhrakaṭīvṛṣaṇapāyu ca // GarP_1,158.1 //
ekasaṃvahanāḥ proktā gudāsthivivarāśrayāḥ /
adhomukho 'pi bastirhi mūtravāhiśirāmukhaiḥ // GarP_1,158.2 //
pārśvebhyaḥ pūryate ślakṣṇai (sūkṣmaiḥ) syandamānairanāratam /
taistaireva praviśyaivandoṣānkuvanti viṃśatim // GarP_1,158.3 //
mūtrāghātaḥ pramehaśca kṛcchrānmarma samāśrayet /
bastivaṅkṣaṇameḍhrārtiyuktolpālpaṃ muhurmuhuḥ // GarP_1,158.4 //
mūtrāṇyāvātaje kṛcchrapītte pītaṃ sadāharuk /
raktaṃ vā kaphajo bastimeḍhragauravaśothavān // GarP_1,158.5 //
sapicchaṃ saniruddhaṃ ca sarvaiḥ sarvātmakaṃ malaiḥ /
yadā vāyurmukhaṃ bastervyāvartya pāriśoṣayan // GarP_1,158.6 //
mūtraṃ sapittaṃ sakaphaṃ saśukraṃ vā tadā kramāt /
saṃjāyate 'śmarī ghorā pittaṃ goriva rocanā // GarP_1,158.7 //
śleṣmāśrayā ca sarvā syādathāsyāḥ pūrvalakṣaṇam /
bastyādhmānaṃ tadāsannadeśohi parito 'tiruk // GarP_1,158.8 //
bastau ca mūtrasaṅgitvaṃ mūtrakṛcchraṃ jvaro 'ruciḥ /
sāmānyaliṅgaṃ ruṅnābhisīvanībastimūrdhasu // GarP_1,158.9 //
vistīrṇavā saṃ mūtraṃ syāttathā mārganirodhane /
baddhaṃ baddhvā sukhaṃ mehedacchaṃ gomedakopamam // GarP_1,158.10 //
tatsaṃkṣobhādbhavetsāsṛṅmāṃsamadhvani rugbhavet /
tatra bātābhisṛtyārtodantān khādati vepate // GarP_1,158.11 //
gṛhṇāti mehanaṃ nābhiṃ pīḍayatyatilakṣaṇam /
sānilaṃ muñcati śakṛnmuhurmehati binduśaḥ // GarP_1,158.12 //
śyāmarūkṣāśmarī cāsya syāccitā kaṇṭakairiva /
pittena dahyate bastiḥ pacyamāna ivoṣṇavān // GarP_1,158.13 //
bhallātakāsthisaṃsthānā raktā pītā sitāśmarā /
bastirnistudyata iva śleṣmaṇā śītalo guruḥ // GarP_1,158.14 //
aśmarī mahatī ślakṣṇā madhuvarṇātha vā sitā /
etā bhavanti bālanāṃ teṣāmeva ca bhūyasām // GarP_1,158.15 //
āśayopacayālpatvādgahaṇāharaṇe sukhī /
sukrāśmarī tu mahatī jāyate śukradhāraṇāt // GarP_1,158.16 //
sthānacyutamabhuktaṃ vā aṇḍayorantare 'nilaḥ /
śoṣayatyupasaṃgṛhya śukraṃ tacchukramaśmarī // GarP_1,158.17 //
bastirukkṛcchramūtratvaṃ śuklā śvayathukāriṇī /
tasyāmutpannamātrāyāṃ śuṣkametya vilīyate // GarP_1,158.18 //
pīḍite jvarakāse 'sminnaśmaryeva ca śarkarā /
asau vā vāyunā bhinnā sā tvasminnamulomage // GarP_1,158.19 //
nireti saha mūtreṇa pratilome vipacyate /
mūtrasaṃdhāraṇaṃ kuryātkruddho bastermukhe marut // GarP_1,158.20 //
mūtrasaṅgaṃ rujaṃ kaṇḍūṃ kadācicca suvāmataḥ /
pracchādya bastimuddhṛtya garmāntaṃ sthūlaviplutām // GarP_1,158.21 //
karoti tatra rugdāhaṃ spandanodveṣṭanāni ca /
binduśaśca pravarteta mūtraṃ bastau tu pīḍite // GarP_1,158.22 //
dhārāvarodhaścāpyeṣa vātabastiriti smṛtaḥ /
dustaro dustarataro dvitīyaḥ prabalo 'nilaḥ // GarP_1,158.23 //
śakṛpmārgasya basteśca vāyurantaramāśritaḥ /
aṣṭhīlābhaṃ ghanaṃ granthiṃ karotyaca (ba) lamunnatam // GarP_1,158.24 //
vātāṣṭhīleti sātmānaṃ viṣṇūtrānila (ti) sargakṛt /
viguṇaḥ kuṇḍalībhūto bastau tīvravyathonilaḥ // GarP_1,158.25 //
ābadhya mūtraṃ bhramati saṃstambhodveṣṭagauravam /
mūtramalpālpamathavā vimuñcati sakṛtsakṛt // GarP_1,158.26 //
vātakuṇḍaliketyeva mūtraṃ tu vidhṛte 'ciram /
na nireti niruddhaṃ vā mūtrātītaṃ tadalparuk // GarP_1,158.27 //
vidhāraṇātpratihataṃ vātādāvartitaṃ yadā /
nābheradhastādudaraṃ mūtramāpūrayettadā // GarP_1,158.28 //
kuryāttīvrarugādhmānamaśaktiṃ malasaṃgraham /
tanmūtraṃ jāṭharacchidravaiguṇyenānilena vā // GarP_1,158.29 //
ākṣiptamalpamūtrasya vastau nābhau ca vā male /
sthitvā plavecchanaiḥ paścātsarujaṃ vāthavārujam // GarP_1,158.30 //
mūtrotsargaṃ savicchinnaṃ tacchreyo guruśephasoḥ /
antarvasti mukhe tṛṣṇā sthirālpaṃ sahasā bhavet // GarP_1,158.31 //
aśmarītulyaruggranthirmūtragranthiḥ sa ucyate /
mūtritasya striyaṃ yāto vāyunā śukramuddhṛtam // GarP_1,158.32 //
sthānāccyutaṃ mūtrayataḥ prāk paścādvā pravartate /
bhasmodakapratīkāśaṃ mūtraśukraṃ taducyate // GarP_1,158.33 //
rūkṣadurbalayorvātenodāvartaṃ śakṛdyadā /
mūtrasroto 'nuparyeti saṃsṛṣṭaṃ śakṛtā tadā // GarP_1,158.34 //
mūtrabinduṃ tulyagandhaṃ syādvighātaṃ tamādiśet /
pittavyāyāmatīkṣṇāmlabhojanādhmānakādibhiḥ // GarP_1,158.35 //
pravṛddhavāyunā mūtre vastisthe caiva dāhakṛt /
mūtraṃ vartayate pūrvaṃ saraktaṃ raktameva vā // GarP_1,158.36 //
uṣṇaṃ punaḥ punaḥ kṛcchrāduṣṇavātaṃ vadanti tam /
rūkṣasya klāntadehasya bastisthau pittamārutau // GarP_1,158.37 //
mūtrakṣayaṃ sarugdāhaṃ janayetāṃ tadāhvayam /
pittaṃ kapho dvādapi vā saṃhanyetenilenacet // GarP_1,158.38 //
kṛcchrānmūtraṃ tadā pītaṃ raktaṃ śvetaṃ ghanaṃ sṛjet /
sadāhaṃ rocanāśaṅkhacūrṇavarṇaṃ bhavecca tat // GarP_1,158.39 //
śuṣkaṃ samastavarṇaṃ vā mūtrasādaṃ vadantitam /
iti vistārataḥ proktā rogā mūtrapravartitāḥ // GarP_1,158.40 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe mūtrāghātamūtrākṛcchanidāna nāmāṣṭapañcāśaduttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 159
dhanvanvariruvāca /
pramehāṇāṃ nidānante vakṣye 'haṃ śṛṇu suśruta ! /
pramehā viṃśatistatra śleṣmaṇo daśa pittataḥ // GarP_1,159.1 //
ṣaṭcatvāro 'nilātteca medomatrakaphāvahāḥ /
hāridramehī kaṭukaṃ haridrāsannibhaṃ śakṛt // GarP_1,159.2 //
vistraṃ māñjiṣṭhameheca mañjiṣṭhā salilopamam /
vistramuṣṇaṃ salavaṇaṃ raktābha raktamehataḥ // GarP_1,159.3 //
vasāmehī vasāmiśraṃ vasābhaṃ mūtrayenmuhuḥ /
majjābhaṃ majjamiśraṃ vā majjamehī muhurmuhuḥ // GarP_1,159.4 //
hastī matta ivājastraṃ mūtraṃ vegavivarjitam /
salasīkaṃ vivaddhaṃ ca hastimehī pramehati // GarP_1,159.5 //
madhumehī madhusamaṃ jāyate sa kila dvidhā /
kruddhe dhātukṣayādvāyau doṣāvṛtapathe yadā // GarP_1,159.6 //
āvṛto doṣaliṅgāni so 'nimittaṃ pradarśayet /
kṣaṇātkṣīṇaḥ kṣaṇātpūrṇo bhajate kṛcchrasāghyatām // GarP_1,159.7 //
kālenopekṣitaḥ sarvohyāyāti madhumehatām /
madhuraṃ yacca meheṣu prāyo madhviva mehati // GarP_1,159.8 //
sarve te madhumehākhyā mādhuryācca tanoryataḥ /
avipāko 'ruciśchardirnidrā kāsaḥ sapīnasaḥ // GarP_1,159.9 //
upadravāḥ prajāyante mehānāṃ kaphajanmanām /
bastimehanayostodomuṣkāvadaraṇaṃ jvaraḥ // GarP_1,159.10 //
dāhastṛṣṇāmlikā mūrchā viḍbhedaḥ pittajanmanām /
vātajānāmudāvartaḥ kampahṛdgahalolatāḥ // GarP_1,159.11 //
śūlamunnidrātā śoṣaḥ śvāsaḥ kāsañca jāyate /
śarāvikā kacchapikā jvālinī vinatālajī // GarP_1,159.12 //
masūrikā sarṣapikā putriṇī savidārikā /
vidradhiśceti piḍikāḥ pramehopekṣayā daśa // GarP_1,159.13 //
annasya kaphasaṃśleṣātprāyastatra pravartanam /
svādvamlalavaṇasnigdhagurupicchilaśītam // GarP_1,159.14 //
navaṃ dhānyaṃ surāsūpamāṃsekṣuguḍagorasam /
ekasthānāsanavati śayanaṃ vinivartanam // GarP_1,159.15 //
bastimāśritya kurute pramehāddūṣitaḥ kaphaḥ /
dūṣayitvā vapuḥ kledaṃ svedamedovasāmiṣam // GarP_1,159.16 //
pittaṃ raktamatikṣīṇe kaphādau mūtrasaṃśrayam /
dhātuṃ bastimupānīya tatkṣayeccaiva mārutaḥ // GarP_1,159.17 //
sādhyāsādhyapratītyādyāḥ mehāstenaiva tadbhavāḥ /
same samakṛtā doṣe paramatvāttathāpi ca // GarP_1,159.18 //
sāmānya lakṣaṇanteṣāṃ prabhūtāvilamūtratā /
doṣadūṣyā viśeṣe 'pi tatsaṃyogaviśeṣataḥ // GarP_1,159.19 //
mūtravarṇādibhedena bhedo meheṣu kalpyate /
acchaṃ bahusitaṃ śītaṃ nirgandhamudakopamam // GarP_1,159.20 //
mehatyudakamehena kiñcidāvilapicchilam /
ikṣo rasamivātyarthaṃ madhuraṃ cekṣumehataḥ // GarP_1,159.21 //
sāndrī bhavetparyuṣitaṃ sāndramehena mehati /
surāmehī surātulyamuparyacchamadhoghanam // GarP_1,159.22 //
sahṛṣṭaromā piṣṭena piṣṭabadbahulaṃ sitam /
śukrābhaṃ śukramiśraṃ vā śukramehī pramehati // GarP_1,159.23 //
mūtrayetsikatāmehī sikatārūpiṇo malān /
śītamehī subahuśo madhuraṃ bhṛśaśītalam // GarP_1,159.24 //
śanaiḥ śanaiḥ śanairmehī mandaṃ mandaṃpramehati /
lālātantuyutaṃ mūtraṃ lālāmehena picchilam // GarP_1,159.25 //
gandhavarṇarasasparśeḥ kṣāreṇa kṣāratoyavat /
nīlamehana nīlābhaṃ kālamehī masīnibham // GarP_1,159.26 //
sandhimarmasu jāyante māṃsaleṣu ca dhāmasu /
antonnatā madhyaninmā akledasurujānvitā // GarP_1,159.27 //
śarāvamānasaṃsthānā piḍikā syāccharāvikā /
sadāhā kūrmasaṃsthānā jñeyā kacchapikā budhaiḥ // GarP_1,159.28 //
mahatī piḍikā nīlā vinatā nāma sā smṛtā /
dahati tvacamutthāne jvālinī kaṣṭadāyinī // GarP_1,159.29 //
raktā sitā sphoṭacitā dāruṇā tvalajī bhavet /
masūrākṛti saṃsthānā vijñeyā tu masūrikā // GarP_1,159.30 //
sarṣapopamasaṃsthānā jihvāpākamahārujā /
putriṇī mahatī cālpā susūkṣmā piḍikā smṛtā // GarP_1,159.31 //
vidārīkandavadvṛttā kaṭhinā ca vidārikā /
vidradherlakṣaṇairyuktā jñeyā vidradhikā tu sā // GarP_1,159.32 //
putriṇī ca vidārī ca duḥ sahā bahumedasaḥ /
sadyaḥ pittolbaṇāstvanyāḥ sambhavantyalpamedasaḥ // GarP_1,159.33 //
piḍikāstā bhaveyuḥ syāddoṣodreko yathāyatham /
prameheṇa vināpyetā jāyante duṣṭamedasaḥ // GarP_1,159.34 //
tāvacca nopalakṣyante yāvadvarṇañca varjitam /
hāridraṃ raktavarṇaṃ vā mehaprāgrūpavarjitam // GarP_1,159.35 //
yo mūtrayeta tanmaheṃ raktapittantu tadviduḥ /
svedo 'ṅgagāndhaḥ śithilatvamaṅge śyyāśanasvapnasukhābhiṣaṅgaḥ /
hṛnnetrajihvāśravaṇopadāhā ghanogratā keśanakhābhivṛddhiḥ // GarP_1,159.36 //
śītapriyatvaṃ galatāluśoṣo mādhurya māsye karapādadāhaḥ /
bhaviṣyato mehagaṇasya rūpaṃ mūtre 'pi dhāvanti pipīlikāśca // GarP_1,159.37 //
tṛṣṇā pramehe madhuraṃ prapicchaṃ madhvāmaye syādvividhovikāraḥ /
sampūraṇādvā kaphasambhavaḥ syātkṣīṇeṣu doṣeṣvanilātmako vā // GarP_1,159.38 //
sampūrṇarūpāḥ kaphapittamehāḥ krameṇa ye vai ratisambhavāśca /
sakrāmate pittakṛtāstu yāpyāḥ sādhyo 'sti meho yadi nāsti diṣṭam // GarP_1,159.39 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pramehanidāna nāmaikonaṣaṣṭyuttaraśatatamo 'dhyāyaḥ

śrīgaruḍamahāpurāṇam- 160
dhanvantariruvāca /
nidānaṃ vidradhervakṣye gulmasya śṛṇu śuśruta ! /
bhuktaiḥ paryuṣitātyuṣṇaśuṣkarūkṣavidāhibhiḥ // GarP_1,160.1 /


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 160
dhanvantariruvāca /
nidānaṃ vidradhervakṣye gulmasya śṛṇu śuśruta ! /
bhuktaiḥ paryuṣitātyuṣṇaśuṣkarūkṣavidāhibhiḥ // GarP_1,160.1 //
jihmaśayyāviceṣṭābhistaistaiścāsṛkpradūṣaṇaiḥ /
duṣṭasatvaṅmāṃsamedo 'sthimadāmṛṣṭodarāśrayaḥ // GarP_1,160.2 //
yaḥ śotho bahirantaśca mahāśūlo mahārujaḥ /
vṛttaḥ syādāyato yo vā smṛto rogaḥ sa vidradhiḥ // GarP_1,160.3 //
doṣaiḥ pṛthaksamuditaiḥ śoṇitena stratena ca /
vahate tatra tatrāṅge dāruṇe grathito 'strutaḥ // GarP_1,160.4 //
antarā dāruṇaścaiva gambhīro gulmavardhanaḥ /
valmīkavatsamutstrāvī hyagnimāndyañca jāyate // GarP_1,160.5 //
nābhibastiyakṛtplīhaklomahṛtkukṣivaṅkṣaṇi /
hṛdaye vepamāne tu tatratatrātitīvraruk // GarP_1,160.6 //
śyāmāruṇaśirotthānapāko viṣamasaṃsthitiḥ /
saṃjñācchedabhramānāhasyandasarpaṇaśabdavān // GarP_1,160.7 //
raktatāmrāsitaḥ pittāttṛṇmohajvaradāhavān /
kṣiptotthānaprapākaśca pāṇḍuḥ kaṇḍūyutaḥ kaphāt // GarP_1,160.8 //
saṃkleśaśītakastambhajṛmbhārocakagauravāḥ /
cirotthāno 'vipākaśca saṃkīrṇaḥ sannipātajaḥ // GarP_1,160.9 //
sāmarthyāccātra viḍbhedo bāhyābhyantaralakṣaṇam /
kṛṣṇasphoṭāvṛtaśyāmastīvradāharujājvaraḥ // GarP_1,160.10 //
pittaliṅgo 'sṛjā bāhye strīṇāmeva tathāntaram /
śastrādyairabhighātottharaktaiśca rogakāraṇam // GarP_1,160.11 //
kṣatottho vāyunā kṣiptaḥ sa raktaḥ pittamīrayan /
pittāsṛglakṣaṇaṃ kuryādvidradhiṃ bhūryupadravam // GarP_1,160.12 //
tenopadravabhedaśca smṛto 'dhiṣṭhānabhedataḥ /
nābhau hi dhmātaṃ cedbastau mūtrakṛcchrañcajāyate // GarP_1,160.13 //
śvāsapraśvāsarodhaśca plīhāyāmatitṛṭ param /
galarodhaśca klomni syātsarvāṅgaprarujā hṛdi // GarP_1,160.14 //
pramohastamakaḥ kāsau hṛdayoddhaṭṭanantathā /
kukṣipārśvāntare caiva kukṣau doṣopajanma ca // GarP_1,160.15 //
tathā cedūrusandhau ca vaṅkṣaṇe kaṭipṛṣṭhayoḥ /
pārśvayośca vyathā pāyau pavanasya nirodhanam // GarP_1,160.16 //
āmapakvavidagdhatvaṃ teṣāṃ śothavadādiśet /
nābherūrdhvamukhātpakvātpradravantyapare gudāt // GarP_1,160.17 //
gudāstanābhije vidyāddoṣakledoccavidradhau /
kurute svādhiṣṭhānasya vivartaṃ sannipātajaḥ // GarP_1,160.18 //
pakvo hi nābhivastistho bhinno 'ntarbahireva vā /
pākaścāntaḥ pravṛddhasya kṣīṇasyopadravārditaḥ // GarP_1,160.19 //
vidradhiśca bhavettatra pāpānāṃ pāpayoṣitām /
mṛte tu garbhage caiva sambhavecchvayatharghanaḥ // GarP_1,160.20 //
stane samatthe duḥkhaṃ vā bāhyavidradhilakṣaṇam /
nārīṇāṃ sūkṣmaraktatvātkanyāyāntu na jāyate // GarP_1,160.21 //
kruddho ruddhagatirvāyuḥ śephamūlakaro?hi saḥ /
muṣkavaṅkṣaṇataḥ prāpya phalakoṣātivāhinīm // GarP_1,160.22 //
āpīḍya dhamanīvṛddhiṃ karoti phalakoṣayoḥ /
doṣo medaḥsu tatrāste savṛddhiḥ saptadhā gadaḥ // GarP_1,160.23 //
mūtrantayorapyanilādbāhye vābhyantare tathā /
vātapūrṇaḥ kharasparśo rūkṣo vātācca dāhakṛt // GarP_1,160.24 //
pakvodumbarasaṅkāśaḥ pittāddāhoṣmapākavān /
kaphāttīvro guruḥ snigdhaḥ kaṇḍūmānkaṭhino 'lparuk // GarP_1,160.25 //
kṛṣṇaḥ sphoṭāvṛtaḥ piṇḍoṃ vṛddhiliṅgaśca raktataḥ /
kaphavanmedasāṃ vṛddhirmṛdutālaphalopamaḥ // GarP_1,160.26 //
mūtradhāraṇaśīlasya mūtrajastatra gacchataḥ /
alobhaḥ pūrṇadhṛtimānkṣobhaṃ yāti saranmṛdu // GarP_1,160.27 //
mūtrakṛcchramadhastācca valayaḥ phalakoṣayoḥ /
vātakopibhisahāraiḥ śītatoyāvagāhanaiḥ // GarP_1,160.28 //
viṇmūtradhāraṇāccaiva viṣamāṅgaviceṣṭanaiḥ /
kṣobhitaiḥ kṣobhitaujāśca kṣīṇāntardehino yadā // GarP_1,160.29 //
pavano viguṇībhūya śoṇitaṃ tadadhonayet /
kuryāttatkṣaṇasandhistho granthyābhaḥ śvayathustadā // GarP_1,160.30 //
upekṣyamāṇasya ca gulmavṛddhimādhmānarugvai vividhāśca rogāḥ /
supīḍito 'ntaḥ svanavān prayāti pradhmāpayanneti punaśca mūrdhni // GarP_1,160.31 //
raktavṛddhirasādhye 'yaṃ vātavṛddhisamākṛtiḥ /
rūkṣakṛṣṇāruṇaśirā ūrṇāvṛtagavākṣavat // GarP_1,160.32 //
vāto 'ṣṭadhā pṛthadauṣaiḥ saṃspṛṣṭairnicayaṃ gataḥ /
ārtavasya ca doṣeṇa nārīṇāṃ jāyate 'ṣṭamaḥ // GarP_1,160.33 //
jvaramūrchātisāraiśca vamanādyaiśca karmabhiḥ /
karśito balavānyāti śītārtaśca bubhukṣitaḥ // GarP_1,160.34 //
yaḥ pibatyannapānāni laṅghanaplāvanādikam /
sevate hīnasaṃjñābhirarditaḥ samudīrayan // GarP_1,160.35 //
snehasvedāvanabhyasya śoṣaṇaṃ vā niṣevayet /
śuddho vā suddhihānirvā bhajeta spandanāni vā // GarP_1,160.36 //
vātolbaṇāstasya malāḥ pṛthakcaiva hi te 'thavā /
sarvo raktayuto vātāddehasnoto 'nusāriṇaḥ // GarP_1,160.37 //
ūrdhvādhomārgamāvṛtya vāyuḥ śūlaṃ karoti vai /
sparśopalabhyaṃ gulmotthamuṣṇaṃ granthisvarūpiṇam // GarP_1,160.38 //
karṣaṇātkaphaviḍghātairmārgasyāvaraṇena vā /
vāyuḥ kṛtāśrayaḥ koṣṭhe raukṣyātkāṭhinyamāgataḥ // GarP_1,160.39 //
svatantraḥ svāśraye duṣṭaḥ paratantraḥ parāśraye /
tataḥ piṇḍakavacchleṣmā malasaṃsṛṣṭa eva ca // GarP_1,160.40 //
gulama ityucyate bastinābhihṛtpārśvasaṃśrayaḥ /
vātajanye śiraḥ śūlajvara plīhāntrakūjanam // GarP_1,160.41 //
vedhaḥ sūcyeva viḍbhraṃśaḥ kṛcchre mūtraṃ pravartate /
gātre mukhe pade śothaḥ hyagnimāndyaṃ tathaiva ca // GarP_1,160.42 //
rūkṣakṛṣṇatvagāditvaṃ calatvādanilasyaca /
anirūpitasaṃsthāno vividhāñjanayedvyathām // GarP_1,160.43 //
pipīlikāvyāpta iva gulmaḥ sphurati nudyate /
pittāddāhāmlakau mūrchā viḍbhedaḥ svedatṛḍjvarāḥ // GarP_1,160.44 //
hāridrayaṃ sarvagātreṣu gulmācchothasya darśanam /
hīyate dīpyate śleṣmā svasthānaṃ dahatīvaca // GarP_1,160.45 //
kaphātstaimityamaruciḥ sadanaṃ śirasi jvaraḥ /
pīnasālasyahṛllāsau śuklakṛṣṇatvagāditā // GarP_1,160.46 //
gulmo gabhīraḥ kaṭhino gururgarbhasthabālavat /
svasthānasthā adhāvantastata evātra mārakāḥ // GarP_1,160.47 //
prāyastu yattaddvandvotthā gulmāḥ saṃsṛṣṭamaithunāḥ /
sarvajastīvrarugdāhaḥ śīghrapākī ghanonnataḥ // GarP_1,160.48 //
so 'sādhyo raktagulmastu striyā eva prajāyate /
ṛtau yā caiva śūlārtā yati vā yonirogiṇī // GarP_1,160.49 //
sevate vānilāṃśca strī kruddhastasyāḥ samīraṇaḥ /
nirudhyātyārtavaṃ yonyāṃ pratimāsaṃ vyavasthitam // GarP_1,160.50 //
sukṣau karoti tadgarbhe liṅgamāviṣkaroti ca /
hṛllāsadauhṛdastanyadarśanaṃ kāmacāritā // GarP_1,160.51 //
krameṇa vāyoḥ saṃsargātpittaṃ yoniṣu sañcayam /
raktasya kurute tasyā vātapittoktagulmajān // GarP_1,160.52 //
garbhāśaye ca sutarāṃ śūlāṃścaivāsṛgāśraye /
yonistrāvaśca daurgandhyaṃ bhūyaḥ syandanavedane // GarP_1,160.53 //
kadāpi garbhavadgulmaḥ sarve te ratisambhavāḥ /
pākañcireṇa bhajate naidhate vidradhiḥ punaḥ // GarP_1,160.54 //
pacyate śīghramatyarthaṃ duṣṭaraktāśrayastu saḥ /
ataḥ śīghraṃ vidāhitvādvadradhiḥ so 'bhīdhīyate // GarP_1,160.55 //
gulmāntāraśraye bastidāhaśca plīhavedanā /
agnivarṇabalabhraṃśo vegānāṃ vā pravartanam // GarP_1,160.56 //
ato viparyaye bāhyakoṣṭhāṅgeṣu ca nātiruk /
vaivarṇyamatha vā kāso bahirunnatatādhikam // GarP_1,160.57 //
sāṭopamatyugrarujamādhmānamudare bhṛśam /
ūrdhvādho vātarodhena tamānāhaṃ pracakṣate // GarP_1,160.58 //
dhanaścāṣṭhyupamo granthilo 'ṣṭhīlātu samunnatā /
samastāliṅgasaṃyuktaḥ pratyaṣṭhīlā tadākṛtiḥ // GarP_1,160.59 //
pakvaśayodbhavo 'pyevaṃ vāyustīvrarujāśrayāt /
udgārabāhulyapurīṣabandhatṛptyakṣamatvāntravikūjanāni // GarP_1,160.60 //
ācopamādhmānamapaktiśaktiḥ āsannagulmasya bhavecca cihnam // GarP_1,160.61 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vidradhigulmanidāna nāma ṣaṣṭyuttaraśatatamodhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 161
dhanvantariruvāca /
udarāṇāṃ nidānañca vakṣye suśruta tacchṛṇu /
rogāḥ sarve 'pi mandāgnau sutarāmudarāṇi tu // GarP_1,161.1 //
anīrṇāmayāścāpyanye jāyante malasaṃcayāt /
ūrdhvādho vāyavo ruddhvā vyākulāvipravāhiṇī? // GarP_1,161.2 //
prāṇānapānānsaṃdūṣya kuryustānmāṃsasandhigān /
ādhmāpya kukṣimudaramaṣṭadhā te ca bhedataḥ // GarP_1,161.3 //
pṛthagdoṣaiḥ samastauśca plīhavaṅkṣakṣatodakaiḥ /
tenārtāḥ śuṣkatālvoṣṭhāḥ sarvapādakarodarāḥ // GarP_1,161.4 //
naṣṭaceṣṭabalāhārāḥ kṛtapradhmāt kukṣayaḥ /
puruṣāḥ syuḥ pretarūpā bhāvinastasya lakṣaṇam // GarP_1,161.5 //
kṣunnāśo 'rucivatsarvaṃ savidāhañca pacyate /
jīrṇānnaṃ yo na jānāti so 'pathyaṃ sevatenaraḥ // GarP_1,161.6 //
kṣīyate balamaṅgasya śvasityalpo 'viceṣṭitaḥ /
viṣayāvṛttibuddhiśca śokaśoṣādayo 'pica // GarP_1,161.7 //
rugbastisandhau satataṃ laghvalpabhojanairapi /
jarājīrṇo balabhraṃśo bhavejjaṭhararogiṇaḥ // GarP_1,161.8 //
svatantratandrālasatā malasargo 'lpavahnitā /
dāhaḥ śvayathurādhmānamantre salilasambhave // GarP_1,161.9 //
sarvatra toye maraṇaṃ śocanaṃ tatra niṣphalam /
gavākṣavacchirājālairudaraṃ guḍguḍāyate // GarP_1,161.10 //
nābhimantraśca viṣṭabhya vegaṃ kṛtvā praṇaśyati /
mārute hṛtkaṭīnābhipāyuvaṅkṣaṇavedanāḥ // GarP_1,161.11 //
saśabdo niḥ saredvāyurvahate mūtramalpakam /
nātimātraṃ bhavellaulyaṃ narasya virasaṃ mukham // GarP_1,161.12 //
tatravātodare śothaḥ pāṇipānmukhakukṣiṣu /
kurkṣipārśvodarakaṭīpṛṣṭharukparvabhadanam // GarP_1,161.13 //
śuṣkakāsāṅgamardādhogurutāmalasaṃgrahaḥ /
śyāmāruṇatvagāditvaṃ mukhe ca rasavaddhitā // GarP_1,161.14 //
satodabhedamudaraṃ nīlakṛṣṇaśirātatam /
ādhmātamudare śabdamadbhutaṃ vā karoti saḥ // GarP_1,161.15 //
vāyuścātra sarukcchabdaṃ vidhatte sarvathā gatim /
pittodare jvaro mūrchā dāhitvaṃ kaṭukāsyatā // GarP_1,161.16 //
bhramotisāraḥ pītatvaṃ tvagādāvudaraṃ harit /
pītatāmraśirāditvaṃ sasvedaṃ soṣma dahyate // GarP_1,161.17 //
dhūmāyate mṛdusparśaṃ kṣaiprapākaṃ pradūyate /
śleṣmodareṣu sadanaṃ svedaśvayathugauravam // GarP_1,161.18 //
nidrā kleśo 'ruciḥ śvāsaḥ kāśaḥ śuklatvagāditā /
udaraṃ timiraṃ snigdhaṃ śuklakṛṣṇaśirāvṛtam // GarP_1,161.19 //
nīrātivṛddhau kaṭhinaṃ śītasparśaṃ guru sthiram /
tridoṣakopane taistaistridoṣajīnaitarmalaiḥ // GarP_1,161.20 //
sarvadūṣaṇaduṣṭāśca saraktāḥ sañcitā malāḥ /
koṣṭhaṃ prāpya vikurvāṇāḥ śoṣamūrchābhramānvitam // GarP_1,161.21 //
kuryustriliṅgamudaraṃ śīghrapākaṃ sudāruṇam /
vardhate tacca sutarāṃ śītavātapradarśane // GarP_1,161.22 //
atyaśanācca saṃkṣobhādyānapānādiceṣṭhitaiḥ /
avihitaiśca pānādyairvamanavyādhikarṣaṇaiḥ // GarP_1,161.23 //
vāmapārśvāsthitaḥ plīhā tyutasthāno vivardhate /
śoṇitādvā rasādibhyo vivṛddho janayedvyathām // GarP_1,161.24 //
so 'ṣṭhīlā cātikaṭhinaḥ pronnataḥ kūrmapṛṣṭhavat? /
krameṇa vardhamānaśca kukṣau vyātatimāharet // GarP_1,161.25 //
śvāsakāsapipāsāsyavairasyādhmānakajvaraiḥ /
pāṇḍutvamūrchācharditvagdāhamohaiśca saṃyutaḥ // GarP_1,161.26 //
aruṇābhaṃ vicitrābhaṃ nīlahāridrarājitam /
udāvartena cānāhamohatṛḍdgahanajvaraiḥ // GarP_1,161.27 //
gauravārucikāṭhinyairvighātabhramasaṃkramāt /
plīhavaddakṣiṇātpārśvātkuryādyakṛdapi cyutam // GarP_1,161.28 //
pakve bhūte yakṛti ca sadā baddhamalo gude /
durnāmabhirudāvartairanyairvā pīḍito bhavet // GarP_1,161.29 //
varcaḥ pittakaphānbaddhānkaroti kupito 'nilaḥ /
apāno jaṭhare tena saṃruddho jvararukkaraḥ // GarP_1,161.30 //
kāśaśvāsorusadganaṃ śiroruṅnābhipārśvaruk /
malāsaṃgo 'ruciśchardirudare malamārutaḥ // GarP_1,161.31 //
sthiranīlāruṇaśirājālairudaramāvṛtam /
nābherupari ca prāyo gopucchākṛti jāyate // GarP_1,161.32 //
asthyādiśalyai ranyaiśca viddhe caivodare tathā /
pacyate yakṛtādiśca tacchidraiśca saranbahiḥ // GarP_1,161.33 //
āma eva gudāheti tato 'lpālpaḥ śakṛdrasaḥ /
sa syādvikṛtagandho 'pi picchilaḥ pītalohitaḥ // GarP_1,161.34 //
śeṣaścāpūrya jaṭharaṃ ghoramārabhate tataḥ /
vardhate tadadho nābherāśu caiti jalātmatām // GarP_1,161.35 //
udrikte doṣarūpe ca vyāpte ca śvāsatṛṭbhramaiḥ /
chidrodaramidaṃ prāhuḥ paristrāvīti cāpare // GarP_1,161.36 //
pravṛttasnehapānādeḥ sahasāpathyasevinaḥ /
atyambupānānmandāgneḥ kṣīṇasyātikṛśasya ca // GarP_1,161.37 //
ruddhaḥ svamārgādanilaḥ kaphaśca jalamūrchitaḥ /
vardhate tu tadevāmbu tanmātrādvindurāśitaḥ // GarP_1,161.38 //
tatkopādudaraṃ tṛṣṇāgudasnutirujānvitam /
kāśaśvāsāruciyutaṃ nānāvarṇāśirātatam // GarP_1,161.39 //
toyapūrṇānmṛdusparśātsadṛśakṣobhavepathu /
bakodaraṃ sthiraṃsnigdhaṃ nāḍīmāvṛtya jāyate // GarP_1,161.40 //
upekṣāyāñca sarveṣāṃ svasthānāṃ paricālitāḥ /
pākā dravā dravīkuryuḥ sandhisrotomukhānyapi // GarP_1,161.41 //
svede caiva tu saṃruddhe mūrchitāścāntarasthitāḥ /
tadevodaramāpūrya kuryādudarāmayam // GarP_1,161.42 //
gurūdaraṃ sthitaṃ vṛttamāhatañca na śabdakṛt /
hīnabalaṃ tathā ghoraṃ nāḍyāṃ spṛṣṭañca sapati // GarP_1,161.43 //
śirāntardhānamudare sarvalakṣaṇamucyate /
vātapittakaphaplīhasannipātodakodaram // GarP_1,161.44 //
pakṣācca jātasalilaṃ viṣṭambhopadravānvitam /
janmanaivodaraṃ sarvaṃ prāyaḥ kṛcchratamaṃ matam // GarP_1,161.45 //

iti śrīgāruḍe mahāpurāṇme pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekaṣaṣṭyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 162
dhanvantariruvāca /
pāṇḍuśothanidānañca śṛṇu suśrata vacmi te /
pittapradhānāḥ kupitā yathoktaiḥ kopanairmalāḥ // GarP_1,162.1 //
natrānilena balinā kṣiptākṣiptaṃ yadi sthitam /
dhamanīrdaśamīḥ prāpya vyāpnuvansakalāṃ tanum // GarP_1,162.2 //
tvagasṛkchleṣmamāṃsāni pradūṣyanrasamāśritam /
tvaṅmāṃsayostu kurute tvaci varṇān pṛthagvidhān // GarP_1,162.3 //
svayaṃ haridrā hāridraṃ pāṇḍutvaṃ teṣu cādhikam /
yāto 'yaṃ prahatedugraḥ sa rogastena gauravam // GarP_1,162.4 //
dhātūnāṃ sparśaśaithilyamāmajaśca guṇakṣayaḥ /
tato 'lparaktamedo 'sthiniḥ sāraḥ syācchlathendriyaḥ // GarP_1,162.5 //
śīryamāṇairivāṅgaistu dravatā hṛdayena ca /
śūlokṣikūṭavadane staimityaṃ tatra lālayā // GarP_1,162.6 //
hīnatṛṭ śiśiradveṣī śīrṇalobho hatānalaḥ /
mandaśaktirjvarī śvāsī karṇaśūlī tathā bhramī // GarP_1,162.7 //
sa pañcadhā pṛthagdoṣaiḥ samastairmṛttikādanāt /
prāgrūpamasya hṛdayaspandanaṃ rūkṣatā tvaci // GarP_1,162.8 //
aruciḥ pītamūtratvaṃ svedābhāvo 'lpamṛtratā /
medaḥ samānilāttatra gāḍharukkledagātratā // GarP_1,162.9 //
kṛṣṇekṣaṇaṃ kṛṣṇaśirānakhaviṇmūtranetratā /
śotho nāsāsyavairasyaṃ viṭśoṣaḥ pārśvamūrchanā // GarP_1,162.10 //
pitte haritapittābhaḥ śirādiṣu jvarastamaḥ /
tṛṭśoṣamūrchādaurgandhyaṃ śītecchā kaṭuvakratā // GarP_1,162.11 //
viḍbhedaścāmlako dāhaḥ kaphācca hṛdayārdratā /
tandrā lavaṇavakratvaṃ romaharṣaḥ svarakṣayaḥ // GarP_1,162.12 //
kāśaśchardiśca nicayānnaṣṭaliṅgo 'tiduḥ sahaḥ /
utkṛṣṭenilapittābhyā kaṭurvā madhuraḥ kaphaḥ // GarP_1,162.13 //
dūṣayitvā vasādīṃśca raukṣyādraktavimokṣaṇam /
srotasāṃ saṃkṣayaṃ kuryādanurudhya ca pūrvavat // GarP_1,162.14 //
pāṇḍurogekṣayejāte nābhipādāsyamehanam /
purīṣaṃ kṛmivanmuñcedbhinnaṃ sāstraṃ kaphānvitam // GarP_1,162.15 //
yaḥ pittarogī seveta pittalaṃ tasya kāmalam /
koṣṭhaśā khodgataṃ pittaṃ dagdhvāsṛṅmāṃsamāharet // GarP_1,162.16 //
hāridramūtranetratvaṃ mukhaṃ raktaṃ śakṛttathā /
dāhī vipākatṛṣṇāvān bhekābho durbalendriyaḥ // GarP_1,162.17 //
bhavetpittānugaḥ śothaḥ pāṇḍurogāvṛtasya ca /
upekṣayā ca śothādyāḥ sakṛcchrāḥ kumbhakāmalāḥ // GarP_1,162.18 //
haritaśyāmapittatve pāṇḍurogo yadā bhavet /
vātapitte bhramastṛṣṇā strīṣu harṣo mṛdujvaraḥ // GarP_1,162.19 //
tandrā vā cānalabhraṃśastaṃ vadanti halīmakam /
ālasyañcātibhavati teṣāṃ pūrvamupadravaḥ // GarP_1,162.20 //
śothaḥ pradhānaḥ kathitaḥ sa evāto nigadyate /
pittaraktakaphānvāyurduṣṭo duṣṭānbahiḥ śirāḥ // GarP_1,162.21 //
nītvā ruddhagatistairhi kuryāttvaṅmāṃsasaṃśrayam /
utsedhaṃ saṃhataṃ śothaṃ tamāhurnicayādataḥ // GarP_1,162.22 //
sarvahetuviśaṣaistu rūpabhedānnavātmakam /
doṣaiḥ pṛthagvidhaiḥ sarvairabhighātādviṣādapi // GarP_1,162.23 //
tadeva nīyamānantu sarvāṅge kāmajambhavet /
pṛthūnnatāgragrathitairviśeṣaiśca tridhā viduḥ // GarP_1,162.24 //
sāmānyahetuḥ śothānāṃ doṣajāto viśeṣataḥ /
vyādhiḥ karmopavāsādikṣīṇasya bhavati drutam // GarP_1,162.25 //
atimātraṃ yadāsevedgurumatyantaśītalam /
lavaṇakṣāratīkṣṇāmlaśākāmbusvapnajāgaram // GarP_1,162.26 //
rodho vegasya vallūramajīrṇaśramamaithunam /
pacyate mārgagamanaṃ yānena kṣobhiṇāpi vā // GarP_1,162.27 //
śvāsakāsātisārārśojaṭharapradarajvarāḥ /
viṣṭambhālasyakacchardihikkāpāṇḍuvisarpakam // GarP_1,162.28 //
ūrdhvaśothamadho bastau madhye kurvanti madhyagāḥ /
sarvāṅgagaḥ sarvagataḥ pratyapratyageti tadāśrayaḥ // GarP_1,162.29 //
tatpūrvarūpaṃ kṣavathuḥ śirāyāmaṅgagauravam /
vātācchothaścalo rūkṣaḥ khararomāruṇo 'sitaḥ // GarP_1,162.30 //
śaṅkhabastyantraśophartimedobhedāḥ prasuptitā /
vātottānaḥ klamaḥ śīghramunnametpīḍitāṃ tanum // GarP_1,162.31 //
sigdhastu mardanaiḥ śāmyedrātrāvalpo divā mahān /
tvaksarṣapavilipte ca tasmiṃścimicimāyate // GarP_1,162.32 //
pītaraktāsiṃtābhāsaḥ pittajātaśca śoṣakṛt /
śīghraṃ nāsau vā praśamenmadhye prāgdahate tanum // GarP_1,162.33 //
satṛṭdāhajvarasvedo bhramaklodamadabhramāḥ /
sābhilāṣī śakṛdbhedo gandhaḥ sparśasaho mṛduḥ // GarP_1,162.34 //
kaṇḍūmānpāṇḍuromā tvakkaṭhinaḥ śītalo guruḥ /
snigdhaḥślakṣṇaḥ sthiraḥ śūlo nidrācchardyagnimāndyakṛt // GarP_1,162.35 //
āghātena ca śastrādicchedabhedakṣatādibhiḥ /
himānilairdadhyanilairbhallātakapikacchajaiḥ // GarP_1,162.36 //
rasaiḥ śuṣkaiśca saṃsparśācchvayathuḥ syādvisarpavān /
bhṛśoṣmā lohitābhāsaḥ prāyaśaḥ pittalakṣaṇaḥ // GarP_1,162.37 //
viṣajaḥ saviṣaprāṇiparisarpaṇamūtraṇāt /
daṃṣṭrādantanakhāghātādaviṣaprāṇināmapi // GarP_1,162.38 //
viṇmūtraśukropahatamalavadvastusaṃṅkarāt /
viṣavṛkṣānilasparśādgarayogāvacūrṇanāt // GarP_1,162.39 //
mṛduścalo 'valambī ca śīghro dāharujākaraḥ /
navo 'nupadravaḥ śothaḥ sādhyo 'sādhyaḥ pureritaḥ // GarP_1,162.40 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pāṇḍusothanidānaṃ nāma dviṣaṣṭyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 163
dhanvantīraruvāca /
visarpādinidānante vakṣye suśruta tacchṛṇu /
syādvisarpo vighātāttu doṣairduṣṭaiśca śothavat // GarP_1,163.1 //
adhiṣṭhānañca taṃ prāhurbāhyaṃ tatra bhayācchramāt /
yathāttarañca duḥ sādhyastatra doṣo yathāyatham // GarP_1,163.2 //
prakopanaiḥ prakupitā viśeṣeṇa vidāhibhiḥ /
dehe śīghraṃ viśantīha te 'ntare hi sthitā bahiḥ // GarP_1,163.3 //
tṛṣṇābhiyogādvegānāṃ viṣamācca pravartanāt /
āśu cāgnibalabhraṃśādato bāhyaṃ visarpayet // GarP_1,163.4 //
tatra vātātsa vīsarpo vātajvarasamavyathaḥ /
śothasphuraṇanistodabhedāyāsārtiharṣavān // GarP_1,163.5 //
pittāddrutagatiḥ pittajvaraliṅgo 'tilohitaḥ /
kaphātkaṇḍūyutaḥ snigdhaḥ kaphajvarasamānaruk // GarP_1,163.6 //
sannipātasamutthāśca sarvaliṅgasamanvitāḥ /
svadoṣaliṅgaiścīyante sarvaiḥ sphoṭairupekṣitāḥ /
te 'pi svedānvimuñcati bibhrato vraṇalakṣaṇam // GarP_1,163.7 //
vātapittājjvaracchardimūrchātīsāratṛḍbhramaiḥ /
ganthibhedāgnisadanatamakārocakairyutaḥ // GarP_1,163.8 //
karoti sarvamaṅgañca dīptāṅgārāvakīrṇavat /
yaṃyaṃ deśaṃ visarpaśca visarpati bhavetsasaḥ // GarP_1,163.9 //
śāntāṅgārāsito nīlo rakto vāsu ca cīyate /
agnidagdha iva sphoṭaiḥ śīghragatvāddrutaṃ sa ca // GarP_1,163.10 //
marmānusārī vīsarpaḥ syādvāto 'tibalastataḥ /
vyathate 'ṅgaṃ haretsaṃjñāṃ nidrāñca śvāsamīrayet // GarP_1,163.11 //
hikkāñca sa gato 'vasthāmīdṛśīṃ labhate naraḥ /
kvacinmarmāratigrasto bhūmiśayyāsanādiṣu // GarP_1,163.12 //
ceṣṭamānastataḥ kliṣṭo manodehapramohavān /
duṣprabodho 'śnute nidrāṃ so 'gnivīsarpa ucyate // GarP_1,163.13 //
kaphena ruddhaḥ pavano bhittvātaṃ bahudhā kapham /
raktaṃ vā vṛddharaktasya tvakchirāsnāyumāṃsagam // GarP_1,163.14 //
dūṣayitvā tu dīrghānuvṛttasthūlakharātmikām /
granthīnāṃ kurute mālāṃ saraktāntīvrarugjvarām // GarP_1,163.15 //
śvāsakāsātisārāsyaśoṣahikkāvamibhramaiḥ /
mohavaivarṇyamūrchāṅgabhaṅgagnisadanairyutām /
ityayaṃ granthivīsarpaḥ kaphamārutakopajaḥ // GarP_1,163.16 //
kaphapittājjvaraḥ stambho nidrā tandrā śirorujā /
aṅgāvasādavikṣeṃpau pralāpārocakabhramāḥ // GarP_1,163.17 //
mūrchāgnihānirbhedo 'sthnāṃ pipāsendriyagauravam /
āmopaveśanaṃ lepaḥ srotasāṃ sa ca sarpati // GarP_1,163.18 //
prāyeṇāmāśayaṃ gṛhṇannekadeśaṃ na cātiruk /
pīḍakairavakīrṇo 'tipītalohitapāṇḍuraiḥ // GarP_1,163.19 //
snidhno 'sito mecakābho malinaḥ śothavānguruḥ /
gambhīrapākaḥ prāyoṣmaspṛṣṭaḥ klinnoṃ'vadīryate // GarP_1,163.20 //
pakvavacchīrṇamāṃsaśca spaṣṭasnāyuśirāgaṇaḥ /
sarvago lakṣaṇaiḥ sarveḥ sarvagatvaksamarpaṇaḥ /
śavagandhī ca vīsarpaḥ kardamākhyamuśanti tam // GarP_1,163.21 //
bāhyahetoḥ kṣatātkruddhvaḥ saraktaṃ pittamīrayan /
vīsarpaṃ mārutaḥ kuryātkulatthasadṛśaiścitam // GarP_1,163.22 //
sphoṭaiḥ śothajvararujādāhāḍhyaṃ śyāvaśoṇitam /
pathagdoṣaistrayaḥ sādhyā dvandvajāścānupadravāḥ // GarP_1,163.23 //
asādhyāḥ kṛtasarvotthāḥ sarve cākrāntamarmaṇaḥ /
śīrṇasnāyuśirāmāṃsāḥ klinnāścaśavagandhayaḥ // GarP_1,163.24 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vīsarpanidānaṃ nāma tripaṣṭyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 164
dhanvantariruvāca /
mithyāhāravihāreṇa viśeṣeṇa virodhinā /
sādhunindāvadhādyuddhaharaṇādyaiśca sevitaiḥ // GarP_1,164.1 //
pāpmabhiḥ karmabhiḥ sadyaḥ prāktanaiḥ preritāmalāḥ /
śirāḥ prapadya tairyuktāstvagvasāraktamāmiṣam // GarP_1,164.2 //
dūṣayanti ca saṃśoṣya niścarantastato bahiḥ /
tvacaḥ kurvānti vaivarṇyaṃ śiṣṭāḥ kuṣṭhamuśantitam // GarP_1,164.3 //
kālenopekṣitaṃ yatsyātsarvaṃ koṣṭhāni tadvapuḥ /
prapadya dhātūnbāhyāntaḥ sarvānsaṃkledya cāvahet // GarP_1,164.4 //
sasvedakledasaṅkocānkṛmīn sūkṣmāṃścadāruṇān /
lomatvaksnāyudhamanīrākrāmati yathākramam // GarP_1,164.5 //
bhasmācchāditavatkuryādbāhyaṃ kuṣṭhamudāhṛtam /
kuṣṭhāni saptadhā doṣaiḥ pṛthagdvandvaiḥ samāgataiḥ // GarP_1,164.6 //
sarveṣvapi tridoṣeṣu vyapadeśo 'dhikastataḥ /
vātena kuṣṭhaṃ kāpālaṃ pittenaudumbaraṃ kaphāt // GarP_1,164.7 //
maṇḍalākhyaṃ vicarco ca ṛṣyākhyaṃ vātapittajam /
carmaikakuṣṭhaṃ kiṭimaṃ sidhmālasavipādikāḥ // GarP_1,164.8 //
vātaśleṣmodbhavāḥ śleṣmapittāddadrūśatāruṣī /
puṇḍarīkaṃ savisphoṭaṃ pāmā carmadalaṃ tathā // GarP_1,164.9 //
sarvebhyaḥ kākaṇaṃ pūrvatrikaṃ dadru sakākaṇam /
puṇḍarīkaryajihve ca mahākuṣṭhāni sapta tu // GarP_1,164.10 //
atiślakṣṇakharasparśasvedāsvedavivarṇatāḥ /
dāhaḥ kaṇḍūstvaci svāpastodaḥ koconnatistamaḥ // GarP_1,164.11 //
vraṇānāmadhikaṃ śūlaṃ śīghrotpattiścirasthitiḥ /
rūḍhānāmapi rūkṣatvaṃ nimitte 'lpe 'tikopanam // GarP_1,164.12 //
romaharṣo 'sṛjaḥ kārṣṇyaṃ kuṣṭhalakṣaṇamagrajam /
kṛṣṇāruṇakapālābhaṃ yadrūkṣaṃ paruṣaṃ tanu // GarP_1,164.13 //
vistṛtākṛtiparyastandūṣitairlomabhiścitam /
kāpālaṃ todabahulaṃ tatkuṣṭhaṃ viṣamaṃ smṛtam // GarP_1,164.14 //
udumbaraphalābhāsaṃ kuṣṭhamaudumbaraṃ vadet /
vartulaṃ bahulaketyuktaṃ dāharujādhikam // GarP_1,164.15 //
asaṃcchannamadaraṇaṃ kṛmivatsyādudumbaram /
sthiraṃ satyānaṃ guru snigdhaṃ śvetaraktaṃ malānvitam // GarP_1,164.16 //
anyonyasaktapucchūnabahukaṇḍūsnutikṛmi /
ślakṣṇapītābhāsaṃyuktaṃ maṇḍalaṃ parikīrtitam // GarP_1,164.17 //
sakaṇḍūpiṭikā śyāvā sakledā ca vicarcikā /
paruṣantatraraktāntamantaḥ śyāmaṃ samunnatam // GarP_1,164.18 //
ṛṣyajihvākṛtiproktaṃ ṛṣyajihvaṃ bahukrimi /
hasticarmakharasparśaṃ carmākhyaṃ kuṣṭhamucyate // GarP_1,164.19 //
asvedañcamatsyaśalkasannibhaṃ kiṭimaṃ punaḥ /
rūkṣāgnivarṇaṃ duḥ sparśaṃ kaṇḍūmatparuṣāsitam // GarP_1,164.20 //
antā rūkṣaṃ bahiḥ snigdhamantarghṛṣṭaṃ rajaḥ kiret /
ślakṣṇasparśaṃ tanu snigdhaṃ svacchamasvedapuṣpavat // GarP_1,164.21 //
prāyeṇa cordhvakārśyañca kuṇḍaiḥ kaṇḍūparaiścitam /
raktairalaṃśukā pāṇipāde kuryādvipādikā // GarP_1,164.22 //
tīvrārtiṃ gāḍhakaṇḍūñca sarāgapiḍikācitam /
dīrghapratānadūrvāvadatasīkusumacchavi // GarP_1,164.23 //
ucchūnamaṇḍalo dadruḥ kaṇḍūmāniti kathyate /
sthūlamūlaṃ sadāhārti raktastrāvaṃ bahuvraṇam // GarP_1,164.24 //
sādahakakledarujaṃ prāyaśaḥ sarvajanma ca /
raktāktamaṇḍalaṃ pāṇḍu kaṇḍūdāharujānvitam // GarP_1,164.25 //
sotsedhamācitaṃ raktaiḥ kañjaparṇamivāmbubhiḥ /
puṇḍarīkaṃ bhavettaddhi citaṃ sphoṭaiḥ sitāruṇaiḥ // GarP_1,164.26 //
visphoṭapiṭikā pāmā kaṇḍūkledarujānvitāḥ /
sūkṣmā śyāmāruṇā rūkṣā prāyaḥ sphikpāṇikūrpare // GarP_1,164.27 //
sasphoṭasaṃsparśasahaṃ kaṇḍūraktātidāhavat /
raktadalaṃ carmadalaṃ kākaṇaṃ tīvradāharuk // GarP_1,164.28 //
pūrvaraktañca kṛṣṇañca kākaṇaṃ triphalopamam /
kṛṣṇaliṅgairyutaiḥ sarvaiḥ svasvakāraṇato bhavet // GarP_1,164.29 //
doṣabhedāya vihitairādiśelliṅgakarmabhiḥ /
kuṣṭhasvadoṣānugataṃ sarvadoṣagataṃ tyajet // GarP_1,164.30 //
kuṣṭhoktaṃ yacca yaccāsthimajjāśukrasamāśrayam /
kṛcchraṃ medomatañcaiva yāpyaṃ snāpvāsthimāṃsagam // GarP_1,164.31 //
akṛcchraṃ kaphavātotthaṃ tvaggataṃ tvamalañca yat /
tatra tvaci sthite kaṣṭhe kāye vaivarṇyarūkṣātā // GarP_1,164.32 //
svedatāpaśvayathavaḥ śoṇite piśite punaḥ /
pāṇipādāśritāḥ sphoṭāḥ kleśātsandhiṣu cādhikam // GarP_1,164.33 //
doṣasyābhīkṣṇayogena dalanaṃ syācca medasi /
nātisaṃjñāsti majjāsthinetravegasvarakṣyaḥ // GarP_1,164.34 //
kṣate ca krimibhiḥ śukre svadārāpatyabādhanam /
yathāpūrvāṇi sarvāṇi svaliṅgāni mṛgādiṣu // GarP_1,164.35 //
kaṣṭhaikasambhavaṃ śvitraṃ kilāsaṃ dāruṇaṃ bhavet /
nirdiṣṭamaparistrāvi tridhātūdbhavasaṃśrayam // GarP_1,164.36 //
vātādrūkṣāruṇaṃ pittāttāmraṃ kamalapatravat /
sadāhaṃ romavidhvaṃsi kaphācchvetaṃ ghana guru // GarP_1,164.37 //
sakaṇḍūraṃ kramādraktamāṃsamedaḥ su cādiśet /
varṇenaivedṛgubhayaṃ kṛcchraṃ taccottarottaram // GarP_1,164.38 //
aśuklaromabahulamasaṃśliṣṭaṃ mitho navam /
anagnidagdhajaṃ sādhyaṃ śvitraṃ varjyamato 'nyathā // GarP_1,164.39 //
guhyapāṇitalauṣṭheṣu jātamapyacirantaram /
varjanīyaṃ viśeṣeṇa kilāsaṃ siddhimicchitā // GarP_1,164.40 //
sparśaikāhārasaṃgādisevanātprāyaśo gadāḥ /
ekaśayyāsanāccaiva vastramālyānulepanāt // GarP_1,164.41 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe kuṣṭharoganidāna nāma catuḥ ṣaṣṭyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 165
dhanvantariruvāca /
krimayaśca dvidhā proktā bāhyabhyantarabhedataḥ /
bahirmalakaphāsṛgviṭjanmabhedāccaturvidhāḥ // GarP_1,165.1 //
nāmato viṃśatividhā bāhyāstatra malodbhavāḥ /
tilapramāṇasaṃsthānavarṇāḥ keśāmbarāśrayāḥ // GarP_1,165.2 //
bahupādāśca sūkṣmāśca yūkā likṣāśca nāmataḥ /
dvidhā te koṣṭhapiḍikāḥ kaṇḍūgaṇḍānprakurvate // GarP_1,165.3 //
kuṣṭhaikahetavo 'ntarjāḥ śleṣmajā bāhyasambhavāḥ /
madhurānnaguḍakṣīradadhimatsyanavaudanaiḥ // GarP_1,165.4 //
kaphādāmāśaye jātā vṛddhāḥ sarpanti sarvataḥ /
pṛthubradhnanibhāḥ kecitkecidgaṇḍūpadopamāḥ // GarP_1,165.5 //
rūḍhadhānyāṅkurākārāstanudīrghāstathāṇavaḥ /
śvetāstāmrāvabhāsāśca nāmataḥ saptadhā tu te // GarP_1,165.6 //
antrādā udarāveṣṭā hṛdayādā mahāgudāḥ /
cyuravo darbhakusumāḥ sugandhāste ca kurvate // GarP_1,165.7 //
hṛllāsamāsyaśravaṇamavipākamarocakam /
mūrchācchardijvarānāhakārśyakṣavathupīnasān // GarP_1,165.8 //
raktavāhiśirāsthānaraktajā jantavo 'ṇavaḥ /
apādā vṛttatāmrāśca saukṣmyātkecidadarśanāḥ // GarP_1,165.9 //
keśādā romavidhvaṃsā romadvīpā udumbarāḥ /
ṣaṭte kuṣṭhaikakarmāṇaḥ sahasaurasamātaraḥ // GarP_1,165.10 //
pakvāśaye purīṣotthā jāyante 'thovisarpiṇaḥ /
vṛddhāste syurbhaveyuśca te yadāmāśayonmukhāḥ // GarP_1,165.11 //
tadāsyodgāraniḥ śvāmaviḍgandhānuvidhāyinaḥ /
pṛthuvṛttatanusthūlāḥ śyāvapītasitāsitāḥ // GarP_1,165.12 //
te pañcanāmnā krimayaḥ kakerukamakerukāḥ /
sausurādāḥ saśūlākhyā lelihā janayanti hi // GarP_1,165.13 //
vaṅbhedaśūlaviṣṭambhakārśyapāruṣyapāṇḍutāḥ /
romaharṣāgnisadanaṃ gudakaṇḍūṃrvimārgagāḥ // GarP_1,165.14 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe kriminidānaṃ nāma pañcaṣaṣṭhyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 166
dhanvantariruvāca /
vātavyādhinidānaṃ te vakṣye suśruta tacchṛṇu /
sarvathānarthakathane vighna eva ca kāraṇam // GarP_1,166.1 //
adṛṣṭaduṣṭapavanaśarīramaviśeṣataḥ /
sa viśvakarmā viśvātmā viśvarūpaḥ prajāpatiḥ // GarP_1,166.2 //
sraṣṭā dhātā vibhurviṣṇuḥ saṃhartā mṛtyurantakaḥ /
tadvaduktaṃ ca yatnena yatitavyamataḥ sadā // GarP_1,166.3 //
tasyokte doṣavijñāne karma prākṛtavaikṛtam /
samāsavyāsato doṣabhedānāmavadhārya ca // GarP_1,166.4 //
pratyekaṃ pañcadhā vīro vyāpāraśceha vaikṛtaḥ /
tasyocyate vibhāgena sanidānaṃ salakṣaṇam // GarP_1,166.5 //
dhātukṣayakarairvāyuḥ kruddho nātiniṣevyate /
catuḥ snoto 'vakāśeṣu bhūyastānyeva pūrayet // GarP_1,166.6 //
tebhyastu doṣapūrṇebhyaḥ pracchādya vivaraṃ tataḥ /
tava vāyuḥ sakṛtkruddhaḥ śūlānāhāntrakūjanam // GarP_1,166.7 //
malarodhaṃ svarabhraṃśaṃ dṛṣṭipṛṣṭhakaṭigraham /
karotyeva punaḥ kāye kṛcchrānanyānupadravān // GarP_1,166.8 //
āmāśayotthavamathuśvāsakāsaviṣūcikāḥ /
kaṇḍūparodhagharmādivyādhīnūrdhvañca nābhitaḥ // GarP_1,166.9 //
śrotrādīndriyabādhāṃ ca tvaci sphoṭanarūkṣatām /
cakretīvrarujāśvāsagarāmayavivarṇatāḥ // GarP_1,166.10 //
antrasyāntañca viṣṭambhamaruciṃ kṛśatāṃ bhramam /
māṃsamedogatagranthiṃ carmādāvupakarkaśam // GarP_1,166.11 //
gurvaṅgantudyate 'tyarthaṃ daṇḍamuṣṭihataṃ yathā /
asthisthaḥ sakthisandhyasthiśūlaṃ tīvrañca lakṣayet // GarP_1,166.12 //
majjastho 'sthiṣu cāsthairyamasvapnaṃ yattadā rujām /
śukrasya śīghramutsaṅgasargānvikṛtimeva vā // GarP_1,166.13 //
tattadgarbhasthaśukrasthaḥ śirasyādhmānariktātā /
tatra sthānasthitaḥ kuryāt kruddhaḥ śvayathukṛcchratām // GarP_1,166.14 //
jalapūrṇadṛtisparśaṃ śoṣaṃ sandhigato 'nilaḥ /
sarvāṅgasaṃśrayastodabhedasphuraṇabhañjanam // GarP_1,166.15 //
stambhanākṣepaṇaṃ svapnaḥ sandhibhañjanakampanam /
yadā tu dhamanīḥ sarvāḥ kruddho 'bhyeti muhurmuhuḥ /
tadāṅgamākṣipatyeṣa vyādhirākṣepaṇaḥ smṛtaḥ // GarP_1,166.16 //
adhaḥ pratihato vāyurvrajedūrdhvaṃ yadā punaḥ /
tadāvaṣṭabhya hṛdayaṃ śiraḥ śaṅkhau ca pīḍayet // GarP_1,166.17 //
sakṣipetparito gātraṃ hanuṃ vā cāsya nāmayat /
kṛcchrāducchvasitaṃ cāpi nimīlannayanadvayam // GarP_1,166.18 //
kapota iva kūjecca niḥ saṃgaḥ sopatantrakaḥ /
sa eva vāmanāsāyāṃ yuktastu marutā hṛdi // GarP_1,166.19 //
prāpnoti ca muhuḥ svāsthyaṃ muhurasvāsthyavānbhavet /
abhighātasamutthaśca duścikitsyatamo mataḥ // GarP_1,166.20 //
svedastambhaṃ tadā tasya vāyuśchinnatanuryadā /
vyāpnoti sakalaṃ dehaṃ yatra cāyāmyate punaḥ // GarP_1,166.21 //
antardhāntugataścaiva vegastambhaṃ ca netrayoḥ /
karoti jṛmbhāṃ sadanaṃ daśanānāṃ hatodyamam // GarP_1,166.22 //
pārśvayorvedanāṃ bāhyāṃ hanupṛṣṭhasirograham /
dehasya bahirāyāmaṃ pṛṣṭhato hṛdaye śiraḥ // GarP_1,166.23 //
uraścotkṣipyate tatra skandho vā nāmyate tadā /
danteṣvāsye ca vaivarṇyaṃ hyasvedastatra gātrataḥ // GarP_1,166.24 //
bāhyāyāmaṃ hanustambhaṃ bravate vātarogiṇam /
viṇmūtramasṛjaṃ prāpya sasamīrasamīraṇāḥ? // GarP_1,166.25 //
āyacchanti tanordeṣāḥ sarvamāpādamastakam /
tiṣṭhataḥ pāṇḍumātrasya vraṇāyāmaḥ suvardhitaḥ // GarP_1,166.26 //
gātravege bhavetsvāsthyaṃ sarveṣvākṣepaṇena tat /
jihvāvilekhanāduṣṇabhakṣaṇādatimānataḥ // GarP_1,166.27 //
kupito hanumūlasthaḥ stambhayitvānilo hanum /
karoti vivṛtāsyatvamathavā saṃvṛtāsyatām // GarP_1,166.28 //
hanastambhaḥ sa tena syātkṛcchrāccarvaṇabhāṣaṇam /
vāgvādinī śirāstambho jihvāṃ stambhayate 'nilaḥ // GarP_1,166.29 //
jihvāstambhaḥ sa tenānnapānavākyeṣvanīśatā /
śirasā bhāraharaṇādatihāsyaprabhāṣaṇāt // GarP_1,166.30 //
viṣamādupadhānācca kaṭhinānāṃ ca carvaṇāt /
vāyurvivardhate taiśca vātūlairūrdhvamāsthitaḥ // GarP_1,166.31 //
vakrīkaroti vaktraṃ ca hyuccairhasitamīkṣitam /
tato 'sya kurute mṛdvīṃ vākśaktiṃ stabdhanetratām // GarP_1,166.32 //
dantacālaṃ svarabhraṃśaḥ śrutihānīkṣitagrahau /
gandhājñānaṃ smṛtidhvaṃsastrāsaḥ śvāsaśca jāyate // GarP_1,166.33 //
niṣṭhīvaḥ pārśvatodaśca hyekasyākṣṇo nimīlanam /
jatrorūrdhvaṃ rujastīvrāḥ śarīrārdhadharo 'pi vā // GarP_1,166.34 //
tamāhurarditaṃ kecidekāṅgamatha cāpare /
raktamāśritya ca śirāḥ kuryānmūrdhadharāḥ śirāḥ? // GarP_1,166.35 //
rūkṣaḥ savedanaḥ kṛṣṇaḥ so 'sādhyaḥ syācchirograhaḥ /
tanuṃ gṛhītvā vāyuśca snāyustathaiva ca // GarP_1,166.36 //
pakṣamanyataraṃ hanti pakṣāghātaḥ sa ucyate /
kṛtsnasya kāyasyārdhaṃ syādakarmaṇyamacetanam // GarP_1,166.37 //
ekāṅgarogatāṃ kecidanye kakṣarujāṃ viduḥ /
sarvāṅgarodhaḥ stambhaśca sarvakāyāśrite 'nile // GarP_1,166.38 //
śuddhavātakṛtaḥ pakṣaḥ kṛcchrasādhyatamo mataḥ /
kṛcchraścānyena saṃsṛṣṭo vivṛddhaḥ kṣayahetukaḥ // GarP_1,166.39 //
āmabaddhāyanaḥ kuryātsaṃstabhyāṅgaṃ kaphānvitaḥ /
asādhya eva sarvo hi bhaveddaṇḍāpatānakaḥ // GarP_1,166.40 //
aṃsamūlotthito vāyuḥ śirāḥ saṃkucya tatragaḥ /
bahiḥ prasyanditaharaṃ janayatyeva bāhukam // GarP_1,166.41 //
talaṃ pratyaṅgulīnāṃ yaḥ kaṇḍarā bāhupṛṣṭhataḥ /
bāhvoḥ karmakṣayakarī vipūcī veti socyate // GarP_1,166.42 //
vāyuḥ kaṭyāśritaḥ sakthnaḥ kaṇḍarāmākṣaipedyadā /
tadā khañjo bhavejjantuḥ paṅguḥ sakthnordvayorvadhāt // GarP_1,166.43 //
kampate gamanārambhe khañjanniva ca gacchati /
kalāyakhañjaṃ taṃ vidyānmuktasandhiprabandhanam // GarP_1,166.44 //
śītoṣṇadravasaṃsuṣkagurusnigdhaiśca sevitaiḥ /
jīrṇājīrṇe tathāyāsakṣobhasnigdhaprajāgaraiḥ // GarP_1,166.45 //
śleṣmabhedaḥ samaye paramatyarthasaṃcitam /
abhibhūyetaraṃ doṣaṃ śarīraṃ pratipadyate // GarP_1,166.46 //
sakthyasthīni prapūryāntaḥ śleṣmaṇā stambhitena tat /
tadāsthi snāti tenorostathā śītānilena tu // GarP_1,166.47 //
śyāmāṅgamaṅgastaimityatandrāmūrchārucijvaraiḥ /
tamūrustambhamityāha bāhyavātamathāpare // GarP_1,166.48 //
vātaśoṇitasaṃśotho jānumadhye mahārujaḥ /
jñeyaḥ kroṣṭukaśīrṣastu sthūlakroṣṭukaśīrṣavat // GarP_1,166.49 //
rukpādaviṣamanyaste śramādvā jāyate yadā /
vātena gulphamākṣitya tamāhurvātakaṇṭakam // GarP_1,166.50 //
pārṣṇipratyaṅgulīnābhau kaṇṭhe vā mārutārdite /
satikṣepaṃ nigṛhṇāti gṛdhrasīṃ tāṃ pracakṣate // GarP_1,166.51 //
hṛṣyete caraṇau yasya bhavetāṃ cāpi suptakau /
pādaharṣaḥ sa vijñeyaḥ kaphamārutakopajaḥ // GarP_1,166.52 //
pādayoḥ kurute dāhaṃ pittāsṛksahito 'nilaḥ /
viśeṣataścaṅkramataḥ pādadāhaṃ tamādiśet // GarP_1,166.53 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vātavyādhinidānaṃ nāma ṣaṭūṣaṣṭyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 167
dhanvantarīruvāca /
vātaraktanidānaṃ te vakṣye suśruta tacchṛṇu /
viruddhādhyaśanakrodhadivāsvapnaprajāgaraiḥ // GarP_1,167.1 //
prāyaśaḥ sukumārāṇāṃ mithyāhāravihāriṇām /
sthūlānāṃ sukhināṃ cāpi kupyate vātaśoṇitam // GarP_1,167.2 //
agnighātādaśuddheśca nṛṇāmasṛji dūṣite /
vātalaiḥ śītalairvāyurvṛddhaḥ kruddho vimārgagaḥ // GarP_1,167.3 //
tādṛśaivāsṛjā ruddhaḥ prāktadaiva pradūṣayet /
tathā vāto gude pīḍāṃ balāsaṃ vātaśoṇitam // GarP_1,167.4 //
saṃstabhya janayetpūrvaṃ paścātsarvatra dhāvati /
viśeṣādvamanādyaiśca pralambastasya lakṣaṇam // GarP_1,167.5 //
bhaviṣyataḥ kuṣṭhasamaṃ tathā sāmbudasaṃjñakam /
jānujaṅghorukaṭyaṃsahastapādāṅgasandhiṣu // GarP_1,167.6 //
kaṇḍūsphuraṇanistodabhedagauravasuptatāḥ /
bhūtvā bhūtvā praśāmyanti muhurāvirbhavanti ca // GarP_1,167.7 //
pādayormūlamāsthāya kadāciddhastayorapi /
ākhoriva vilaṃ kruddhaḥ kṛtsnaṃ dehaṃ bidhāvati // GarP_1,167.8 //
tvaṅmāṃsāśrayamattānaṃ tatpūrvaṃ jāyate tataḥ /
kālāntareṇa gambhīraṃ sarvadhātūnabhidravet // GarP_1,167.9 //
kaṭyādisaṃyatasthāne tvaktāmraśyāvalohitāḥ /
śvayathurgrathitaḥ pākaḥ sa vāyuścāsthimajjasu // GarP_1,167.10 //
chindanniva caratyantaścakīkurvaṃśca vegavān /
karoti khañjaṃ paṅguṃ vā śarīraṃ sarvataścaran // GarP_1,167.11 //
vātādhike 'dhikaṃ tatra śūlasphuraṇabhañjanam /
śothasya raukṣyaṃ kṛṣṇatvaṃ śyāvatāvṛddhihānayaḥ // GarP_1,167.12 //
dhamanyaṅgulisandhīnāṃ saṃkocoṅgagraho tiruk /
śītadveṣānupaśayau stambhavepathusuptayaḥ // GarP_1,167.13 //
rakte śotho 'tiruktodastāmrāścimicimāyate /
snigdharūkṣaiḥ samaṃ naiti kaṇḍukledasamanvitaḥ // GarP_1,167.14 //
pitte vidāhaḥ saṃmohaḥ svādo mūrchā madastṛṣā /
sparśāsahatvaṃ rugrāvaḥ śoṣaḥ pāko bhṛśoṣmatā // GarP_1,167.15 //
kaphe staimityagurutā suptisnigdhatvaśītatā /
kaṇḍūrmandā ca rugdbandvaṃ sarvaliṅgañca saṃkarāt // GarP_1,167.16 //
ekadoṣañca saṃsādhyaṃ yāpyañcaiva dvidoṣajam /
tridoṣajantyajedāśu raktapittaṃ sudāruṇam // GarP_1,167.17 //
raktamaṅge nihantyāśu śākhāsandhiṣu mārutaḥ /
niveśyānyonyamāvārya vedanābhirharatyasūn // GarP_1,167.18 //
vāyau pañcātmake prāṇe raukṣyāccāpalyalaṅghanaiḥ /
atyāhārābhighātācca vegodīraṇacāraṇaiḥ // GarP_1,167.19 //
kupitaścakṣurādīnāmupaghātaṃ prakalpayet /
pīnaso dāhatṛṭkāsaśvāsādiścaiva jāyate // GarP_1,167.20 //
kaṇṭharodhomalabhraṃśacchardyarocakapīnasān /
kuryācca galagaṇḍadīṃstañjatrumūrdhvasaṃśrayaḥ // GarP_1,167.21 //
vyāno 'tigamanasnānakrīḍāviṣayacoṣṭitaiḥ /
viruddharūkṣabhīharṣaviṣādādyaiśca dūṣitaḥ // GarP_1,167.22 //
puṃstvotsāhabalabhraṃśaśokacittaplavajvarān /
sarvākārādinistodaromaharṣaṃ suṣuptatām // GarP_1,167.23 //
kuṣṭhaṃ visarpamanyacca kuryāt sarvāṅgasādanam /
samāno viṣamājīrṇaśītasaṅkīrṇabhojanaiḥ // GarP_1,167.24 //
karotyakālaśayanajāgarādyaiśca dūṣitaḥ /
śūlagulmagrahaṇyādīnyakṛtkāmāśrayāngadān // GarP_1,167.25 //
apāno rūkṣagurvannavegāghātātivāhanaiḥ /
yānapānasamutthānacaṅkramaiścātisevitaiḥ // GarP_1,167.26 //
kupitaḥ kurute rogānkṛtsnān pakvāśayāśrayān /
mūtrasukrapradoṣārśogudabhraṃśādikānbahūn // GarP_1,167.27 //
sarvāṅgamātataṃ sāmaṃ tandrāstaimityagauravaiḥ /
snigdhatvādbodha kālasya śaityaśothāgnihānayaḥ // GarP_1,167.28 //
kaṇḍūrūkṣātināśena tadvidhopaśamena ca /
muktiṃ vidyānnirāmaṃ taṃ tandrādīnāṃ viparyayāt // GarP_1,167.29 //
vāyorāvaraṇaṃ vāto bahubhedaṃ pracakṣate /
pittaliṅgāvṛte dāhastṛṣṇā śūlaṃ bhramastamaḥ // GarP_1,167.30 //
kaṭukoṣṇāmlalavaṇairvidāhaśītakāmatā /
śaityagauravaśūlāgnikaṭvājyapayaso 'dhikam // GarP_1,167.31 //
laṅghanāyāsarūkṣoṣṇakāmatā ca kaphāvṛte /
kaphāvṛte 'ṅgamardaḥ syāddhṛllāso gurutāruciḥ // GarP_1,167.32 //
raktavṛte sadāhārtistavaṅmāṃsāśrayajā bhṛśam /
bhavetsarāgaḥ śvayathurjāyante maṇḍalāni ca // GarP_1,167.33 //
śotho māṃsena kaṭhino hṛllāsapiṭikāstathā /
harṣaḥ pipīlikānāṃ ca saṃcāra iva jāyate /
calalagrano mṛduḥ śītaḥ śotho gātreṣu rocakaḥ // GarP_1,167.34 //
āḍhyavāta iva jñeyaḥ sa kṛcchro medasāvataḥ /
sparśa ācchāditetyuṣṇaśītalaśca tvanāvṛte /
majjāvṛte tu viṣamaṃ jṛmbhaṇaṃ pariveṣṭanam // GarP_1,167.35 //
śūlañca paḍyimānaśca pāṇibhyāṃ labhate sukham /
śukrāvṛte tu śothe vai cātivego na vidyate // GarP_1,167.36 //
bhukte kukṣau rujā jīrṇe nikṛttirbhavati dhruvam /
mūtrāpravṛttirādhmānaṃ bastermūtrāvṛte bhavet // GarP_1,167.37 //
chidrāvṛte vibandho 'tha svasthānaṃ parikṛnta ti /
patatyāśu jvarākrānto mūrchāṃ ca labhate naraḥ // GarP_1,167.38 //
sakṛt pīḍitamanyena duṣṭaṃ śukraṃ cirātsṛjet /
sarvadhātvāvṛte vāyau śroṇivaṅkṣaṇapṛṣṭharuk // GarP_1,167.39 //
vilome mārute caiva hṛdayaṃ paripīḍyate /
bhramo mūrchā rujā dāhaḥ pittena prāṇa āvṛte // GarP_1,167.40 //
rujā tandrā svarabhraṃśo dāho vyāne tu sarvaśaḥ /
kramoṃ gaceṣṭābhaṅgaśca santāpaḥ sahavedanaḥ // GarP_1,167.41 //
samāna ūṣmopahatiḥ sasvedoparatiḥ sutṛṭ /
dāhaśca syādapāne tu male hāridravarṇatā // GarP_1,167.42 //
rajovṛddhistāpanañca tathā cānāhamehanam /
śleṣmaṇā prāvṛte prāṇe nādaḥ snoto 'varodhanam // GarP_1,167.43 //
ṣṭhīvanañcaiva sasvedaśvāsaniḥ śvāsasaṃgrahaḥ /
udāne gurugātratvamarucirvāksvaragrahaḥ // GarP_1,167.44 //
balavarṇapraṇāśaścā pāne parvāsthisaṃgrahaḥ /
gurutāṅgeṣu sarveṣu sthūlatvañcāgataṃ bhṛśam // GarP_1,167.45 //
samāne 'tikriyājñatvamasvedo mandavahnitā /
apāne sakalaṃ mūtraṃ śakṛtaḥ syātpravartanam? // GarP_1,167.46 //
iti dvāviṃśatividhaṃ vātaraktāmayaṃ viduḥ /
prāṇādayastathānyo 'nyaṃ samākrāntā yathākramam // GarP_1,167.47 //
sarve 'pi viṃśatividhaṃ vidyādāvaraṇañca yat /
hṛllāsocchvāsasaṃrodhaḥ pratiśyāyaḥ śirograhaḥ // GarP_1,167.48 //
hṛdrogo mukhaśoṣaśca prāṇenāpāna āvṛte /
udānenāvṛte prāṇe bhaveddhai balasaṃkṣayaḥ // GarP_1,167.49 //
vicāraṇena vibhajetsarvamāvaraṇaṃ bhiṣak /
sthānānyapekṣya vātānāṃ vṛrdhihāniṃ ca karmaṇām // GarP_1,167.50 //
prāṇādīnāñca pañcānāṃ pittamāvaraṇaṃ mithaḥ /
pittādīnāmāvasatirmiśrāṇāṃ miśritaiśca taiḥ // GarP_1,167.51 //
miśraiḥ pittādibhistadvanmiśrāṇyapitvanekadhā /
tāṃllakṣayedavahito yathāsvaṃ lakṣaṇodayāt // GarP_1,167.52 //
śanaiḥ śanaiścopaśayāndṛḍhānapi muhurmuhuḥ /
viśeṣājjīvitaṃ prāṇa udāno balamucyate /
syāttayoḥ pīḍanāddhanirāyuṣañca balasya ca // GarP_1,167.53 //
āvṛtā vāyavo 'jñātā jñātā vā sthānavicyutāḥ /
prayatnenāpi duḥ sādhyā bhaveyurvānupadravāḥ // GarP_1,167.54 //
vidradhiplīhahṛdrogagulmāgnisadanādayaḥ /
bhavantyupadravāsteṣāmāvṛtānāmupekṣayā // GarP_1,167.55 //
nidānaṃ suśruta ! mayā ātreyoktaṃ samīritam /
sarvarogavivekāya narādyāyuḥ pravṛddhaye // GarP_1,167.56 //
evaṃ vijñāya rogādīṃścikitsāmatha vai caret /
triphalā sarvarogaghnī madhvājyaguḍasaṃyutā // GarP_1,167.57 //
savyoṣā triphalā vāpi sarvarogapramardinī /
śatāvarīguḍūcyagniviḍaṅgena yutāthavā // GarP_1,167.58 //
śatāvarī guḍūcyagniḥ śuṇṭhīmūṣalikā balā /
punarnavā ca bṛhatī nirguṇḍī nimbapatrakam // GarP_1,167.59 //
bhṛṅgarājaścāmalakaṃ vāsakastadrasena vā /
bhāvitā triphalā saptavāramekhamathāpivā // GarP_1,167.60 //
pūrvoktaśca yathālābhayuktaiścūrṇañca modakaḥ /
vaṭikā ghṛtatailaṃ vā kaṣāyo śoṣaroganut /
palaṃ palārdhakaṃ vāpi karṣaṃ karṣārdhameva vā // GarP_1,167.61 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vātaraktani saptaṣaṣṭyādhikaśatatamodhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 168
nidānaṃ samāptam /
dhanvantariruvāca /
sarvarogaharaṃ siddhaṃ yogasāraṃ vadāmyaham /
śṛṇu suśrutaṃ saṃkṣepātprāṇināṃ jīvahetave // GarP_1,168.1 //
kaṣāyakaṭutiktāmlarūkṣāhārādibhojanāt /
cintāvyavayavyāyāmabhayaśokaprajāgarāt // GarP_1,168.2 //
uccairbhāṣātibhārācca karmayogātikarṣaṇāt /
vāyuḥ kupyati parjanye jīrṇānne dinasaṃkṣaye // GarP_1,168.3 //
uṣṇāmla lavaṇakṣārakaṭukājīrṇabhojanāt /
tīkṣṇātapāgnisantāpamadyakrodhaniṣevaṇāt // GarP_1,168.4 //
vidāhakāle bhuktasya madhyāhne jaladātyaye /
grīṣmakāler'ddharātre 'pi pittaṃ kupyati dehinaḥ // GarP_1,168.5 //
svādvamlalavaṇasnigdhaguruśītātibhojanāt /
navānnapicchilānūpamāṃsādeḥ sevanādapi // GarP_1,168.6 //
avyāyāma divāsvapnaśayyāsanasukhādibhiḥ /
kaphapradoṣo bhukte ca vasante ca prakupyati // GarP_1,168.7 //
dehapāruṣyasaṃkocatodaviṣṭambhakādayaḥ /
tathā ca suptā romaharṣastambhanaśoṣaṇam // GarP_1,168.8 //
śyāmatvamaṅgaviśleṣabalamāyāsavardhanam /
vāyorliṅgāni tairyuktaṃ rogaṃ vātātmakaṃ vadet // GarP_1,168.9 //
dāhoṣmapādasaṃkledakoparāgapariśramāḥ /
kaṭvamlaśavavaigandhyasvedamūrchātitṛṭbhramāḥ // GarP_1,168.10 //
hāridraṃ haritatvañca pittaliṅgānvitairnaraḥ /
dehe snigdhatvamādhuryacirakāritvabandhanam // GarP_1,168.11 //
staimityatṛptisaṅghātaśothaśatilagauravam /
kaṇḍūnidrābhiyogaśca lakṣaṇaṃ kaphasambhavam // GarP_1,168.12 //
hetulakṣaṇasaṃsargādvidyādvyādhiṃ dvidoṣajam /
sarvahetusamutpannaṃ triliṅgaṃ sānnipātikam // GarP_1,168.13 //
doṣadhātumalādhāro dehināṃ deha ucyate /
teṣāṃ samatvamārogyaṃ kṣayavṛddherviparyayaḥ // GarP_1,168.14 //
vasāsṛṅmāṃsamedo 'sthimajjāśukrāṇi dhātavaḥ /
vātapittakaphā doṣā viṇmūtrādyā malāḥ smṛtāḥ // GarP_1,168.15 //
vāyuḥ śīto laghuḥ sūkṣmaḥ svaranāśīsthiro balī /
pittamamlakaṭūṣṇañcāpaṅktī rogakāraṇam // GarP_1,168.16 //
madhuro lavaṇaḥ snigdho guruḥ śleṣamātipicchilaḥ /
gudaśroṇyāśrayo vāyuḥ pittaṃ pakvāśayasthitam // GarP_1,168.17 //
kaphasyāmāśayasthānaṃ kaṇṭho vā mūrdhasandhayaḥ /
kaṭutiktakaṣāyāśca kopayanti samīraṇam // GarP_1,168.18 //
kaṭvamlalavaṇāḥ pittaṃ svādūṣṇalavaṇāḥ kapham /
eta eva viparyastāḥ śamāyaiṣāṃ prayojitāḥ /
bhavanti rogiṇāṃ śāntyai svasthāne sukhahetavaḥ // GarP_1,168.19 //
cakṣuṣyo madhuro jñeyo rasadhātuvivahddhanaḥ /
amlottaro manohṛdyaṃ tathā dīpanapācanam // GarP_1,168.20 //
dīpanojvaratṛṣṇāghnastiktaḥ śodhanaśoṣaṇaḥ /
pittalo lekhana stambhī kaṣāyo grāhiśoṣaṇaḥ // GarP_1,168.21 //
rasavīryavipākānāmāśrayaṃ dravyamuttamam /
rasapākāntarasthāyi sarvadravyāśrayaṃ drutam // GarP_1,168.22 //
śītoṣṇaṃ lavaṇaṃ vīryamatha vā śaktiriṣyate /
rasānāṃ dvividhaḥ pāko kaṭureva ca // GarP_1,168.23 //
bhiṣagbheṣajarogārtaparicārakasampadaḥ /
cikitsāṅgānicatvāri viparītānyasiddhaye // GarP_1,168.24 //
deśakālavayovahnisāmyaprakṛtibheṣajam /
dehasattvabalavyādhīnbuddhvā karma samācaret // GarP_1,168.25 //
bahūdakanago 'nūpaḥ kaphamārutakopavān /
jāṅgalo 'paraśākhī ca raktapittagadottaraḥ // GarP_1,168.25*1 //
saṃsṛṣṭalakṣaṇopeto deśaḥ sādhāraṇaḥ smṛtaḥ /
bāla ā ṣoḍaśānmadhyaḥ saptatervṛddha ucyate // GarP_1,168.26 //
kaphapittānilāḥ prāyo yathākramamudīritāḥ /
kṣārāgniśastrarahitā kṣīṇe pravayasi kriyāḥ // GarP_1,168.27 //
kṛśasya vṛṃhaṇaṃ kāryaṃsthūladehasya karṣaṇam /
rakṣaṇaṃ madhyakāyasya dehabhedāstrayo matāḥ // GarP_1,168.28 //
sthairyavyāyāmasantoṣairboddhavyaṃ yatnato balam /
avikārī mahotsāho mahāsāhasiko naraḥ // GarP_1,168.29 //
pānāhārādayo yasya viruddhāḥ prakṛterapi /
śvasukhāyopakalpyante tatsāmyamiti kathyate // GarP_1,168.30 //
garbhiṇyāḥ ślaiṣmikairbhakṣyaiḥ ślaiṣmiko jāyate naraḥ /
vātalaiḥ pittalaistadvatsamadhāturhitāśanāt // GarP_1,168.31 //
kṛśo rūkṣo 'lpakeśaśca calacitto naraḥ sthitaḥ /
bahuvākyarataḥ svapnevātaprakṛtiko naraḥ // GarP_1,168.32 //
akālapalito gauraḥ prasvedī kopano budhaḥ /
svapne 'pi dīptimatprekṣī pittaprakṛtirucyate // GarP_1,168.33 //
sthiracittaḥ svaraḥ sūkṣmaḥ prasannaḥ snigdhamūrdhajaḥ /
svapne jalaśilālokī śleṣma prakṛtiko naraḥ // GarP_1,168.34 //
saṃmiśralakṣaṇairjñeyo dvitridoṣānvayo naraḥ /
doṣasyetarasadbhāve 'pyadhikā prakṛtiḥ smṛtāḥ // GarP_1,168.35 //
mandastīkṣṇo 'tha viṣamaḥ samaścaiti caturvidhāḥ /
kaphapittānilādhikyāttatsāmyājjāṭharo 'nalaḥ // GarP_1,168.36 //
samasya pālanaṃ kāryaṃ viṣame vātanigrahaḥ /
tīkṣṇe pittapratīkāro mande śleṣmaviśodhanam // GarP_1,168.37 //
prabhavaḥ sarvarogāṇāmajīrṇaṃ cāgnināśanam /
āmāmlarasaviṣṭambha lakṣaṇantaccaturvidham // GarP_1,168.38 //
āmādviṣūcikā caiva hṛdālasyādayastathā /
vacālavaṇatoyena chardanaṃ tatra kārayet // GarP_1,168.39 //
śukrābhāvo bhramo mūrchā tarṣo 'mlātsaṃpravartate /
apakvaṃ tatra śītāmbupānaṃ vātaniṣevaṇam // GarP_1,168.40 //
gātrabhaṅgaṃ śirojāḍyaṃ bhaktadoṣādayo gadān /
tasminsvāpo divā kāryolaṅghanaṃ ca vivarjanam // GarP_1,168.41 //
śūlagulmau ca viṇmūtrasthānaviṣṭambhasūcakau /
vidheyaṃ svedanaṃ tatra pānīyaṃ lavaṇodakam // GarP_1,168.42 //
āmamamlaṃ ca viṣṭabdhaṃ kaphapittānilaiḥ kramāt /
ālipya jaṭharaṃ prājño hiṅgutryūṣaṇasaindhavaiḥ // GarP_1,168.43 //
divāsvapnaṃ prakurvīta sarvājīrṇavināśanam /
ahitānnai rogarāśirahitānnaṃ tatastyajet // GarP_1,168.44 //
uṣṇāmbu vānupānaṃ ca mākṣikaiḥ pācanaṃ bhavet /
karīradadhimatsyaiśca prāyaḥ kṣīraṃ virudhyate // GarP_1,168.45 //
bilvaḥ śoṇā ca gambhārī pāṭalā gaṇikārikā /
dīpanaṃ kaphavātaghnaṃ pañcamūlamidaṃ mahat // GarP_1,168.46 //
śālaparṇo pṛśriparṇo bṛhatīdvayagokṣuram /
vātapittaharaṃ vṛṣyaṃ kanīyaḥ pañcamūlakam // GarP_1,168.47 //
ubhayaṃ daśasūlaṃ syātsannipātajvarāpaham /
kāse śvāse ca tandrāyāṃ pārśvaśūle ca śasyate // GarP_1,168.48 //
etaistailāni sarpoṣi pralepādalakāṃ jayet /
kvāthāccaturguṇaṃ vāri pādasthaṃ syāccaturguṇam // GarP_1,168.49 //
snehañca tatsamaṃ kṣīraṃ kalkaśca snehapādakaḥ /
saṃvartitauṣadhaiḥ pāko bastau pāne bhavetsamaḥ /
kharo 'bhyaṅge mṛdurnasye pāko 'pi saṃprakalpayet // GarP_1,168.50 //
sthūladehandriyāścintyā prakṛtiryā tvadhiṣṭhitā /
ārogyamiti taṃ vidyādāyuṣmantamupācaret // GarP_1,168.51 //
yo gṛhṇātīndriyairarthānviparītānsa mṛtyubhāk /
bhiṣaṅmitragurudveṣī priyārātiśca yo bhavet // GarP_1,168.52 //
gulphajānulalāṭaṃ ca hanurgaṇḍastathaiva ca /
bhraṣṭaṃ sthānacyutaṃ yasya sa jahātyacirādasūn // GarP_1,168.53 //
vāmākṣimajjanaṃ jihvā śyāmā nāsā vikāriṇī /
kṛṣṇau sthānacyutau coṣṭhau kṛṣṇāsyaṃ yasyataṃ tyajet // GarP_1,168.54 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaidyakaśāstraparibhāṣā nāmāṣṭaṣaṣṭyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 169
dhanvantariruvāca /
hitāhitavikekāya anupānavidhiṃ bruve /
raktaśāli tridoṣaghnaṃ tṛṣṇāmedonivārakam // GarP_1,169.1 //
mahāśāli paraṃ vṛṣyaṃ kalamaḥ śleṣmapittahā /
śītto gurustridoṣaghnaḥ prāyaśo gauraṣaṣṭikaḥ // GarP_1,169.2 //
śyāmākaḥ śoṣaṇo rūkṣo vātalaḥ śleṣmapittahā /
tadvatpriyaṅgunīvārakoradūṣāḥ prakīrtitāḥ // GarP_1,169.3 //
bahuvāraḥ sakṛcchītaḥ śleṣmapittaharo yavaḥ /
vṛṣyaḥ śīto guruḥ svādurgodhūmo vātanāśanaḥ // GarP_1,169.4 //
kaphapittāstrajinmudgaḥ kaṣāyo madhurolaghuḥ /
māṣo bahubalo vṛṣyaḥ pittaśleṣmaharo guruḥ // GarP_1,169.5 //
avṛṣyaḥ śleṣmapittaghno rājamāṣo 'nilārtinut /
kulatthaḥ śvāsahikkāhṛtkaphagulmānilāpahaḥ // GarP_1,169.6 //
raktapittajvaronmātho śīto grāhī makuṣṭhakaḥ /
puṃstvāsṛkkaphapittaghnaścaṇako vātalaḥ smṛtaḥ // GarP_1,169.7 //
masūro madhuraḥ śīva saṃgrahī kaphapittahā /
tadvatsarvaguṇāḍhyaśca kalāyaścātivātalaḥ // GarP_1,169.8 //
āgkī kaphapittaghno śukralā ca tathā smṛtā /
atasī pittalā jñeyā siddhārthaḥ kaphavātajit // GarP_1,169.9 //
sakṣāramadhurasnigdho baloṣṇapittakṛttilaḥ /
balaghnā rūkṣalāḥ śītā vividhāḥ sasyajātayaḥ // GarP_1,169.10 //
citrakeṅgudinālīkāḥ pippalīmadhuśigravaḥ /
cavyācaraṇanirguṇḍītarkārīkāśamardakāḥ // GarP_1,169.11 //
sabilvāḥ kaphapittaghnāḥ krimighnā laghudīpakāḥ /
varṣābhūmārkarau vātakaphaghnau doṣanāśanau // GarP_1,169.12 //
tiktarasaḥ syāderaṇḍaḥ kākamācī tridoṣahṛt /
cāṅgerī kaphavātaghnī sarṣapaḥ sarvadoṣadam // GarP_1,169.13 //
tadvadeva ca kausmasumbhaṃ rājikā vātapittalā /
nāḍīcaḥ kaphapittaghnaḥ cucurmadhuraśītalaḥ // GarP_1,169.14 //
doṣaghnaṃ padmapatrañca tripuṭaṃ vātakṛtparam /
sakṣāraḥ sarvadoṣaghno vāstuko rocanaḥ paraḥ // GarP_1,169.15 //
taṇḍukīyovipaharaḥ pālaṅkyāśca tathāpare /
mūlakaṃ doṣakṛcchāmaṃ svinnaṃ vātakaphāpadam // GarP_1,169.16 //
sarvadoṣaharaṃ hyadyaṃ kaṇṭhyaṃ tatpakvamiṣyate /
karkoṭakaṃ savārtākaṃ padolaṃ kāravellakam // GarP_1,169.17 //
kuṣṭhamehajvaraśvāsakāsapittakaphāpaham /
sarvadoṣaharaṃ hṛdyaṃ kūṣmāṇḍaṃ bastiśodhanam // GarP_1,169.18 //
kaliṅgālābunī pittanāśinī vātakāriṇī /
trapuṣorvāruke vātaśleṣmale pittavāraṇe // GarP_1,169.19 //
vṛkṣāmlaṃ kaphavātaghnaṃ jambīraṃ kaphavātanut /
vātaghnaṃ dāḍimaṃ grāhi nāgaraṅgaphalaṃ guru // GarP_1,169.20 //
keśaraṃ mātuluṅgaṃ ca dīpanaṃ kaphavātanut /
vātapittaharo māṣastvaksnigdhoṣṇānilāpahaḥ // GarP_1,169.21 //
saramāmalakaṃ vṛṣyaṃ madhuraṃ hṛdyamamlakṛt /
bhuktaprarocakā puṇyā harītakyamṛtopamā // GarP_1,169.22 //
straṃsanī kaphavātaghnī hyakṣastadvattridoṣajit /
vātaśleṣmaharaṃ tvamlaṃ straṃsanaṃ tintiḍīphalam // GarP_1,169.23 //
doṣalaṃ lakucaṃ svādu bakulaṃ kaphavātajit /
gulmavātakaphaśvāsakāsaghnaṃ bījapūrakam // GarP_1,169.24 //
kapitthaṃ grāhi doṣaghnaṃ pakvaṃ guru viṣāpaham /
kaphapittakaraṃ bālamāpūrṇaṃ pittavardhanam // GarP_1,169.25 //
pakvāmraṃ vātakṛnmāṃsaśukravarṇabalapradam /
vātaghnaṃ kaphapittaghnaṃ grāhi viṣṭambhi jāmbavam // GarP_1,169.26 //
tindukaṃ kaphavātaghnaṃ badaraṃ vātapittahṛt /
viṣṭambhi vātalaṃ bilvaṃ priyālaṃ pavanāpaham // GarP_1,169.27 //
rājādanaphalaṃ mocaṃ panasaṃ nārikelajam /
śukramāṃsakarāṇyāhuḥ svādusnigdhagurūṇi ca // GarP_1,169.28 //
drākṣāmadhūkakharjūraṃ kuṅkumaṃ vātaraktajit /
māgadhī madhurā pakvā śvāsapittaharā parā // GarP_1,169.29 //
ārdrakaṃ rocakaṃ vṛṣyaṃ dīpanaṃ kaphavātahṛt /
śuṇṭhīmaricapippalyaḥ kaphavātajito matāḥ // GarP_1,169.30 //
avṛṣyaṃ maricaṃ vidyāditi vaidyakasaṃmatam /
gulmaśūlavibandhaghnaṃ hiṅguvātakaphāpaham // GarP_1,169.31 //
yavānīdhanyakājājyaḥ vātaśleṣmanudaḥ param /
cakṣuṣyaṃ saindhavaṃ vṛṣyaṃ tridoṣaśamanaṃ smṛtam // GarP_1,169.32 //
sauvarcalaṃ vibandhaghnamuṣṇaṃ hṛcchūlanāśanam /
uṣṇaṃ śūlaharaṃ tīkṣṇaṃ viḍaṅgaṃ vātanāśanam // GarP_1,169.33 //
romakaṃ vātalaṃ svādu rocanaṃ kledanaṃ guru /
hṛtpāṇḍugalarogaghnaṃ yavakṣāro 'gnidīpanaḥ // GarP_1,169.34 //
dahano dīpanastīkṣṇaḥ sarjikṣāro vidāraṇaḥ /
doṣaghnaṃ nābhasaṃ vārilaghu hṛdyaṃ viṣāpaham // GarP_1,169.35 //
nādeyaṃ vātalaṃ rūkṣaṃ sārasaṃ madura laghu /
vātaśleṣmaharaṃ vārpyaṃ tāḍāgaṃ vātalaṃ smṛtam // GarP_1,169.36 //
raucyamagnikaraṃ rūkṣaṃ kaphaghnaṃlaghu nairjharam /
dīpanaṃ pittalaṃ kaupamaudbhidaṃ pittanāśanam // GarP_1,169.37 //
divārkakiraṇairjuṣṭaṃ rātrau caivenduraśmibhiḥ /
sarvadoṣavinirmuktaṃ tattulyaṃ gaganāmbunā // GarP_1,169.38 //
uṣṇaṃ vāri jvaraśvāsamedo 'nilakaphāpaham /
śṛtaṃ śītatridoṣaghnamuṣitaṃ tacca doṣalam // GarP_1,169.39 //
gokṣīraṃ vātapittagnaṃ snigdhaṃ gururasāyanam /
gavyādgurutaraṃ snigdhaṃ māhiṣ vahnināśanam // GarP_1,169.40 //
chāgaṃ raktātisāraghnaṃ kāsaśvāsakaphāpaham /
cakṣuṣyaṃ jīvanaṃ strīṇāṃ raktapitte canāvanam // GarP_1,169.41 //
paraṃ vātaharaṃ vṛṣyaṃ pittaśleṣmakaraṃ dadhi /
doṣaghnaṃ manthajātantu mastu srotoviśodhanam // GarP_1,169.42 //
grahaṇyarśo 'rditārtighnaṃ navanītaṃ navoddhṛtam /
vikārāśca kilāṭādyā guravaḥ kuṣṭhahetavaḥ // GarP_1,169.43 //
paraṃ grahaṇīśothārśaḥ pāṇḍvatīsāragulmanut /
tridoṣaśamanaṃ takraṃ kathitaṃ pūrvasūribhiḥ // GarP_1,169.44 //
vṛṣyañca madhuraṃ sarpirvātapittakaphāpaham /
gavyaṃ medhyañca cākṣuṣyaṃ saṃskārācca tridoṣajit // GarP_1,169.45 //
apasmāragadonmādamūrchāghnaṃ saṃskṛtaṅghṛtam /
ajādīnāñca sarpoṣi vidyādgokṣīrasadguṇaiḥ /
kaphavātaharaṃ mūtraṃ sarvakrimiviṣāpaham // GarP_1,169.46 //
pāṇḍutvodarakuṣṭhārśaḥ śothagulmapramehanut /
vātaśleṣmaharaṃ balyaṃ tailaṃ kaśyaṃ tilodbhavam // GarP_1,169.47 //
sārṣapaṃ kṛmipāṇḍughnaṃ kaphamedo 'nilāpaham /
kṣaumaṃ tailamacakṣuṣyaṃ pittahṛdvātanāśanam // GarP_1,169.48 //
akṣajaṃ kaphapittaghnaṃ keśyaṃ tvakśrotratarpaṇam /
tridoṣaghnaṃ madhu proktaṃ vātalañca prakīrtitam // GarP_1,169.49 //
hikkāśvāsakṛmicchardimehatṛṣṇāviṣāmaham /
ikṣavoraktapittaghno balyā vṛṣyāḥ kaphapradāḥ // GarP_1,169.50 //
phāṇitaṃ pittalaṃ tavriṃ surā matsyaṇḍikā laghuḥ /
khaṇḍaṃ vṛṣyaṃ tathā snigdhaṃ svādvasṛkpittavātajit // GarP_1,169.51 //
vātapittaharo rūkṣo vātaghnaḥ kaphakṛdguḍaḥ /
sa pittaghnaḥ paraḥ pathyaḥ purāṇo 'sṛkprasādanaḥ // GarP_1,169.52 //
raktipittaharā vṛṣyā sasnehā gaḍaśarkarā /
sarvapittakaraṃ madyamamlatvātkaphavātajit // GarP_1,169.53 //
raktapittakarāstīkṣṇāstathā sauvīrajātayaḥ /
pācano dīpanaḥ pathyo maṇḍaḥ syādbhṛṣṭataṇḍulaḥ // GarP_1,169.54 //
vātānulomanī laghvī peyā vastiviśodhanī /
satakradāḍimavyoṣā saguḍā madhupippalī // GarP_1,169.55 //
intīyaṃ sukṛtā peyā kāsaśvā sapravāhikāḥ /
pāyasaḥ kaphakṛdbalyaḥ kṛśarā vātanāśinī // GarP_1,169.56 //
sudhautaḥ prastrutaḥ snigdhaḥ sukhoṣṇo laghurocanaḥ /
kandamūlaphalehaiḥ sādhito bṛṃhaṇoguruḥ // GarP_1,169.57 //
īṣaduṣṇasevanācca laghuḥ sūpaḥ susādhitaḥ /
svinna niṣpīḍitaṃ śākaṃ hitaṃ snehādisaṃskṛtam // GarP_1,169.58 //
dāḍimāmalakairyūṣo vahnikṛdvātapittahā /
śvāsakāsapratiśyāyakaphaghno malakaiḥ kṛtaḥ // GarP_1,169.59 //
yavakolakulatthānāṃ yūṣaḥ kaṇṭhyo 'nilāpahaḥ /
mudgāmalakajo grāhī śleṣmapittavināśanaḥ // GarP_1,169.60 //
saguḍaṃ dadhi vātaghnaṃ saktavo rūkṣavātulāḥ /
ghṛtapūrṇo 'gnikārī syādvṛṣyā gurvo ca śaṣkulī // GarP_1,169.61 //
bṛṃhaṇāḥ sāmiṣā bhakṣyapiṣṭa kā gukhaḥ smṛtāḥ /
tailasiddhāśca dṛṣṭighnāstoyasvinnāśca durjarāḥ // GarP_1,169.62 //
atyuṣṇā maṇḍakāḥ pathyāḥ śītalā gukho matāḥ /
anupānañca pānīyaṃ śramatṛṣṇādināśanam // GarP_1,169.63 //
annapānādinā rakṣā kṛtsyādrogavarjitaḥ /
anuṣṇaḥ śikhikaṇṭhābho viṣañcaiva vivarṇakṛt // GarP_1,169.64 //
gandhasparśarasāstīvrābhoktuśca syānmanovyathā /
āghrāṇe cākṣirogaḥ syādasādhyaśca bhiṣagvaraiḥ /
vepathurjṛmbhaṇādyaṃ syādviṣasyaitattu lakṣaṇam // GarP_1,169.65 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe anupānādividhikathanaṃ nāmaikonasaptatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 170
dhanvantariruvāca /
jvaro 'ṣṭadhā pṛthagdvandvasaṃghātāgantujaḥ smṛtaḥ /
mustaparpaṭakośīracandanodīcyanāgaraiḥ /
śṛtaśītaṃ jalaṃ dadyātpipāsājvaraśāntaye // GarP_1,170.1 //
nāgaraṃ devakāṣṭhañca dhānyākaṃ bṛhatīdvayam /
dadyātpācanakaṃ pūrvaṃ jvaritāya jvarāpaham // GarP_1,170.2 //
āragvadhābhayāmustātiktāgranthikanirmitaḥ /
kaṣāyaḥ pācanaḥ sāme saśūle ca jvarehitaḥ // GarP_1,170.3 //
madhūkasārasindhūtthavacoṣaṇakaṇāḥ samāḥ /
ślakṣṇaṃ piṣṭvāmbhasā nasyaṃ kuryātsaṃjñāprabodhanam // GarP_1,170.4 //
trivṛdviśālātriphalākaṭukāragvadhaiḥ kṛtaḥ /
sakṣāro bhedanaḥ kvāthaḥ peyaḥ sarvajvarāpahaḥ // GarP_1,170.5 //
mahauṣadhāmṛtāmustacandanośīradhānyakaiḥ /
kvāthastṛtīyakaṃ hanti śarkarāmadhuyojitaḥ // GarP_1,170.6 //
apāmagajaṭākaṭyāṃ lohitaiḥ saptatantubhiḥ /
baddhvā vāre ravernūnaṃ jvaraṃ hanti tṛtīyakam // GarP_1,170.7 //
gaṅgāyā uttare kūle aputrastāpaso mṛtaḥ /
tasmai tilodakaṃ dadyānmuñcatyaikāhiko jvaraḥ // GarP_1,170.8 //
guḍūcyāḥ kvāthakalkābhyāṃ viphalāvāsakasya ca /
mṛdvīkāyā balāyāśca siddhāḥ snehā jvaracchidaḥ // GarP_1,170.9 //
dhātrīśivākaṇāvahnikvāthaḥ sarvajvarāntakaḥ /
jvarātisāraharaṇamauṣadhaṃ pravadāmyatha // GarP_1,170.10 //
pṛśriparṇobalāvilvanāgarotpaladhānyakaiḥ /
pāṭhendrayavabhūnimbamustaparpaṭakaiḥ śṛtāḥ /
jyantyāmamatīsāraṃ sajvaraṃ samahauṣadhāḥ // GarP_1,170.11 //
nāgarātiviṣāmustabhūnimbāmṛtavatsakaiḥ /
sarvajvaraharaḥ kvathaḥ sarvātīsāranāśanaḥ // GarP_1,170.12 //
mustaparpaṭakadivyaśṛṅgaveraśṛtaṃ payaḥ /
śālaparṇo pṛśriparṇo bṛhatī kaṇṭakārikā // GarP_1,170.13 //
balāśvadaṃṣṭrābilvādi pāṭhānāgaradhānyakam /
etadāhārasaṃyoge hitaṃ sarvātisāriṇām // GarP_1,170.14 //
bilvacūtāsthikvāthaśca khaṇḍaṃ madhvatisāranut /
atisāre hitā tadvatkuṭajatvakkaṇāyutā // GarP_1,170.15 //
vatsakātiviṣāviśvakaṇākandakaṣāyakaḥ /
prayuktaścāmaśūlāḍhye hyatīsāre saśoṇita // GarP_1,170.16 //
cikitsātha grahaṇyāstugrahaṇī cāgrināśinī /
citrakākvāthaklakābhyāṃ grahaṇīghnaṃ kṣṛtaṃ haviḥ /
gulmaśothodaraplīhaśūlārśoghnaṃ pradīpanam // GarP_1,170.17 //
sauvarcalaṃ saindhavañca viḍaṅgaudbhidameva ca /
sāmudreṇa samaṃ pañcalavaṇānyatra yojayet // GarP_1,170.18 //
bheṣajaṃ śastrakṣārāgnyastridhā vai cārśasāṃ haram /
viddhi taccārśasoghnantu yaddhi takraṃ navoddhṛtam // GarP_1,170.19 //
guḍūṭīṃ pippalīyuktāmabhayāṃ ghṛtabharjitām /
trivṛdarśovināśārthaṃ bhakṣayedamlaloṇikām // GarP_1,170.20 //
tilekṣurasasaṃyogaścārśaḥ kuṣṭha vināśanaḥ /
pañcakolaṃ samaricaṃ satryūṣaṇamathāgnikṛt // GarP_1,170.21 //
harītakī bhakṣyamāṇā nāgeraṇa guḍena vā /
saindhavopahitā vāpi sātatyenāgnidīpanī // GarP_1,170.22 //
phalatrikāmṛtāsātiktābhūnimbanimbajaḥ /
kvāthaḥ kṣaudrayuto hanyātpāṇḍurogaṃ sakāmalam // GarP_1,170.23 //
trivṛcca triphalā śyāmā pippalī śarkaga madhu /
modakaḥ sannipātānto raktapittajvarāpahaḥ // GarP_1,170.24 //
vāsāyāṃ vidyamānāyāmāśāyāṃ jīvitasya ca /
raktapittī kṣayī kāsī kimarthamavasīdati // GarP_1,170.25 //
āṭarūpakamṛdvīkāpathyākvāthaḥ saśarkaraḥ /
kṣaudrāḍhyaḥ kāsaniḥ śvāsaraktapittanibarhaṇaḥ // GarP_1,170.26 //
vāsārasaḥ khaṇḍamadhuyutaḥ pīto 'tharaktajit /
sallakībadarījambupriyālāmrārjunaṃ dhavaḥ /
pītaṃ kṣīrañca madhvāḍhyaṃ pṛthakchoṇitavāraṇam // GarP_1,170.27 //
samūlaphalapatrāyā nirguṇḍyāḥ svarasairghṛtam /
siddhaṃ pītvā kṣayakṣīṇī nirvyādirbhāti devavat // GarP_1,170.28 //
harītakī kaṇā śuṇṭhī maricaṃ guḍasaṃyutam /
kāsaghno modakaḥ proktastṛṣṇārocakanāśanaḥ // GarP_1,170.29 //
kaṇṭakāriguḍūcībhyāṃ pṛthaktriṃśatpale rase /
prasthaṃ siddhaṃ ghṛtaṃ syācca kāsanudvahnidāpanam // GarP_1,170.30 //
kṛṣṇā dhātrī śitā śuṇṭhī hakkāghnī madhusaṃyutā /
hikkāśvāsī pivedbhārṅgo saviśvāmuṣṇavāriṇā // GarP_1,170.31 //
tailāktaṃ svarabhede vā khādiraṃ dhārayenmukhe /
pathyāṃ pippalikāyuktāṃ saṃyuktāṃ nāgareṇa vā // GarP_1,170.32 //
viḍaṅgatrilācūrṇaṃ chardihṛnmadhunā saha /
āmrajambūkaṣāyaṃ vā pibonmākṣikasaṃyutam // GarP_1,170.33 //
chardi sarvāṃ praṇudati tṛṣṇāñcaivāpakarṣati /
triphalā bhramamūrchāhṛtpītā sā madhunāpi vā // GarP_1,170.34 //
pañcagavyaṃ hitaṃ pānādapasmāragrahādinut /
kūṣmāṇḍakaraso vājyaṃ sayaṣṭikaṃ tadarthakṛt // GarP_1,170.35 //
brāhmīrasavacākuṣṭhaśaṅkhapuṣpībhireva ca /
purāṇaṃ sevyamunmādagrahāpasmāradghṛnutam // GarP_1,170.36 //
aśvagandhākaṣāye ca kalke kṣīre caturguṇe /
ghṛtapakvantu vātaghnaṃ vṛṣyaṃ māṃ sāya putrakṛt // GarP_1,170.37 //
nīlīmuṇḍīrikācūrṇaṃ madhusarpiḥ samanvitam /
chinnākvāthaṃ pibanhanti vātaraktaṃ sudustaram // GarP_1,170.38 //
saguḍāḥ pañca pathyāśca kuṣṭārśovātasādanāḥ /
gaḍacīsvarasaṃ kalkaṃ cūrṇaṃ vā kvāthameva vā // GarP_1,170.39 //
vātaraktāntakaṃ kālāguḍūcīkvāthakalkataḥ /
kuṣṭhavraṇādiśamanaṃ śṛtamājyaṃ sadugdhakam // GarP_1,170.40 //
triphalāguggulurvātaraktamūrchāpahārakaḥ /
ūrustambhavināśāya gomūtreṇa ca gugguluḥ // GarP_1,170.41 //
śuṇṭhīgokṣurakakvāthaḥ sāmavātārtiśūlanut /
daśamūlāmṛtairaṇḍarāsnānāgaradārubhiḥ // GarP_1,170.42 //
kvātho hanti māhaśothaṃ marīcaguḍasaṃyutaḥ /
kāsaghno modakaḥ proktastṛṣṇārocakanāśanaḥ // GarP_1,170.43 //
kaṇṭakāriguḍūcībhyāṃ pṛthak triṃśatpale rase /
prasthasiddhaṃ ghṛtañcaiva kāsanuddhṛdi dīpanaḥ // GarP_1,170.44 //
kṛṣṇādhātrīsitāśuṇṭhīmarīcasaindhavānvitaḥ /
kvātha eraṇḍatailena sāmaṃ hantyanilaṃ gurum // GarP_1,170.45 //
balā punarnavairaṇḍabṛhatīdvayagokṣuraiḥ /
sahiṅgulavarṇa pītaṃ vātaśūlavimardanam // GarP_1,170.46 //
triphalānimbayaṣṭīkakaṭukāragvadhaiḥ śṛtam /
pāyayenmadhunā miśraṃ dāhaśūlopaśāntaye // GarP_1,170.47 //
triphalāpaḥ sayaṣṭīkāḥ pariṇāmārtināśanāḥ /
gomūtraśuddhamaṇḍūraṃ triphalācūrṇasaṃyutam /
vilihanmadhusarpirbhyāṃ śūlaṃ hanti tridoṣajam // GarP_1,170.48 //
trivṛtkṛṣṇāharītakyo dvicatuṣpañcabhāgikāḥ /
guṭikā guḍatulyāstā viḍvibandhagadāpahāḥ // GarP_1,170.49 //
harītakīyavakṣārapippalītrivṛtastathā /
ghṛtaiścūrṇamidaṃ peyamudāvartāvināśanam // GarP_1,170.50 //
trivṛddharītakīśyāmāḥ snuhīkṣīreṇa bhāvitāḥ /
vaṭikā mūtrapītāstāḥ śreṣṭāścānāhabhedikāḥ // GarP_1,170.51 //
tryūṣaṇatriphalādhanyaviḍaṅgacavyacitrakaiḥ /
kalkīkṛtairghṛtaṃ siddhaṃ saṃskāraṃ vātagulmanut // GarP_1,170.52 //
mūlaṃ nāgaramānītaṃ sakṣīraṃ hṛdayārtinut /
sauvacalaṃ tadardhantu śivānāñca ghṛtaṃ pibet // GarP_1,170.53 //
kaṇāpāṣāṇabhedairvā śilājatukacūrṇakam /
taṇḍulībhirguḍenāpi mūtrakṛcchrīti jīvati // GarP_1,170.54 //
amṛtānāgarīdhātrīvājigandhātrikaṇṭakām /
prapibedvātaregārtaḥ saśūlo mūtrakṛcchravān // GarP_1,170.55 //
sitātulyo yavakṣāraḥ sarvakṛcchranivāraṇaḥ /
nidigdhikāraso vāpi sakṣaudraḥ kṛcchranāśanaḥ // GarP_1,170.56 //
lavaṇaṃ triphalākalkairmūtrāghātaharaṃ smṛtam /
mūtre viruddhe karpūracūrṇaṃ liṅge praveśayet // GarP_1,170.57 //
kvāthaśca śigrumūlotthaḥ kaṭūṣṇośmānipātanaḥ /
sarvamehaharodhātryā rasaḥkṣaudraniśāyutaḥ /
triphalādārudārvyaṣṭakvāthaḥ kṣaudreṇa mehahā // GarP_1,170.58 //
asvapnaṃ ca vyavāyaṃ ca vyāyāmāścintanāni ca /
sthaulyamicchanpaparityaktaṃ krameṇābhipravardhayet // GarP_1,170.59 //
yavaśyāmākabhojī syāsthaulyakṛnmadhuvāriṇā /
uṣṇamannaṃ samaṇḍaṃ vā pibankṛśatanurbhavet // GarP_1,170.60 //
sacavyajīrakaṃ vyoṣā hiṅgusauvarcalāmalāḥ /
madhunā raktavaḥ pītā medhoghnā sarvadīpanāḥ // GarP_1,170.61 //
caturguṇe jale mūtre dviguṇe citrakāṇi ca /
kalkaiḥ siddha ghṛta prasthaṃ sakṣīraṃ jaṭharī pibet // GarP_1,170.62 //
kramavṛddhyā daśāhāni daśa paippālikaṃ dinam /
vardhayetpayasā sārdhaṃ tathaivāpānayetpunaḥ // GarP_1,170.63 //
kṣīraṣaṣṭikabhojīsyādevaṃ kṛṣṇasahasrakam /
bṛṃhaṇaṃ mudgamāyuṣyaṃ plīhodaravināśanam // GarP_1,170.64 //
punarnavākvāthakalkaiḥ siddhaṃ śothaharaṃ ghṛtam /
gāvā matreṇa saṃsevyaṃ pippalī vā payo 'nvitāḥ /
guḍana vābhayāṃ tulyāṃ viśvaṃ vā śotharogiṇā // GarP_1,170.65 //
tailameraṇḍajaṃ pītvā balāsiddhaṃ payo 'nvitam /
ādhmānaśūlopacitāmantravṛddhiñjayennaraḥ // GarP_1,170.66 //
bhraṣṭorucakatailena kalkaḥ pathyāsamudbhavaḥ /
kṛṣṇasaindhavasaṃyukto vaddhirogaharaḥ paraḥ // GarP_1,170.67 //
nirguṇḍīmūlanasyena gaṇḍamālā vinaśyati /
smuhīgaṇḍīrikāsvedo nāśayedarbudāni ca // GarP_1,170.68 //
hastikarṇapalāśasya galagaṇḍaṃ tu lepataḥ /
dhattūrairaṇḍanirguṇḍīvarṣābhūśigrusarṣapaiḥ // GarP_1,170.69 //
pralepaḥślīpadaṃ hanti cirotthamatidāruṇam /
śobhāñjanakasindhṛtthahiṅguṃ vidradhināśanam // GarP_1,170.70 //
śarapuṅkhā madhuyutā yātsarsvavraṇagepaṇī /
nimbapatrasya vālepaḥ śvayathuvraṇagepaṇaḥ // GarP_1,170.71 //
triphalā khadiro dārvo nyagrodho vraṇaśodhanaḥ /
sadyaḥ kṣataṃ vraṇaṃ vaidyaḥ saśūlaṃ pariṣecayet // GarP_1,170.72 //
yaṣṭīmadhukayuktena kiñciduṣṇena sarpiṣā /
buddhvāgantuvraṇānvaidyo ghṛtakṣaudrasamanvitām // GarP_1,170.73 //
śītāṃ kriyāṃ prayuñjīta pittaraktoṣmanāśinīm /
kvātho vaṃśatvageraṇḍaśvadaṃṣṭravanidākṛtaḥ // GarP_1,170.74 //
sahiṅgusaindhavaḥ pītaḥ koṣṭhasthaṃ strāvayedasṛk /
yavakolakulatthānāṃ niḥsnehena rasena vā // GarP_1,170.75 //
bhuñjītānnaṃ yavāgvā vā pivetsaindhavasaṃyutam /
karañjāriṣṭanirguṇḍīraso hanyādvraṇakrimīn // GarP_1,170.76 //
triphalācūrṇasaṃyukto guggulurvaṭakīkṛtaḥ /
niryantraṇo vibandhaghno vradhanagepaṇaḥ // GarP_1,170.77 //
dūrvāsvarasasiddhaṃ vā talaṃ kampillakena vā /
dārvotvacaśca kalkena pradhānaṃ vraṇaropaṇam // GarP_1,170.78 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jvarādicikitsānirūpaṇaṃ nāma saptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 171
dhanvantariruvāca /
nāḍīvraṇādirogāṇāṃ cikitsāṃ śṛṇu suśruta /
nāḍīṃ śastreṇa saṃpāṭya nājīnāṃ vraṇavatkriyā // GarP_1,171.1 //
guggulutriphalāvyopaiḥ samāṃśairājyayojitaiḥ /
nāḍīduṣṭavraṇaṃ śūlaṃ bhagandaramatho jayet // GarP_1,171.2 //
nirguṇḍīrasatastailaṃ nāḍīduṣṭavraṇāpaham /
hitaṃ pāmāmayānāṃ tu pānābhyañjananāvanaiḥ // GarP_1,171.3 //
gaggutriphalākṛṣṇātripañcaikāṃśayojitā /
ghuṭi (guḍi) kāśothagulmārśobhagandaravatāṃ hitā // GarP_1,171.4 //
dhvajamadhye śirāvedhe viśuddhirupadaṃśake /
pāko rakṣyaḥ prayatnena śiśrakṣayakaro hi saḥ // GarP_1,171.5 //
paṭolanimbatriphalāguḍūcīkvāthamāpibet /
sagugguluṃ sakhadiramupadaṃśo vinaśyati // GarP_1,171.6 //
dahetkaṭāhe triphalāṃ sāmasī (ṣī) madhasaṃyutām /
upadaṃśe pralepo 'ya sadyo ropayate vraṇam // GarP_1,171.7 //
triphalānimbabhūnimbakarañjakhadirādibhiḥ /
kalkaiḥ kvāthairghṛtaṃ pakvamupadaṃśaharaṃ param // GarP_1,171.8 //
ādau bhagnaṃ viditvā tu secayecchītalāṃbunā /
pakvenālepanaṃ kāryaṃ bandhanaṃ ca kuśānvitam // GarP_1,171.9 //
māṣaṃ māṃsaṃ tathā sarpiḥ kṣīraṃ yūṣaḥ satījalaḥ /
bṛṃhaṇaṃ cānnapānaṃ syātpradeyaṃ bhagnarogiṇe // GarP_1,171.10 //
rasonamadhunāsājyasitākalkaṃ samaśnutā /
chinnabhinnacyutāsthīnāṃ sandhānamacirādbhavet // GarP_1,171.11 //
aśvatthatriphalāvyoṣāḥ savarabhiḥ samīkṛtaiḥ /
tulyo guggulunā yojyo bhagnasandhiprasādha (kṛt) kaḥ // GarP_1,171.12 //
sarvakuṣṭheṣu vamanaṃ recanaṃ raktamokṣaṇa /
vacāvāsāpaṭolānāṃ nimbasya kalinītvacaḥ // GarP_1,171.13 //
kaṣāyo madhunā pīto vātahṛnmadanānvitaḥ /
virecanaṃ prayoktavyaṃ trivṛtkarṇaphalatrikaiḥ // GarP_1,171.14 //
manaḥ śilāṃmarīcaistu tailaṃ kuṣṭhavināśanam /
sarvakuṣṭhe vilepo 'yaṃ śivāpañcaguḍaudanam // GarP_1,171.15 //
karañjailagajaiḥ kuṣṭhaṃ gomūtreṇa pralepataḥ /
karavīrodvartanaṃ ca tailāktasya ca kuṣṭhahṛt // GarP_1,171.16 //
haridrā malayaṃ rāsnā guḍūcyeḍagajastathā /
āragvadhaḥ karañjaśca lepaḥ kuṣṭhaharaḥ paraḥ // GarP_1,171.17 //
manaḥ śilāviḍaṅgāni vāgajī sarṣapāstathā /
karañjairmūtrapiṣṭo 'yaṃ lepaḥ kuṣṭaharor'kavat // GarP_1,171.18 //
viḍaṅgaiḍavacā kuṣṭhaniśāsindhūtthasarṣapaiḥ /
mūtrāmlapiṣṭo lepo 'yaṃ dadrūkuṣṭavināśanaḥ // GarP_1,171.19 //
prapunnāṭasubījāni dhātrī sarjarasaḥ snuhī /
sauvīrapiṣṭaṃ dadrūṇāmetadudvartanaṃ param // GarP_1,171.20 //
āragvadhasya patrāṇi āranālena peṣayet /
dadrūkiṭṭima (bha) kuṣṭhāni hanti sidhmānameva ca // GarP_1,171.21 //
uṣṇo pītā vāgujī ca kuṣṭhajitkṣīrabhojanaḥ /
tilājyatriphalākṣaudravyoṣabhallātaśarkarāḥ /
vṛṣyāḥ sapta samā medhyāḥ kaṣṭhahāḥ kāmacāriṇaḥ // GarP_1,171.22 //
viḍaṅgatriphalākṛṣṇācūrṇaṃ līḍhaṃ samākṣikam /
hanti kuṣṭhakrimimehanāḍīvraṇabhagandarān // GarP_1,171.23 //
yaḥ khādedabhayāriṣṭamariṣṭāmalakāniśāḥ /
sa jayetsarvakuṣṭhānimāsādūrdhvaṃ na saṃśayaḥ // GarP_1,171.24 //
dahyamānāyutaḥ kumbhe mūlage khadirāṅkuraḥ /
sākṣadhātrīrasaḥ kṣaudro hanyātkuṣṭhaṃ rasāyanam // GarP_1,171.25 //
dhātrī khadirayoḥ kkāthaṃ pītvā vāgajisaṃyutam /
śaṅkhendudhavalaṃ śvitraṃ hanti tūrṇaṃ na saṃśayaḥ // GarP_1,171.26 //
pītvā bhallātakaṃ tailaṃ māsādvyādhiṃ jayennaraḥ /
sevitaṃ khādiraṃ vāri pānādyaiḥ kuṣṭhajidbhavet // GarP_1,171.27 //
bhāvitaṃ malapūkvāthaiḥ somarājīphalaṃ bahu /
karṣaṃ bhakṣedalavaṇo hyakṣaphalguśṛtaṃ pibet // GarP_1,171.28 //
hanti śvitramasādhyaṃ ca lepe yojyāparājitā /
vāsā śuddhā ca triphalā paṭolaṃ ca karañjakam // GarP_1,171.29 //
nimbāśanaṃ kṛṣṇavetraṃ kvāthakalkena yaddhṛtam /
vajrakaṃ tadbhavetkuṣṭhaṃ śatavarṣāṇi jīvati // GarP_1,171.30 //
svarasena ca dūrvāyāḥ pacettailaṃ caturguṇam /
kacchūrvicarcikā pāmā abhyaṅgādeva naśyati // GarP_1,171.31 //
drumatvagarkakuṣṭhāni lavaṇāni ca mūtrakam /
gambhārikācitrakaistaistailaṃ kuṣṭhavraṇādinut // GarP_1,171.32 //
(athāmlapittacikitsā) dhātrīnimbaphalaṃ tadvadgomūtreṇa ca citrakam /
vāsāmṛtāparpaṭikānimbabhūnimbamārkaraiḥ (vaiḥ) /
triphalākulatthaiḥ kvāthaḥ sakṣaudraścāmlapittahā // GarP_1,171.33 //
phalatrikaṃ paṭolaṃ ca tiktakvāthaḥ sitāyutaḥ /
pīto yaṣṭīmadhuyuto jvaracchardyamlapittajit // GarP_1,171.34 //
vāsāghṛtaṃ tiktaghṛtaṃ pippalīghṛtameva ca /
amlapitte prayoktavyaṃ guḍakūṣmāṇḍakaṃ tathā // GarP_1,171.35 //
pippalī madhusaṃyuktā amlapittavināśinī /
śleṣmāgnimāndyanutpathyāpippalīguḍamodakaḥ // GarP_1,171.36 //
piṣṭvājājīṃ sadhanyākāṃ ghṛprasthaṃ vipācayet /
kaphapittāruciharaṃ mandānalavamiṃ haret // GarP_1,171.37 //
(ityamlapittacikitsā) pippalyamṛtabhūnimbavāsakāriṣṭaparpaṭaiḥ /
khadirāriṣṭakaiḥ kvātho visphoṭārtijvarāpahaḥ // GarP_1,171.38 //
triphalārasasaṃyuktaṃ sarpistrivṛtayāsaha /
prayoktavyaṃ virekārthaṃ vīsarpajvaraśāntaye // GarP_1,171.39 //
khādirātriphalāriṣṭapaṭolāmṛtavāsakaiḥ /
kvātho 'ṣṭakākhyo jayati romāntikamasūrikām // GarP_1,171.40 //
kuṣṭhavīsarpavisphoṭakaṇḍvādīnāṃ vighātakaḥ /
laśunānāṃ tu cṛrṇasya gharṣo maśakanāśanaḥ // GarP_1,171.41 //
carmakīlaṃ jarumaṇiṃ maśakāṃstilakālakān /
utkṛtya śastreṇa dahetkṣāgagnibhyāmaśeṣataḥ // GarP_1,171.42 //
paṭolanīlīlepaḥ syājjāla (jvālā) gardabharoganut /
guñjāphalaiḥ śṛtaṃ talaṃ bhṛṅgarājarasena tu /
kaṇṭha (ṇḍu) dāruṇakṛtkuṣṭhavātavyādhivināśanam // GarP_1,171.43 //
arkāsthimajjātriphalānālīchā bhṛṅgarājakam /
jīrṇe pakve lauhacūrṇaṃ kāñjikaṃ kṛṣṇakeśakṛt // GarP_1,171.44 //
kṣīrātsaśarkarasāddviprastho madhukātpale /
tailamya kuḍavaṃ pakvaṃ tannasyaṃ palitāpaham // GarP_1,171.45 //
mukharoge tu triphalāgaṇḍūṣaparidhāraṇam /
gṛhadhūma yavakṣārapāṭhāvyoparasāñjanam // GarP_1,171.46 //
tejodaṃ triphalālodhraṃ citrakaṃ ceti cūrṇitam /
sakṣaudraṃ dhārayedvaktre grīvādantāsyaroganut // GarP_1,171.47 //
paṭola nimbajamvvāgramālatīnavapallavāḥ /
pañcapallavakaḥ śreṣṭhaḥ kaṣayo mukhadhāvane // GarP_1,171.48 //
laśunārdrakaśigrūṇāṃ pārulyā mūlakasya ca /
rudantyāśca rasaḥ śreṣṭhaḥ kaduṣṇaḥ karṇapūraṇe // GarP_1,171.49 //
tīvraśūlottare karṇe saśabde kledavāhini /
bastamūtraṃ kṣipetkoṣṇaṃ saindhavenāvacūrṇitam // GarP_1,171.50 //
jātīpatrarase tailaṃ pakvaṃ pūtikakarṇajit /
śuṇṭhītailaṃ sārṣapaṃ ca kroṣṇaṃ syātkarṇaśūlanut // GarP_1,171.51 //
pañcamūliśṛtaṃ kṣīraṃ syāccitrakaharītakī /
sarpirguḍaḥ ṣaḍaṅgaścayūṣaḥ pīnasaśāntaye // GarP_1,171.52 //
akṣikukṣibhavā rogāḥ pratiśyāyavraṇajvarāḥ /
pañcaite pañcarātreṇa praśamaṃ yānti laṅghanāt // GarP_1,171.53 //
dhātrīrasānāñca dṛśaḥ kopaṃ harati pūraṇāt /
sakṣaudraḥ saindhavo vāpi śigrudārvirasāñjanam // GarP_1,171.54 //
haridrādārusindhūtthapathyājanavagaurikaiḥ /
piṣṭairdatto bahirlapo netravyādhinivārakaḥ // GarP_1,171.55 //
mṛtabhraṣṭābhayālepāttriphalā kṣīrasaṃyutā /
śuṇṭhīnimbadalaiḥ piṣṭaiḥ sukhoṣṇaiḥ svalpasaindhavaiḥ /
dhāryaścakṣuṣi saṃkṣepācchothakaṇḍūrujāpahaḥ // GarP_1,171.56 //
abhayākṣāmṛtaṃ caikadvicaturbhāgikaṃ yutam /
madhvājyalīḍhaṃ kvātho vā sarvanetrarugardanam // GarP_1,171.57 //
candanatriphalāpūgapalāśatarumūlakaiḥ /
jalapiṣṭairiyaṃ virtiraśeṣatimirāpahā // GarP_1,171.58 //
dadhnātighṛṣṭaṃ maricaṃ rātryāndhyāpahamañjanam /
triphalākvāthakalkābhyāṃ sapayaskaṃ śṛtaṃ ghṛtam // GarP_1,171.59 //
timirāṇyacirāddhanyātpītametanniśāmukhe /
pippalītriphalā drākṣālohacūrṇaṃ sasaindhavam // GarP_1,171.60 //
bhṛṅgarājarasairghṛṣṭaṃ ghuṭikāñjanamiṣyate /
āndhyaṃ satimiraṃ kācaṃ hantyanyānnetrarogakān // GarP_1,171.61 //
trikaṭu triphalā nakta saindhavaṃ ca manaḥ śilā /
rucakaṃ śaṅkhanābhiśca jātīpuṣpāṇi nimbakam // GarP_1,171.62 //
rasāñjanaṃ bhṛṅgarājaṃ ghṛtaṃ madhu payastathā /
etatpiṣṭvā ca vaṭikā sarvanetrarugardinī // GarP_1,171.63 //
dagdhameraṇḍakaṃ mūlaṃ lepātkākikapeṣitam /
śiro 'rtiṃ nāśayatyāśu puṣpaṃ vā mucukundaka (ja) m // GarP_1,171.64 //
śatamūlyairaṇḍamūlacakrāvyāghrīpalaiḥ śṛtam /
tailaṃ nasyamaruśleṣmatimirordhvar (ddha) gadāpaham // GarP_1,171.65 //
nācanaṃ (lanaṇaṃ) saguḍaṃ viśvaṃ pippalī vā sasaindhavā /
bhujastambhādirogeṣu sarveṣūrdhvagadeṣu ca // GarP_1,171.66 //
sūryāvarte vidhātavyaṃ nasyakarmādibheṣajam /
daśamūlīkaṣāyaṃ tu sarpiḥ saindhavasaṃyutam /
nasyamaṅgavibhedaghnaṃ sūryāvartaśiro 'rtinut // GarP_1,171.67 //
dadhnā sauvarcalājājīmadhūkaṃ nīlamutpalam /
pibetkṣaudrayutaṃ nārī vātāsṛgdarapīḍitā // GarP_1,171.68 //
vāsakasvarasaṃ paitte guḍūcyā rasameva vā /
jalenāmalakībījaṃ kalkaṃ vāsasitāmadhu // GarP_1,171.69 //
āmalakyā madhurasaṃ mūlaṃ kārpāsameva vā /
pāṇḍupradaraśāntyarthaṃ pibettaṇḍulavāriṇā // GarP_1,171.70 //
taṇḍulīyakamūlaṃ tu sakṣaudre sarasāñjanam /
taṇḍulodakasaṃpītaṃ sarvāṃścāsṛkdarāñjayet /
kuśamūlaṃ taṇḍulādbhiḥ pītaṃ cāsṛkdaraṃ jayet // GarP_1,171.71 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe nāḍīvraṇādicikitsāvarṇanaṃ nāmaikasaptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 172
dhanvantariruvāca /
strīrogādicikitsāṃ ca vakṣye suśruta tacchṛṇu /
yonivyāpatsu bhūyiṣṭaṃ śasyate karma vātajit // GarP_1,172.1 //
vacopakuñcikājātīkṛṣṇāvāsakasaindhavam /
ajamodāyavakṣāraṃ citrakaṃ śarkarānvitam // GarP_1,172.2 //
piṣṭvāloḍya jalādyaiśca khādayeddhṛtabharjitam /
yonipārśvārtihṛdrogagulmārśo vinivartayet // GarP_1,172.3 //
badarīpatrasaṃlepādyonirbhinnā praśāmyati /
lodhratumbīphalālepādyonerdārḍhyaṃ karoti ca // GarP_1,172.4 //
pañcapallavapiṣṭāhvamālatīkusumairghṛtam /
ravipakvamasṛgdhāraṃ yonigandhavināśanam // GarP_1,172.5 //
sakāñjikaṃ japāpuṣpapuṣpaṃ jyotiṣmatīdalam /
dūrvāpiṣṭaṃ ca saṃprāśya citrakaṃ śarkarānvitam // GarP_1,172.6 //
dhātryañjanābhayācūrṇaṃ toyapītaṃ rajo haret /
sadugdhā lakṣmaṇā pītā nasyādvā putradā ṛtau // GarP_1,172.7 //
dugdhasyārdhāḍhakaṃ cājyamaśvagandhā ca putradā /
vandhyā putraṃ labhetpītvā ghṛtena vyopakesaram // GarP_1,172.8 //
kuśakāśorucṛkānāṃ mṛlairgokṣurakasya ca /
śṛtaṃ dugdhaṃ sitāyuktaṃ garbhiṇyāḥ śūlanutparam // GarP_1,172.9 //
pāṭhālāṅgalisiṃhāmyamayūrakūṭajaiḥ pṛthak /
nābhibasti bhagālepātsukhaṃ nārī prasūyate // GarP_1,172.10 //
sūtāyā hṛcchirobastiśūlamarkanda (kvalla) saṃjñitam /
yavakṣāraṃ pibettatra mastu koṣṇodakena vā // GarP_1,172.11 //
daśamūlīkṛtaḥ ktāthaḥ sājyaḥ mūtirujāpahaḥ /
śātilaṇḍulacūrṇaṃ tu sadugdhaṃ dugdhakṛdbhavet // GarP_1,172.12 //
vidārī kandasvarasaṃ mūlaṃ kārpāsajaṃ tathā /
dhātrī stanyaviśuddhyarthaṃ mudgayūparasāśinī // GarP_1,172.13 //
kuṣṭhā vacābhayā brāhmī madhurā kṣaudrasarpiṣā /
varṇāyuḥ kāntijananaṃ lehyaṃ vālamya dāpayet // GarP_1,172.14 //
stanyābhāve payaśchāgaṃ gavyaṃ vā tadguṇaṃ pivet /
svedanaṃ nāgniśophārte mṛdā syādagnitaptayā // GarP_1,172.15 //
leho mustavipāyāśca vamikāsajvare pibet /
sustaśuṇṭhīviṣāvilvakūṭajairatisāranuta // GarP_1,172.16 //
madhu vyoṣaṃ mātuluṅgaṃ hikkācchardinivāraṇam /
kuṣṭhendrayavasiddhārthā niśā dūrvā ca kuṣṭhajit // GarP_1,172.17 //
mahāmuṇjitikojīcyakāthaiḥ snānaṃ grahāpaham /
saptacchadāmayaniśācandanaiścānulepanam // GarP_1,172.18 //
śaṅkhābjabījarudrākṣavacālauhādidhāraṇam /
oṃ kaṃ ṭaṃ yaṃ gaṃ vainateyāya namaḥ /
oṃ hoṃ hāṃ haḥ mantreṇa śāntirvālānāṃ mārjanādvalidānataḥ /
oṃ hrīṃ bālamrahādvaliṃ gṛhṇīta vālaṃ muñcata svāhā // GarP_1,172.19 //
taṇḍulādbhiḥ śirīpasya palaṃ pītaṃ viṣāpaham /
taṇḍulādbhiśca varṣābhvāḥ śuklāyāḥ sarpadaṃśanut // GarP_1,172.20 //
dadhyājyaṃ taṇḍulīyaṃ ca gṛhadhṛmo niśā tathā /
piṣṭaṃ pānaṃ tathā kṣaudraṃ sindhṛtthasya vipāntakam // GarP_1,172.21 //
aṅkoṭamūlaniṣkvāthaḥ sājyaḥ pīto viṣāntakaḥ /
yajjarāvyādhividhvaṃsi bheṣajaṃ tadrasāyanam // GarP_1,172.22 //
sindūtyarārkarāśuṇṭhīkaṇāmadhuguḍaiḥ kramāt /
varṣādiṣvabhayā sevyā rasāyanaguṇauṣiṇā // GarP_1,172.23 //
jvarasyānte 'bhayāṃ caikāṃ prabhuṅkte dve vibhītake /
bhuktvā madhvājyadhātrīṇāṃ catuṣkaṃ śatavarṣakṛt // GarP_1,172.24 //
pītāśvagandhā payasā ghṛtenāśeparoganut /
maṇḍūkaparṇyāḥ svaraso vidāryāścāmṛtopamaḥ // GarP_1,172.25 //
tiladhātrībhṛṅgarājau jagdhvā varṣaśatī bhavet /
trikaṭu triphalā vahnirguḍūcī ca śatāvarī // GarP_1,172.26 //
viḍaṅgalohacūrṇaṃ tu madhunā saha roganut /
triphalā ca kaṇā śuṇṭhī guḍūcī ca śatāvarī // GarP_1,172.27 //
viḍaṅgabhṛṅgarājādi bhāvitaṃ sarvaroganut /
cūrṇaṃ vidāryā madhvājyaṃ līḍhvā daśa striyo vrajet // GarP_1,172.28 //
ghṛtaṃ śatāvarīkalkaiḥ kṣīrairdaśaguṇaiḥ pacet /
śarkarāpippalīkṣaudrayuktaṃ vā jārakaṃ viduḥ // GarP_1,172.29 //
pratimarṣo 'vapīḍaśca nasyaṃ pravapanaṃ tathā /
śirovirecanaṃ ceti pañcakarma ca kathyate // GarP_1,172.30 //
māsairdvisaṃkhyairmāghādyaiḥ kramātṣaḍṛtavaḥ smṛtāḥ /
agnisevāmadhukṣīravikṛtīḥ paripevayet // GarP_1,172.31 //
strīyuktaḥ śiśire tadvadvasante na divā svapet /
tyajedvarṣāsu svapnādīñcharadindośca raśmayaḥ // GarP_1,172.32 //
pathyāni śālayo mudrā varṣāmbhaḥ kvathitaṃ payaḥ /
nimvātasīkusumbhānāṃ śigrusarṣapayostathā // GarP_1,172.33 //
jyotiṣmatīmūlakānāṃ tailāni ca haranti hi /
kṛmikuṣṭhapramehāṃśca vātaśleṣmaśirorujaḥ // GarP_1,172.34 //
dāḍimāmalakīkolakaramardpiyālakam /
jambīraṃ nāgaggaṃ ca āmrātakakapinthakam // GarP_1,172.35 //
pittalānyanilaghnāni kaphotkleśakarāṇica /
jalaṃ jīmūtakekṣvākukuṭajākṛtabandhanam // GarP_1,172.36 //
dhāmārgavaśca saṃyojyāḥ sarvathā vamaneṣvamī /
pūrvāhne vamanāyete madanendrayavī vacā // GarP_1,172.37 //
mṛdukoṣṭaśca pittena kharo vātakaphāśrayāt /
madhyamaḥ samadoṣe syāttrivṛttite virecanam // GarP_1,172.38 //
śarkarāmadhusaṃyuktaṃ saindhavaṃ nagaraṃ trivṛt /
harītakīvihaṅgāni gomūtreṇa virecanam // GarP_1,172.39 //
eraṇḍatailaṃ triphalākvāthaśca dviguṇastathā /
vātolbaṇeṣu doṣeṣu bhojayitvātha vāmayet // GarP_1,172.40 //
vaṃśādinetraṃ kurvīta paḍaṣṭadvādaśāṅgulam /
karkandhṛphalavacchidraṃ vastiruttānaśāyine // GarP_1,172.41 //
nirūhadāne 'pi vidhirayamevamudīritaḥ /
ardhatripaṭpale mātrā laghumadhyottamaḥ kramāt // GarP_1,172.42 //
pathyākṣavātryokadvicaturbhāga rugardanāḥ /
śatavaryasṛtābhṛṅgasindhuvārādibhāvitāḥ // GarP_1,172.43 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe strīrogacikitsādikayanaṃ nāma dvisaptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 173
dhanvantariruvāca /
dravyāṇi madhurādīni vakṣye rāgaharāṇyaham /
śāliṣaṣṭikagodhṛmakṣīraṃ ghṛtaṃ rasā madha // GarP_1,173.1 //
majjāśṛṅgāṭakayavakaśervivārugīkṣuram /
gambhagī pauṣkaraṃ bījaṃ drākṣā kharjūrakaṃ balā // GarP_1,173.2 //
nārikalekṣvātmaṇuptā vidārī ca priyālakam /
madhukaṃ tālakaṣmāṇḍaṃ mukhyo 'yaṃ madhuro gaṇaḥ // GarP_1,173.3 //
mūrchādāhapraśamanaḥ paḍindriyaprasādanaḥ /
kṛmikṛtkaphakṛccaiva eko 'tyartha nipevitaḥ // GarP_1,173.4 //
śvāsakāsāmyamādhuryasvaraghātārvudāni ca /
galagaṇḍaślīpadāni guḍalepādi kārayet // GarP_1,173.5 //
dāḍimāmalakāmraṃ ca kapitthakaramardakau /
mātuluṅgāmrātakaṃ ca badaraṃ tintaḍīphalam // GarP_1,173.6 //
dadhi takraṃ kāñjikaṃ ca lakucaṃ cāmlave tasam /
amlo loṇaḥ śuṇṭhīyukto jāraṇaḥ pācano rasaḥ // GarP_1,173.7 //
kledano vātakṛddhṛpyo vidāhī cānulomanaḥ /
amlo 'tyarthaṃ sevyamānaḥ kuryāddhai dantaharṣakam // GarP_1,173.8 //
śarīrasya ca śaitilyaṃ svarakaṇṭhāsyahṛddahet /
chinnabhinnavraṇādīni pācayitvāgnibhāvitaḥ // GarP_1,173.9 //
lavaṇāni yavakṣārasarjikādiśca lāvaṇaḥ /
śodhanaḥ pācanaḥ kledī viśleṣasarpaṇādikṛt // GarP_1,173.10 //
mārgarodhī mārdavakṛtsa ekaḥ pariṣevitaḥ /
gātrakaṇḍūkoṣṭhaśothavaivarṇyaṃ janayedrasaḥ /
raktavātaṃ pittaraktaṃ puṃstvendriyarujādikam // GarP_1,173.11 //
vyoṣaśigrūmūlakaṃ devadāru ca kuṣṭhakam /
laśunaṃ valgujī phalaṃ mustāguggululāṅgalī // GarP_1,173.12 //
kaṭuko dīpanaḥ śodhī kuṣṭhakaṇḍūkaphāntakṛt /
sthaulyālasyakrimiharaḥ śukramedovirodhanaḥ /
eko 'tyarthaṃ sevyamānaḥ bhramadāhādikṛdbhavet // GarP_1,173.13 //
kṛtamālaḥ kīrāṇi haridrendrayavāstathā /
svādukaṇṭakavetrāṇi bṛhatīdvayaśaṅkhinī // GarP_1,173.14 //
guḍūcī cadravantī ca trivṛnmaṇḍūkaparṇyapi /
kāravellakavārtākukaravīrakavāsakāḥ // GarP_1,173.15 //
rohiṇī śaṅkhacūrṇaṃ ca karkoṭo vai jayantikā /
jātīvāruṇakaṃ nimbo jyotiṣmatī punarnavā // GarP_1,173.16 //
tikto rasaśchedanaḥ syādrocanī dīpanastathā /
śodhano jvaratṛṣṇāghno mūrchākaṇṭhārtikādijit // GarP_1,173.17 //
viṇmūtrakledasaṃśoṣo hyatyarthaṃ sa ca sevitaḥ /
hanustambhākṣepakārtiśiraḥ śūlabraṇādikṛt // GarP_1,173.18 //
triphalāsallakījambu āmrātakavacādikam /
tindukaṃ vakulaṃ śālaṃ pālaṅkīmudgacillakam // GarP_1,173.19 //
kaṣāyo grāhako ropī stambhanakledaśoṣaṇaḥ /
eko 'tyarthaṃ sevyamāno hṛdaye cātha pīḍakaḥ /
mukhaśoṣajvarādhmānamanyāstambhādikārakaḥ // GarP_1,173.20 //
haridrākuṣṭhalavaṇaṃ meṣaśṛṅgibalādvayam /
kacchurā sallakī pāṭhā punarnavā śatāvarī // GarP_1,173.21 //
agni mantho brahmadaṇḍī śvadaṃṣṭrairaṇḍake tathā /
yavakolakulatthādikarṣāśī daśamūlakam /
pṛthak samasto vātātorbahupittaharastathā // GarP_1,173.22 //
śatāvarī vidārī ca bālakośīracandanam /
dūrvā vaṭaḥ pippalī ca badarī sallakī tathā // GarP_1,173.23 //
kadalī cotpalaṃ padmamudumbarapaṭolakan /
atha śleṣmaharo vargo haridrāguḍakuṣṭhakam // GarP_1,173.24 //
śatapuṣpī ca jātī ca vyoṣāragvadhalāṅgalī /
sarpistailavasāmajjāḥ sneheṣu pravaraṃ smṛtam // GarP_1,173.25 //
tathā dhīsmṛtimedhāgnikāṅkṣiṇāṃ śasyate ghṛtam /
kevalaṃ paittike sarpirvātike lavaṇānvitam // GarP_1,173.26 //
deyaṃ bahukaphe vāpi vyoṣakṣārasamāyutam /
granthināḍīkṛmisleṣmamedomārutarogiṣu // GarP_1,173.27 //
tailaṃ lāghavadārḍhyāya krūrakoṣṭheṣu dehiṣu /
vātātapāmbubhārastrīvyāyāmakṣīṇadhātuṣu // GarP_1,173.28 //
rūkṣakleśakṣayātyāgnivātā vṛtapatheṣu /
atha dagdhvā śirājālaṃ yonikarma śiroruji (jam ) // GarP_1,173.29 //
uttamasya palaṃ mātrā tribhiścākṣaiśca madhyame /
jaghanyasya palārdhena snehakvāthauṣadheṣu ca // GarP_1,173.30 //
jalamuṣṇaṃ ghṛte deyaṃ pṛthak taile tu śasyate /
senehe pitte tu tṛṣṇāyāṃ pibeduṣṇodakaṃ naraḥ // GarP_1,173.31 //
vātānulomaṃ dīptāgrarvarcaḥ snigdhasya tanmatam /
rūkṣamya snedṛnaṃ kāryamabhisnigdhasya rūkṣaṇam // GarP_1,173.32 //
śyāmākakoradoṣānnatakrapiṇyākasakubhiḥ /
vātaśleṣmāṇi vāte vā kaphe vā sveda iṣyate /
na svedayedatimthūlarūkṣadurvalamūrchitān // GarP_1,173.33 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe yogasamadivarṇanaṃ nāma trisaptanyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 174
dhanvatariruvāca /
ghṛtatailādi vakṣyāmi śṛṇu suśruta roganut /
śaṅkhapuṣpī vacā somā brāhmī brahmasuvarcalā // GarP_1,174.1 //
abhayā ca guḍūcī ca aṭarūpakavāgujī /
etairakṣasamairbhāgairghṛtaprasthaṃ vipācayet // GarP_1,174.2 //
kaṇṭakāryā rasaprasthakṣīraprasthamamanvitam /
etadbrāhmīghṛtaṃ nāma śrutimedhākaraṃ param // GarP_1,174.3 //
triphalācitrakabalānirguṇḍī nimbavāsakāḥ /
punarnavā guḍūcī ca bṛhatī ca śatāvarī // GarP_1,174.4 //
etairghṛtaṃ yathālābhaṃ sarvarogavimardanam /
balāśatakaṣāye tu tailasyārdhāḍhakaṃ pacet /
kalkairmadhūkamañjiṣṭhācandanotpalapadmakaiḥ // GarP_1,174.5 //
sūkṣmailāpippalīkuṣṭhatvagelāgurukesaraiḥ /
gandhāśvajīvanīyaiśca kṣīrāḍhakasamāśritam // GarP_1,174.6 //
etanmṛdvagninā pakvaṃ sthāpayedrājate śubhe /
sarvavātavikārāṃstu sarvadhātvantarāśrayān // GarP_1,174.7 //
tailametatpraśamayedvalyākyaṃ rājavallabham /
śatāvarīrasaprasthaṃ kṣīraprasthaṃ tathaiva ca // GarP_1,174.8 //
śatapuṣpaṃ devadāru māṃsī śaileyakaṃ balā /
candanaṃ tagaraṃ kuṣṭaṃ manaḥ śilā jyotiṣmatī // GarP_1,174.9 //
etaiḥ karṣasamaiḥ kalkaiḥ ghṛtaprasthaṃ vipācayet /
kuvjavāmanapaṅgūnāṃ badhiravyaṅgakuṣṭhinām // GarP_1,174.10 //
vāyunā bhagnagātrāṇāṃ ye ca sīdanti maithune /
jarājarjaragātrāṇāṃ cādhmānamukha śoṣiṇām // GarP_1,174.11 //
tvaggatāścāpi ye vātā śirāsnāyugatāśca ye /
sarvāṃstānnāśayatyāśu tailaṃ rogakulāntakam // GarP_1,174.12 //
nārāyaṇamidaṃ tailaṃ viṣṇunoktaṃ rugardanam /
pṛthaktailaṃ ghṛtaṃ kuryātsamastairauṣadhaiḥ pṛthak // GarP_1,174.13 //
śatāvaryā guḍūcyā vā citrakai gocanānvitaiḥ /
nirguṇḍyā vā prasāraḥ syātkaṇṭakāryā rasādibhiḥ // GarP_1,174.14 //
varṣābhūvālayā vāpi vāsakana phalatrikaiḥ /
brāhayā caigṇḍakenāpi bhṛṅgarājena kuṣṭinā // GarP_1,174.15 //
musalyā daśamūlena khadireṇa vaṭādibhiḥ /
vaṭikā modako vāpi cūrṇa syātsarvaroganut // GarP_1,174.16 //
ghṛtena madhunā vāpi adbhiḥ khaṇḍaguḍādibhiḥ /
lavaṇaiḥ kaṭukairyuktaṃ yathālābhaṃ ca geganut // GarP_1,174.17 //
citrakārkatrivṛdvāpi yavānīhayamārakam /
sudhāṃ ca bālāṃ gaṇikāṃ saptaparṇasuvarcikām // GarP_1,174.18 //
jyotiṣmatīñca saṃbhṛtya tailaṃ dhīro vipācayet /
etanniṣyandanaṃ tailaṃ bhṛśaṃ dadyādbhagandare // GarP_1,174.19 //
śodhanaṃ gepaṇaṃ caiva sarvavarṇakaraṃ param /
citrakādyaṃ mahātailaṃ sarvarogaprabhañjanam // GarP_1,174.20 //
ajamodaṃ sasindūraṃ haritālaṃ niśādvayam /
kṣāradvayaṃ phenayutamārdraka sara (śavaḥ lodbhavam // GarP_1,174.21 //
indravāruṇyapāmārgakadalaiḥ syandanaiḥ samam /
ebhiḥ sarṣapajaṃ tailamajāmūtraiścayojitam // GarP_1,174.22 //
mṛdvagninā pacedetgavyakṣīreṇa saṃyutam /
ajamodādikaṃ tailaṃ gaṇḍamālāṃ vyapohati // GarP_1,174.23 //
vidagdhastu pacetpakvaṃ caiva viśodhayet /
ropaṇaṃ mṛdubhāvaṃ ca tailenānena kārayet // GarP_1,174.24 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe brāhmīghṛtādivarṇanaṃ nāma catuḥ saptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 175
rudra uvāca /
evaṃ dhanvantarirviṣṇuḥ suśrutādīnuvāca ha /
hariḥ punarharāyāha nānāyogānrugardanān // GarP_1,175.1 //
hariruvāca /
sarvajvareṣu prathamaṃ kāryaṃ śaṅkara laṅghanam /
kvathitodakapānaṃ ca tathā nirvātasevanam // GarP_1,175.2 //
agnisvedājjvarāstvevaṃ nāśamāyāntihīśvara /
vātajvaraharaḥ kvātho guḍūcyā mustakena ca // GarP_1,175.3 //
durālabhaiścaiva ghṛtaṃ pittajvaraharaḥ śṛṇu /
śuṇṭhīparpaṭamustaiśca bālakośīracandanaiḥ // GarP_1,175.4 //
sājyaḥ kvāthaḥ śleṣmajaṃ tu saśuṇṭhiḥ sadurālabhaḥ /
savālakaḥ sarvajjvaraṃ saśuṇṭhiḥ sahaparpaṭaḥ // GarP_1,175.5 //
kirātatiktairnārīguḍūcīśuṇṭhimustakaiḥ /
pittajvaraharaḥ syācca śṛṇvanyaṃ yogamuttamam // GarP_1,175.6 //
vālakośīrapāṭhābhiḥ kaṇṭakārikamustakaiḥ /
jvaranucca kṛtaḥ kvāthastathā vai suradāruṇā // GarP_1,175.7 //
dhanyākanimbamustānāṃ samadhuḥ sa tu śaṅkara /
paṭolapatrayuktastu guḍūcītriphalāyutaḥ // GarP_1,175.8 //
pīto 'khilajvaraharaḥ kṣudhākṛdvātanuttvidam /
harītakīpiplīnāmāmalīcitrakodbhavam // GarP_1,175.9 //
cūrṇaṃ jvaraṃ ca kvathitaṃ dhānya (dhanyā) kośīrapaparpaṭaiḥ /
āmalakyā guḍūcyā ca madhuyuktaṃ sacandanam // GarP_1,175.10 //
samastajvaranucca syātsannipātaharaṃ śṛṇu /
haridrānimbatriphalāmustakairdevadāruṇā // GarP_1,175.11 //
kaṣāyaṃ kaṭurohiṇyā sapaṭolaṃ sapatrakam /
tridoṣajvaranuccasyātpītaṃ tu kvathitaṃ jalam // GarP_1,175.12 //
kaṇṭakāryā nāgarasya guḍūcyā puṣkareṇa ca /
jagdhvā nāgabalācūrṇaṃ śvasakāsādinudbhavet // GarP_1,175.13 //
kaphavātajvare deyaṃ jalamuṣṇaṃ pipāsine /
viśvaparpaṭakośīramustacandanasādhitam // GarP_1,175.14 //
dadyātsuśītalaṃ vāri tṛṭchardijvaradāhanut /
bilvādipa pañcamūlasya kvāthaḥ syādvātike jvare // GarP_1,175.15 //
pācanaṃ pippalīmūlaṃ guḍṛcīviśvabheṣajam /
vātajvare tvayaṃ kvātho dattaḥ śāntikaraḥ paraḥ // GarP_1,175.16 //
pittajvaraghnaḥ samadhuḥ kvāthaḥ parpaṭanimbayoḥ /
vidhāne kriyamāṇe 'pi ysaya saṃjñā na jāyate // GarP_1,175.17 //
pādayostu lalāṭe vā dahellauhaśalākayā /
tiktā pāṭhā parpaṭāśca viśālā triphalā trivṛt /
sakṣīro bhedanaḥ kvāthaḥ sarvajvaraviśodhanaḥ // GarP_1,175.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe jvaraharanānāyogādivarṇanaṃ nāma pañcasaptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 176
śrībhagavānuvāca /
saptarātrātprajāyante khalvāṭasya kacāḥ śubhāḥ /
dagdhahastidantalepātsājākṣīrarasāñjanāt // GarP_1,176.1 //
bhṛṅgarājarasenaiva caturbhāgena sādhitam /
keśavṛddhikaraṃ tailaṃ guñjācūrṇānvitena ca // GarP_1,176.2 //
elāmāṃsīkuṣṭhamurāyuktamabhyaṅgataḥ śivam /
guñjāphalaṃ samādeyaṃ lepanaṃ candraluptanut // GarP_1,176.3 //
āmrāsthicūrṇalepādvai keśāḥ sūkṣmā bhavanti ca /
karañjāmalakailālalākṣālepo 'ruṇāpahaḥ // GarP_1,176.4 //
āmrāsthimajjāmalakalepātkeśā bhavanti vai /
baddhamūlā ghanā dīrghāḥ snagdhāḥ syurnotpatanti ca // GarP_1,176.5 //
viḍaṅgagandhapāṣāṇasādhitaṃ tailamuttamam /
sacaturguṇagomūtraṃ manasaḥ śilameva vā // GarP_1,176.6 //
śiro 'bhyaṅgācchirājanmayūkālikhyāḥ kṣayaṃ nayet /
navadagdhaṃ śaṅkhacūrṇaṃ ghṛṣṭasīsakalepitam // GarP_1,176.7 //
kacāḥ ślakṣṇā mahākṛṣṇā bhavanti vṛṣabhadhvaja /
bhṛṅgarājaṃ lohacūrṇaṃ triphalā bījapūrakam // GarP_1,176.8 //
nīlī ca karavīraṃ ca guḍametaiḥ samaṃ śṛtam /
palitānīha kṛṣṇāni kuryāllepānmahauṣadham // GarP_1,176.9 //
āmrāsthimajjā triphalā nī (tā) lī ca bhṛṅga rājakam /
jīrṇaṃ pakvaṃ lohacūrṇaṃ kāñjikaṃ kṛṣṇakeśakṛt // GarP_1,176.10 //
cakramardakabījāni kuṣṭhameraṇḍamūlakam /
atyamlakāñjikaṃ piṣṭvā lepānmastakaroganut // GarP_1,176.11 //
saindhavaṃ ca vacā hiṅgu kuṣṭhaṃ nāgeśvaraṃ tathā /
śatapuṣpā devadāru ebhistailaṃ tu sādhitam // GarP_1,176.12 //
gopurīparasenaiva caturbhāgena saṃyutam /
tatkaṇabharaṇādugrakarṇaśūlaṃ kṣayaṃ nayet // GarP_1,176.13 //
meṣamūtrasaindhavābhyāṃ karṇayorbharaṇācchiva /
karṇayoḥ pūtināśaḥ syātkṛmistrāvādikasya ca // GarP_1,176.14 //
mālatīpuppadalayo rasena bharaṇāttathā /
gojalenaiva pūreṇa pūyastrāvo vinaśyati // GarP_1,176.15 //
kaṣṭhamāṣamarīcāni tagaraṃ madhu pippalī /
apāmārgo 'śvagandhā ca bṛhatī sitasarṣapāḥ // GarP_1,176.16 //
yavāstilāḥ saindhavaṃ ca pādikodvartanaṃ śubham /
liṅgabāhustanānāṃ ca karṇayorvṛddhikṛdbhavet /
kaṭutailaṃ bhallātakaṃ bṛhatī phaladāḍimam // GarP_1,176.17 //
valkalaiḥ sādhitairliptaṃ liṅgaṃ tena vivardhate // GarP_1,176.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe keśotpattyādivarṇanaṃ nāma ṣaṭsaptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 177
hariruvāca /
sobhāñjanapatrarasaṃ madhuyuktaṃ hi cakṣuṣoḥ /
bha (ca) raṇādrogaharaṇaṃ bhavennāstyatra saṃśayaḥ // GarP_1,177.1 //
aśītitilapuṣpāṇi jātyāśca kusumāpi ca /
uṣānimbāmalāśuṇṭhīpippalītaṇḍulīyakam // GarP_1,177.2 //
chāyāsuṣkāṃ vaṭīṃ kuryātpiṣṭvā taṇḍulavāriṇā /
madhunā sahasā cākṣṇorañjanāttimirādinut // GarP_1,177.3 //
bibhītakāsthimajjā tu śaṅkhanābhirmanaḥ śilā /
nimbapatramarīcā ni ajāmūtreṇa peṣayet // GarP_1,177.4 //
puṣpaṃ rātryandhatāṃ hanti timiraṃ paṭalaṃ tathā /
caturbhāgāni śaṅkhasya tadardhena manaḥ śilā // GarP_1,177.5 //
saindhavaṃ ca tadardhenatvetatpiṣṭvādakena tu /
chāyāśuṣkāṃ tu vaṭikāṃ kṛtvā nayanamañjayet // GarP_1,177.6 //
timiraṃ paṭalaṃ hanti piciṭaṃ ca mahauṣadham /
trikaṭu triphalāṃ caiva karaṃ jasya phalāni ca // GarP_1,177.7 //
saindhavaṃ rajanīdve va bhṛṅgarājarasena hi /
piṣṭvā tadañjanādeva timirādivināśanam // GarP_1,177.8 //
āṭarūṣakamūlaṃ tu kāñjikāpiṣṭameva tu /
tenākṣibūmilepācca cakṣuḥ śūlaṃ vinaśyati // GarP_1,177.9 //
satakraṃ badarīmūlaṃ pītaṃ vākṣivyathāṃ haret /
saindhaṃvaṃ kaṭutailaṃ ca apāmārgasya mūlakam // GarP_1,177.10 //
kṣīrakāñjikasaṃghṛṣṭaṃ tāmrapātre tu tena ca /
añjanātpiñjaṭasyaiva nāśo bhavati śaṅkara // GarP_1,177.11 //
oṃ dadru sara kroṃ hrīṃ ṭhaḥ ṭhaḥ dadru sara hrīṃ hrīṃ oṃ uṃ ū sara krīṃ krīṃ ṭhaḥ ṭhaḥ /
ādyā hi vaśāmāyānti mantreṇānena cāñjanāt // GarP_1,177.12 //
bilvakanīlikāmūlaṃ piṣṭamabhyañjanena ca /
anenāñjitamātreṇa naśyanti timirāṇi hi // GarP_1,177.13 //
kaṭukaṃ (pippalī) tagaraṃ caiva haridrāmalakaṃ vacā /
khadirapiṣṭavāttaśca añjanānnetraroganut // GarP_1,177.14 //
nīrapūrṇamukho dhauti bṛhanmānena yo 'kṣiṇī /
prabhāte netrarogaiśca nityaṃ sarvaiḥ pramucyate // GarP_1,177.15 //
śuklairaṇḍasya mūlena patreṇāpi prasādhitam /
chagadagdhasekamauṣṇyāccakṣuṣorvātaśalanat // GarP_1,177.16 //
candanaṃ saindhavaṃ vṛddhapālāśaśca harītakī /
paṭalaṃ kusumaṃ nīlī ca (va) krikāṃ harate 'ñjanam // GarP_1,177.17 //
guñjāmūlaṃ chāgamūtre ghṛṣṭaṃ timiranucca tat raupyatāmrasuvarṇānāṃ hastaghṛṣṭaśalākayā // GarP_1,177.18 //
ghṛṣṭamudvartanaṃ rudra kāmalāvyādhināśanam /
ghoṣāphalamapāghrātaṃ pītakāmalanāśanam // GarP_1,177.19 //
dūrvādāḍimapuṣpaṃ tu alaktakaharītakī /
nāsārśavātaraktanunnasyādvai svarasena hi // GarP_1,177.20 //
āpiṣṭvā jāṅgalī mū (tū) laṃ tadrasena vṛṣadhvaja /
nasyādārādvinaśyeta nāśārśo nīlalohita // GarP_1,177.21 //
gavyaṃ ghṛtaṃ sarjarasaṃ rudra dhanyākasaindhavam /
dhuttūrakaṃ gairikaṃ ca etaiḥ sādhitasikthakam // GarP_1,177.22 //
satailaṃ vraṇanutsyācca sphuṭitoddhaṭitādhare /
jātīpatraṃ ca carvitvā vidhṛtaṃ mukharoganut // GarP_1,177.23 //
bhakṣātkesarabījasya dantāḥ syuścalitāḥsthirāḥ /
muṣṭakaṃ kuṣṭhamelā ca yaṣṭikaṃ madhuvālakam // GarP_1,177.24 //
dhanyākametadadanānmukhadurgandhanuddhara /
kaṣāyaṃ kaṭukaṃ vāpi tiktaśākasya bhakṣaṇāt // GarP_1,177.25 //
talayuktasya nityaṃ syānmukhadurgandhatākṣayaḥ /
dantavraṇāni sarvāṇi kṣayaṃ gacchantyanena tu // GarP_1,177.26 //
kāñjikasya satailasya gaṇḍūṣakavalāsthitiḥ /
tāmbūlacūrṇadagdhasya mukhasya vyādhinucchiva ! // GarP_1,177.27 //
parityaktaśleṣmaṇaśca śuṇṭhīcarvaṇato yathā /
mātuluṅgadalānyelā yaṣṭī madhu ca pippalī // GarP_1,177.28 //
jātīpatramathaiṣāṃ ca cūrṇaṃ līḍhvā tathā kṛtam /
śephālikajaṭāyāśca carvaṇaṃ galaśuṇṭhinut // GarP_1,177.29 //
nāsāśirāraktakarṣānnaśyecchaṃśakara jihvikā /
rasaḥ śirīṣabījānāṃ haridrāyāścaturguṇaḥ // GarP_1,177.30 //
tena pakvena bhūteśa nasyaṃ mastakaroganut /
galarogā vinaśyanti nasyamātreṇa tatkṣaṇāt // GarP_1,177.31 //
dantakīṭavināśaḥ myādguñjāmūlasya carvaṇāt /
kākajaṅghāsnuhīnīlīkavāyo madhumojitaḥ // GarP_1,177.32 //
dantākrāntāndantajāṃśca kṛmīnnāśayate śiva /
ghataṃ karkaṭapādena dugdhonmiśreṇa sādhitam // GarP_1,177.33 //
tena cāmyaṅgitādantāḥ kuryuḥ kaṭakaṭānna hi /
liptvā karkaṭapādena kevalenāthavāśiva // GarP_1,177.34 //
trisaptāhaṃ vāḥ piṣṭāni jyotiṣmatyāḥ phalāni hi /
śuklābhayāmajjalepāddantasyāṅkakalaṅkanut // GarP_1,177.35 //
lodhrakuṅkumamañjiṣṭhālohakā leyakāni ca /
yavataṇḍulametaiśca yaṣṭī madhusamanvitaiḥ // GarP_1,177.36 //
vāripiṣṭairvaktralepaḥ strīṇāṃ śobhanavaktrakṛt /
dvibhāgaṃ chāgadugdhena tailaprasthaṃ tu sādhitam // GarP_1,177.37 //
raktavandanamañjiṣṭhālakṣāṇāṃ karṣakeṇa vā /
yaṣṭīmadhukuṅkumābhyāṃ saptāhānmukhakāntikṛt // GarP_1,177.38 //
śuṇṭhīpippalicūrṇaṃ tu guḍūcī kaṇṭakārikā /
ebhiśca kvathitaṃ vāri pītaṃ cāgniṃ karoti vai // GarP_1,177.39 //
vātaśūlakṣayaṃ caiva kageti prathameśvara /
karañjaparpaṭośīraṃ bahatī kaṭurohiṇī // GarP_1,177.40 //
gokṣuraṃ kvathitaṃ tvabhirvāri pītaṃ śramāpahan /
dāhaṃ pittaṃ jvaraṃ śoṣaṃ mūrchāṃ caiva kṣayaṃ nayet // GarP_1,177.41 //
madhvājyapippalīcūrṇaṃ kvathitaṃ kṣīrasaṃyutam /
pītaṃ hṛdrogakāsasya viṣamajvaranudbhavet // GarP_1,177.42 //
kvāthaupadhīnāṃ sarvāsāṃ karṣārdhaṃ grāhyameva ca /
vayo 'nurūyato jñeyo viśeṣo vṛṣabhadhvaja // GarP_1,177.43 //
dugdhaṃ pītaṃ tu saṃyuktaṃ gopurīṣarasena ca /
viṣamajvaranutsyācca kākajandhārasastathā // GarP_1,177.44 //
maśuṇṭhi kvathitaṃ kṣīgmajāyā jvaranudbhavet /
yaṣṭīmadhukamustaṃ ca saindhavaṃ bṛhatīphalam // GarP_1,177.45 //
etairnasvapridānācca nidrā syātpurupasya ca /
marīcapradhvaśvalālānasyānnidrā bhavecchiva // GarP_1,177.46 //
mūlaṃ tu kākajaṅghāyā nidrākṛtsyācchirasthitam /
siddhaṃ tailaṃ kāñjikena tathā sarjarasena ca // GarP_1,177.47 //
śītodakasamāyuktaṃ lepātsantāpanāśanam /
śoṇitajvaradāhebhyo jātasantāpanuttathā // GarP_1,177.48 //
śṛkaśaivālamanthaśca śuṇṭhīpāpāṇabhedakam /
śauvāñjanaṃ gokṣuraṃ vā varuṇacchannameva ca // GarP_1,177.49 //
saubhāñjanasya mūlaṃ ca etaiḥ kvathitavāri ca /
dattvā hiṅguyavakṣāraṃ pītaṃ vātavināśanam // GarP_1,177.50 //
pippalī pippalīmūlaṃ tathā bhallātakaṃ śiva /
vāryetaiḥ kvathitaṃ pītaṃ varaśūlāpahārakṛt // GarP_1,177.51 //
aśvagandhāmūlakābhyāṃ siddhā valmīkamṛttikā /
etayā mardanādrudra ūrustambhaḥ praśāmyati // GarP_1,177.52 //
bṛhatīkasya vai mūlaṃ saṃpiṣṭamudakena ca /
pītaṃ saṃghātavātasya vipāṭanakṛdeva ca // GarP_1,177.53 //
pītaṃ takreṇa mūlaṃ ca ārdrasya tagarasya ca /
haret jhiñjinīvātaṃ?vai vṛkṣamindrāśaniryathā // GarP_1,177.54 //
asthisaṃhāramekena bhaktena saha vāditam /
patiṃ māṃsarasenāpi vātanuccāsthibhaṅganut // GarP_1,177.55 //
ghṛtaliptaṃ saśuṣkaṃ ca chāgīkṣīreṇa saṃyutam /
tallopātpādayārnaṃśyetsakṣepye cātra saṃśayaḥ // GarP_1,177.56 //
madhvājyasaindhavaṃ sikthaṃ guḍakairikaguggulaiḥ /
sasarjarasasphuṭitaḥ klomaśuddhiśca lepanāt // GarP_1,177.57 //
kaṭutailena lipto vai vidhūmāgnau pratāpitaḥ /
mṛttikārakhāditaḥ pādaḥ samaḥ syādvṛṣabhadhvaja // GarP_1,177.58 //
sarjarasāḥ sikthakaṃ ca jīrakaṃ ca harītakī /
utsādhitaghṛtābhyaṅgo hyagnidagdhavyathāpanut // GarP_1,177.59 //
tilatailaṃ cāgnidagdhaṃ yavabhasmasamanvitam /
agnidagdhavraṇaṃ naśyedbrahuśaḥ kṛtalepataḥ // GarP_1,177.60 //
navanītaṃ māhiṣaṃ ca dagdhapiṣṭatilāni ca /
sabhallākaṃ vraṇaṃ naśyeddhṛcchūlaṃ nasyalepanāt // GarP_1,177.61 //
karpūragavyasarpirbhyāṃ prahāraḥ pūrito hara /
śastrodbhavaḥ sabaddhaśca śuklavarṇena śaṅkara ! /
pākaṃ ca vedanāṃ caiva saṃspṛśedvṛṣabhadhvaja // GarP_1,177.62 //
āmra (tasya) mūlarasenaiva śastraghātaḥ prapūritaḥ /
ḍhaukate śastraghātābhyāṃ nirvraṇo ghṛpūritaḥ // GarP_1,177.63 //
śarapuṅkhā lajjālukā pāṭhā caiṣāṃ tu mūlakam /
jalapiṣṭaṃ tasya lepācchastraghātaḥ praśāmyati // GarP_1,177.64 //
mūlaṃ ca kākajaṅghāyāstrirātreṇaiva śoṣitaḥ /
pākapūtiṃ vedanāṃ ca hanti vai rohito vraṇe // GarP_1,177.65 //
sajalaṃ tilatailaṃ ca apāmārgasya mūlakam /
tatsekadānānnaśyecca prahārodbhavavedanā // GarP_1,177.66 //
abhayāṃ saindhavaṃ śuṇṭhīmetatpiṣṭvodakena tu /
bhakṣayitvā hyajīrṇasya nāśo bhavati śaṅkara ! // GarP_1,177.67 //
kaṭibaddhaṃ nimbamūlamakṣisūlaharaṃ bhavet /
śaṇamūlaṃ satāmbūlaṃ dagdhamindriyakasya (lpa) hṛt // GarP_1,177.68 //
annasvinnaharidrā ca śvetasarṣapamūlakam /
bījāni mātuluṅgasya eṣāmudvartanaṃ samam /
saptarātraprayogeṇa śubhadehakaraṃ bhavet // GarP_1,177.69 //
śvetāparājitāpatraṃ nimbapatrarasena tu /
nasyadānāḍḍākinīnāṃ mātṝṇāṃ brahmarakṣasām /
mokṣaḥ syānmadhusāreṇa nasyācca vṛṣabhadhvaja // GarP_1,177.70 //
mūlaṃ śvetajayantyāśca puṣyarkṣe tu samāhṛtam /
śvetāparājitārkasya citrakasya ca mūlakam /
kṛtvā tu vaṭikāṃ nārī tilakena vaśī bhavet // GarP_1,177.71 //
pippalīlohacūrṇaṃ tu śuṇṭhīścāmalakāni ca /
samāni rudra jānīyātsaindhavaṃ madhuśarkarā // GarP_1,177.72 //
udumbarapramāṇena saptāhaṃ bhakṣaṇātsamam /
pumāṃśca balavānsa syājjīvedvarṣaśatadvayam /
oṃ ṭha ṭha ṭha iti sarvavaśyaprayogeṣu prayuktaḥ sarvakāmakṛt // GarP_1,177.73 //
saṃgṛhya vidvānkākasya nilayaṃ pradahecca tat /
citāgnau bhasma tacchatrordattaṃ śirasi śaṅkara // GarP_1,177.74 //
tamuccāṭayate rudra śṛṇu tadyogamuttamam /
niḥ kṣiptaṃ ca purīṣaṃ vai vanamūṣikacarmaṇi // GarP_1,177.75 //
kaṭitantunibaddhaṃ vai kuryānmalanirodhanam /
kṛṣṇakākasya raktena yasya nāma pralipya ca // GarP_1,177.76 //
cyutadale madhyamadhye tato niḥ kṣipyate hara ! /
sa khādyate kākavṛndairnārī puruṣa eva ca // GarP_1,177.77 //
śarkarāmadhvajākṣīraṃ tilagokṣurakaṃ samam /
sa śatruṃ nāśayedrudra ! uccāṭitamidaṃ hara ! // GarP_1,177.78 //
ulūkakṛṣṇakākasya bilvasyātha samicchatam /
rudhireṇa samāyuktaṃ yayornāmnā tu hūyate /
tayormadhye mahāvairaṃ bhavennāstyatra saṃśayaḥ // GarP_1,177.79 //
bhāvitaṃ ṛkṣadugdhena matsyasya rohitasya ca /
māṃsaṃ tatsādhitaṃ tailaṃ tadabhyaṅgācca roganut /
candanodakanasyāttu romotthānaṃ bhavetpunaḥ // GarP_1,177.80 //
haste lāṅgalikākandaṃ gṛhītaṃ tena lepitam /
śarīraṃ yena sa pumānvṛddherdarpaṃ vyapohati // GarP_1,177.81 //
mayūrarudhireṇaiva jīvaṃ saṃharate śiva /
jvalatāṃ tu bhujaṅgānāṃ bilasthānāmapīśvara // GarP_1,177.82 //
dehaścitāgnau dagdhaśca sarpasyājagarasya hi /
tadbhasma saṃmukhe kṣiptaṃ śatraṇāṃ bhaṅgakṛdbhavet // GarP_1,177.83 //
mantreṇānena tatkṣiptaṃ mahābhaṅgakaraṃ ripoḥ /
oṃ ṭha ṭha ṭha cāhīhicāhīhi svāhā /
oṃ udaraṃ pāhihi pāhihisvāhā // GarP_1,177.84 //
sudarśanāyā malaṃ tu puṣyarkṣe tu samāhṛtam /
niḥ kṣiptaṃ gṛhamadhye tu bhujaṅgā varjayanti tat // GarP_1,177.85 //
arkamūlena raviṇā arkāgnijvalitā śiva /
yuktā siddhārthatailena vartirmārgāhināśinī // GarP_1,177.86 //
mārjārapalalaṃ viṣṭhā haritālaṃ ca bhāvitam /
chāga mūtreṇa tallipto mūṣiko mūṣikānharet // GarP_1,177.87 //
mukto hi mandire rudra nātra kāryā vicāraṇā /
viphalārjunapuṣpāṇi bhallātakaśirīṣakam // GarP_1,177.88 //
lākṣā sarjarasaścaiva viḍaṅgaścaiva gugguluḥ /
etairdhūpo makṣikāṇāṃ maśakāṇāṃ vināśanaḥ // GarP_1,177.89 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe netrāñjanādinirūpaṇaṃ nāma saptasaptatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 178
hariruvāca /
brahmadaṇḍīvacākuṣṭhaṃ priyaṅgarnāgakeśaram /
dadyāttāmbūlasaṃyuktaṃ strīṇāṃ mantreṇa tadvaśam /
oṃ nārāyaṇyai svāhā // GarP_1,178.1 //
tāmbūlaṃ yasya dīyeta sa vaśī syātsumantrataḥ /
oṃ hariḥ hariḥ svāhā // GarP_1,178.2 //
godantaṃ haritālañca saṃyuktaṃ kākajihvayā /
cūrṇokṛtya yasya śire dīyate sa vaśī bhavet /
śvetasarṣapanirmālyaṃ yadgṛhe tadvināśakṛt // GarP_1,178.3 //
vaibhī takaṃ śākhoṭakaṃ mūlaṃ patreṇa saṃyutam /
sthāpyate yadgṛhadvāre tatra vai kalaho bhavet // GarP_1,178.4 //
khañjarīṭasya māṃsaṃ tu madhunā saha peṣayet /
ṛtukāleyonilepātpuruṣo dāsatāmiyāt // GarP_1,178.5 //
aguruṃ gugguluṃ caiva nīlotpalasamanvitam /
guḍena dhūpayitvā tu rājadvāre priyo bhavet // GarP_1,178.6 //
śvetāpa rājitāmūlaṃ piṣṭaṃ rocanayā yutam /
yaṃ paśyettilakenaiva vaśī karyānnṛpālaye // GarP_1,178.7 //
kākajaṅghā vacā kuṣṭhaṃ nimbapatraṃ sukuṅkumam /
ātmaraktasamāyuktaṃ vaśī bhavati mānavaḥ // GarP_1,178.8 //
āraṇyasya biḍālasya gṛhitvā rudhiraṃ śubham /
karañjataile tadbhāvyaṃ rudrāgnau kajjalaṃ tataḥ /
pātayetpadmapatreṇa hādṛśyaḥ syāttadañjanāt // GarP_1,178.9 //
oṃ namaḥ khaḍgavajrapāṇaye mahāyakṣasenāpataye svāhā /
oṃ rudraṃ hrāṃ hrīṃ varaśaktā tvaritāvidyā /
oṃ mātaraḥ stambhayasvāhā /
sahasraṃ parijapyāttu vidyeyaṃ cauravāriṇī /
mahāsugandhikāmūlaṃ śukraṃ stambhetkaṭau sthitam // GarP_1,178.10 //
oṃ namaḥ sarvasattvebhyo namaḥ siddhiṃ kuru kuru svāhā /
saptābhimantritaṃ kṛtvā karavīrasya puṣpakam /
strīṇāmagre bhrāmayacca kṣaṇādvai sā vaśe bhavet // GarP_1,178.11 //
brahmadaṇḍīṃ vacāṃ patraṃ madhunā saha peṣayet /
aṅgalepācca vanitā nānyaṃ bhartāramicchati // GarP_1,178.12 //
brahmadaṇḍīśikhā vaktre kṣiptā śukrasya stambhanam /
mūlaṃ jayantyā vaktrasthaṃ vyavahāre jayapradam // GarP_1,178.13 //
bhṛṅgarājasya mūlaṃ tu piṣṭaṃ śukreṇa saṃyutam /
akṣiṇī cāñjayitvā tu vaśī karyānnaraṃ kila // GarP_1,178.14 //
aparājitāśikhāntu nīlotpalasamanvitām /
tāmbūlena pra (dānā) dadyācca vaśīkaraṇamuttamam // GarP_1,178.15 //
aṅguṣṭhe ca pade gulphe jānau ca jaghane tathā /
nābhau vakṣasi kukṣau ca kakṣe kaṇṭhe kapolake // GarP_1,178.16 //
oṣṭhe netre lalāṭe ca mūrdhni candrakalāḥ sthitāḥ /
strīṇāṃ pakṣe site kṛṣṇe ūrdhvādhaḥ saṃsthitā nṛṇām // GarP_1,178.17 //
vāmāṅge dakṣiṇāṅge ca kramādrudra dravādikṛt /
catuḥ ṣaṣṭi kalāḥ proktāḥ kāmaśāstre vaśīkarāḥ /
āliṅganādyā nārīṇāṃ kamārīṇāṃ vaśīkarāḥ // GarP_1,178.18 //
rocanāgandhupuṣpāṇi nimbapuṣpaṃ priyaṅgavaḥ /
kuṅkamaṃ candanañcaiva tilakena jagadvaśet // GarP_1,178.19 //
oṃ hrīṃ gauri devi saubhāgyaṃ putravaśādi dehi me /
oṃ hrīṃ lakṣmi ! devi saubhāgyaṃ sarvaṃ trailokyamohanam // GarP_1,178.20 //
sagandhasya haridrāyāḥ kuṅkamānāṃ ca lepataḥ /
vaśayedrudra dhūpaśca tathāpuṣpasugandhayoḥ // GarP_1,178.21 //
durālabhā vacā kuṣṭhaṃ kuṅkumañca śatāvarī /
tilatailena saṃyuktaṃ yonilepādvaśī naraḥ // GarP_1,178.22 //
nimbakāṣṭhasya dhūmena dhūpayitvā bhagaṃ vadhūḥ /
subhagāsyātsāti rudra patirdāso bhaviṣyati // GarP_1,178.23 //
māhiṣaṃ navanītañca kaṣṭañca madhuyaṣṭikā /
saubhāgyaṃ bhagalepātsyāt patirdāso bhavettathā // GarP_1,178.24 //
madhuyaṣṭiśca gokṣīraṃ tathā ca kaṇṭakārikā /
etāni samabhāgāni pibeduṣṇena vāriṇā /
caturbhāgāvaśeṣeṇa garbhasambhavamuttamam // GarP_1,178.25 //
mātuluṅgasya bījāni kṣīreṇa saha bhāvayet /
tatpītvā labhate garbhaṃ nātra kāryā vicāraṇā // GarP_1,178.26 //
mātuluṅgasya bījāni mūlānyeraṇḍakasya ca /
ghṛtena saha saṃyojya pāyayetputrakākṣiṇī // GarP_1,178.27 //
paśvagandhā mṛta dugdha kvathitaṃ mutrakārakam /
palāśasya tu bījāni kṣaudreṇa saha peṣayet /
rajasvalā tu pītvā syātmuṣpagarbhavivarjitā // GarP_1,178.28 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe hyaṣṭasaptatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 179
hariruvāca /
haritālaṃ yavakṣāṃraṃ patrāṅgaṃ raktacandanam /
jātihiṅgulakaṃ lākṣāṃ paktvā dantānpralepayet // GarP_1,179.1 //
harītakīkaṣāyeṇa mṛṣṭvā dantānpralepayet /
dantāḥ syurlohitāḥ puṃsaḥ śvetā rudra na saṃśayaḥ // GarP_1,179.2 //
mūlakaṃ svidya mandāgnau rasaṃ tasya prapūrayet /
karṇayoḥ pūraṇāttena karṇastrāvo vinaśyati // GarP_1,179.3 //
arkapatraṃ gṛhītvā tu mandāgnau tāpayecchanaiḥ /
niṣpīḍya pūrayetkarṇau karṇaśūlaṃ vinaśyati // GarP_1,179.4 //
priyaṅgumadhukā caiva dhātakyutpalapāṅktibhiḥ /
mañjiṣṭhā lodhralākṣābhiḥ kapitthasvarasena ca /
pacettailaṃ tathā strīṇāṃ naśyetkledaḥ prapūraṇāt // GarP_1,179.5 //
śuṣkamūlakaśuṇṭhīnāṃ kṣāro hiṅgumahauṣadham /
satapuṣpāvacā kuṣṭhaṃ dāru śigra rasāñjanam // GarP_1,179.6 //
sauvarcalaṃ yavakṣāraṃ tathā sarjakasaindhavam /
tathā granthirviḍaṃ mustaṃ madhuyuktaṃ caturguṇam // GarP_1,179.7 //
mātuluṃ garasastadvatkadalyāśca raso hi taiḥ /
pakvatailaṃ haredāśu strāvādīṃśca na saṃśayaḥ // GarP_1,179.8 //
karṇayoḥ kṛmināśaḥ syātkaṭutailasya pūraṇāt /
haridrā nimbapatrāṇi pippalyo maricāni ca // GarP_1,179.9 //
viḍaṅgabhadraṃ mustañca saptamaṃ viśvabheṣajam /
gomūtreṇa ca piṣṭvaiva kṛtvā ca vaṭikāṃ hara ! /
ajīrṇahṛdbhaveccaikaṃ dvayaṃ viṣūcikāpaham // GarP_1,179.10 //
paṭolaṃ madhunā hanti gomūtreṇa tathābudam /
eṣā ca śaṅkarī vartiḥ sarvanetrāmayā pahā // GarP_1,179.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekonāśītyadhikaśatatamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 180
hariruvāca /
vacā māṃsī ca bilvañca tagaraṃ padmakesaram /
nāgapuṣpaṃ priyaṅguñca samabhāgāni cūrṇayet /
anena dhūpito martyaḥ kāmavadvicarenmahīm // GarP_1,180.1 //
karpūraṃ devadāruñca madhunā saha yojayet /
liṅgalepācca tenaiva vaśīkuryātstriyaṃ kila // GarP_1,180.2 //
maithunaṃ puruṣo gacchedgṛhṇīyātsvakamindriyam /
vāmahastena vāmañca hastaṃ liṃpettu yatstriyāḥ /
āliptā strī vaśaṃ yāti nānyaṃ puruṣamicchati // GarP_1,180.3 //
oṃ raktacāmuṇḍe amukaṃ me vaśamānaya ānaya oṃ hrīṃ hraiṃ hraḥ phaṭ /
imaṃ japtvāyutaṃ mantraṃ tilakena ca śaṅkara ! /
gorocanāsaṃyutena svaraktena vaśī bhavet // GarP_1,180.4 //
saindhavaṃ kṛṣṇalavaṇaṃ sauvīraṃ matsyapittakam /
madhu sarpiḥ sitāyuktaṃ strīṇāṃ tadbhagalepanāt // GarP_1,180.5 //
yaḥ pumānmaithunaṃ gacchennānyāṃ nārīṃ gamiṣyati /
śaṅkapuṣpī vacā māṃsī soma rājī ca phalgukam // GarP_1,180.6 //
māhiṣaṃ navanītañca tvakīkṛtya bhiṣagvaraḥ /
samūlāni sa patrāṇi kṣīreṇājyena peṣayet // GarP_1,180.7 //
guṭikāṃ śodhitāṃ kṛtvā nārīyonyā praveśayet /
daśavāraṃ prasūtāpi punaḥ kanyā bhaviṣyati // GarP_1,180.8 //
sarṣapāśca vacā caiva madanasya phalāni ca /
mārjāraviṣṭhā dhattura strīkeśena samanvitaḥ // GarP_1,180.9 //
cāturthikaharo dhūpo ḍākinījvaranāśakaḥ /
arjunasya ca puṣpāṇi bhallātakaviḍaṅgake // GarP_1,180.10 //
balā caiva sarjarasaṃ sauvīrasarṣapāstathā /
sarpayūkāmakṣikāṇāṃ dhūmo maśakanāśanaḥ // GarP_1,180.11 //
bhūtalāyāśca cūrṇena stambhaḥ syādyonipūraṇāt /
tena lepanato yonau bhagastambhastu jāyate // GarP_1,180.12 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe aśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 181
hariruvāca /
tāmbūlañca ghṛtaṃ kṣaudraṃ lavaṇaṃ tāmrabhājane /
tathā payaḥ samāyuktaṃ cakṣuḥ śūlaharaṃ param // GarP_1,181.1 //
harītakī vacā kuṣṭhaṃ vyoṣaṃ hiṅgu manaḥ śilā /
kāse śvāse ca hikkāyāṃ lihyātkṣaudraṃ ghṛplutam // GarP_1,181.2 //
pippalītriphalācūrṇaṃ madhunā lehayennaraḥ /
naśyate pīnasaḥ kāsaḥ śvāsaśca balavattaraḥ // GarP_1,181.3 //
samūlacitrakaṃ bhasmapippalīcūrṇakaṃ lihet /
śvāsaṃ kāsañca hikkāñca madhumiśraṃ vṛṣadhvaja ! // GarP_1,181.4 //
nīlotpalaṃ śarkarā ca madhukaṃ padmakaṃ samam /
taṇḍulodakasaṃmiśraṃ praśamedraktavikriyāḥ // GarP_1,181.5 //
śuṇṭhī ca śarkarā caiva tathā kṣaudreṇa saṃyutā /
kokilasvara eva syādguṭikā bhuktimātrataḥ // GarP_1,181.6 //
haritālaṃ śaṅkhacūrṇaṃ kadalīdalabhasmanā /
etaddravyeṇa codvartya lomaśātanamuttamam // GarP_1,181.7 //
lavaṇaṃ haritālañca tumbinyāśca phalāni ca /
lākṣārasasamāyuktaṃ lomaśātanamuttam // GarP_1,181.8 //
sudhā ca haritālañca śaṅkhabhasma manaḥ śilā /
saindhavena sahaikatra chāgamūtreṇa peṣayet // GarP_1,181.9 //
tatkṣaṇodvartanādeva lomaśātanamuttamam /
śaṅkhamāmalakaṃ patraṃ dhātakyāḥ kusumāni ca // GarP_1,181.10 //
piṣṭvā tatpayasā sārdhaṃ saptāhaṃ dhārayenmukhe /
snigdhāḥ śvetāśca dantāśca bhavanti vimalaprabhāḥ // GarP_1,181.11 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekāśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 182
hariruvāca /
śaradgrīṣmavasanteṣu prāyaśo dadhi garhitam /
hemante śiśire caiva varṣāsu dadhi śasyate // GarP_1,182.1 //
bhukte tu śarkarā pītā navanītena buddhikṛt /
guḍasya tu purāṇasya palamekantu bhakṣayet /
strīsahasrañca saṃgacchetpumānbalayuto hara ! // GarP_1,182.2 //
kuṣṭhaṃ saṃcūrṇitaṃ kṛtvā ghṛtamākṣikasaṃyutam /
bhakṣayetsvapnavelāyāṃ balīpalitanāśanam // GarP_1,182.3 //
atasīmāṣagodhūmacūrṇaṃ kṛtvā tu pippalī /
ghṛtena lepayedgatramobhiḥ sārdhaṃ vicakṣaṇaḥ /
kandarpasadṛśo martyo nityaṃ bhavati śaṅkara ! // GarP_1,182.4 //
yavāstilāśvagandhā ca muśalī saralā guḍam /
ebhiśca racitāṃ jagdhvā taruṇo balavānbhavet // GarP_1,182.5 //
hiṅgu sauvarcalaṃ śuṇṭhīṃ pītvā tu kvathitodakaiḥ /
pariṇāmākhyaśūlañca ajīrṇañcaiva naśyati // GarP_1,182.6 //
dhātakīṃ somarājīñca kṣīreṇa saha peṣayet /
durbalaśca bhavetsthūlo nātra kāryā vicāraṇā // GarP_1,182.7 //
śarkarāmadhusaṃyuktaṃ navanītaṃ balī lihet /
kṣīrāśī ca kṣayī puṣṭiṃ medhāñcaivātulāṃ vrajet // GarP_1,182.8 //
kulīracūrṇaṃ sakṣīraṃ pītañca kṣayareganut /
bhallātakaṃ viḍaṅgañca yavakṣārañca saindhavam // GarP_1,182.9 //
manaḥ śilā śaṅkhacūrṇaṃ tailapakvaṃ tathaiva ca /
lomāni śātayatyeva nātra kāryā vicāraṇā // GarP_1,182.10 //
mālūrasya rasaṃ gṛhya jalaukāṃ tatra peṣayet /
hastau saṃlepayettena tvagnistambhanamuttamam // GarP_1,182.11 //
śālmalīrasamādāya kharamūtre nidhāya tam /
agnayādau vikṣipettena hyagnistambhanamuttamam // GarP_1,182.12 //
vāyasyā udaraṃ gṛhya maṇḍūkavasayā saha /
guṭikāṃ kārayettena tato 'gnau saṃkṣaipetsudhīḥ /
evametatprayogeṇa hyagnistambhanamuttamam // GarP_1,182.13 //
muṇḍītvakca vacā mustaṃ maricaṃ tagaraṃ tathā /
carvitvā ca tvimaṃ sadyo jihvayā jvalanaṃ lihet // GarP_1,182.14 //
gorocanāṃ bhṛṅgarājaṃ cūrṇokṛtyaghṛtaṃ samam /
divyāmbhasaḥ stambhanaṃ syānmantreṇānena vai tathā /
oṃ agnistambhanaṃ kuru kuru // GarP_1,182.15 //
oṃ namo bhagavate jalaṃ stambhaya saṃ saṃ saṃ keka kekaḥ caracara /
jalastambhanamantro 'yaṃ jalaṃ stambhayate śiva ! // GarP_1,182.16 //
gṛdhrāsthiñca gavāsthiñca tathā nirmālyameva ca /
areryo nikhaneddvāre pañcatvamu payāti saḥ // GarP_1,182.17 //
pañcaraktāni puṣpāṇi pṛthagjātyā samālabhet /
kuṅkumena samāyuktamātmaraktasamanvitam // GarP_1,182.18 //
puṣpeṇa tu samaṃ piṣṭvā rocanāyāḥ palaikataḥ /
striyā puṃsā kṛto rudra ! tilako 'yaṃ vaśīkaraḥ // GarP_1,182.19 //
brahmadaṇḍī tu puṣyeṇa bhakṣye pāne vaśīkaraḥ /
yaṣṭi madhu palaikena pakvamuṣṇodakaṃ pibet // GarP_1,182.20 //
viṣṭambhikāñca hṛcchūlaṃ haratyeva maheśvara ! /
oṃ hrūṃ jaḥ /
mantro 'yaṃ harate rudra ! sarvavṛścikajaṃ viṣam // GarP_1,182.21 //
pippalī navanītañca śṛṅgaveraṃ ca saindhavam /
maricaṃ dadhi kuṣṭhañca nasye pāne viṣaṃ haret // GarP_1,182.22 //
triphalārdrakakuṣṭhaṃ ca candanaṃ ghṛtasaṃyutam /
etatpānācca lepācca viṣanāśo bhavecchiva ! // GarP_1,182.23 //
pārāvatasya cākṣīṇi haritālaṃ manaḥ śilā /
etadyogādviṣaṃ hanti vainateya ivoragān // GarP_1,182.24 //
saindhavaṃ tryūṣaṇaṃ caiva dadhimadhvājyasaṃyutam /
vṛścikasya viṣaṃ hanti lepo 'yaṃ vṛṣabhadhvaja ! // GarP_1,182.25 //
brahmadaṇḍītilānkvāthya cūrṇaṃ trikaṭukaṃ pibet /
nāśayedrudra ! gulmāni niruddhaṃ raktameva ca // GarP_1,182.26 //
pītvā kṣīraṃ kṣaudrayutaṃ nāśayedasṛjaḥ strutim /
āṭarūpakamūlena bhagaṃ nābhiṃ ca lepayet /
sukhaṃ prasūyate nārī nātra kāryā vicāraṇā // GarP_1,182.27 //
śarkarāṃ madhusaṃyuktāṃ pītvā taṇḍulavāriṇā /
raktātisāraśamanaṃ bhavatīti vṛṣadhvaja ! // GarP_1,182.28 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe dvyāśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 183
hariruvāca /
maricaṃ śṛṅgaveraṃ ca kuṭajatvacameva ca /
pānācca grahaṇī naśyecchaśāṅkāṅkitaśekhara ! // GarP_1,183.1 //
pippalī pippalīmūlaṃ maricaṃ tagaraṃ vacā /
devadārurasaṃ pāṭhāṃ kṣīreṇa saha peṣayet // GarP_1,183.2 //
anenaiva prayogeṇa hyatisāro vinaśyati /
marīcatilapuṣpābhyā mañjanaṃ kāmalāpaham // GarP_1,183.3 //
harītakī samaguḍā madhunā saha yojitā /
virecanakarī rudra ! bhavatīti na saṃśayaḥ // GarP_1,183.4 //
triphalā citrakaṃ citraṃ tathā kaṭukarohiṇī /
urustambhaharaṃ hyetaduttamantu virecanam // GarP_1,183.5 //
harītakī śṛṅgaveraṃ devadāru ca candanam /
kvāthayecchāgadugdhena apāmārgasya mūlakam /
ūrustambhaṃ jayantyā vā saptarātreṇa nāśayet // GarP_1,183.6 //
anantāśṛṅgaverasya sūkṣmacūrṇāni kārayet /
guggulaṃ guḍatulyaṃ ca guṭikāmupayujyaca /
vāyuḥ snāyugataṃ caiva agnimāndyaṃ ca nāśayet // GarP_1,183.7 //
saṅkhapuṣpīntu puṣpeṇa samuddhṛtya sapatrikām /
samūlāṃ chāgadugdhena apasmāraharaṃ pibet // GarP_1,183.8 //
aśvagandhābhaye caiva udakena samaṃ pibet /
raktapittaṃ vinaśyettu nātra kāryā vicāraṇā // GarP_1,183.9 //
harītakīkuṣṭhacūrṇaṃ kṛtvā āsyaṃ ca pūrayet /
śītaṃ pītvātha pānīyaṃ sarvacchardinivāraṇam // GarP_1,183.10 //
gaḍūcīpadmakāriṣṭadhānyākaṃ raktacaṃndanam /
pittaśleṣmajvaracchardidāhatṛṣṇāghnamagnikṛt /
oṃ huṃ nama iti // GarP_1,183.11 //
śrotre baddhvā śaṅkhapuṣpīṃ jvaraṃ mantreṇa vai haret /
oṃ jambhinī stambhinī mohaya sarvavyādhīnme vajreṇa ṭhaḥ ṭhaḥ sarvavyādhīnme vajreṇa phaṭ iti // GarP_1,183.12 //
puṣpamaṣṭaśataṃ japtvā haste dattvā nakhaṃ spṛśet /
cāturthiko jvaro rudra anye caiva jvarāstathā // GarP_1,183.13 //
jmbūphalaṃ haridrā ca sarpasyaiva tu kañcukam /
sarvajvarāṇāṃ dhūpo 'yaṃ haraścāturthikasya ca // GarP_1,183.14 //
karavīraṃ bhṛṅgapatraṃ lavaṇaṃ kuṣṭhakarkaṭe /
caturguṇena mūtreṇa pacettailaṃ harecca tat /
pāmāṃ vicarcikāṃ kuṣṭhamabhyaṅgāddhi vraṇāni vai // GarP_1,183.15 //
pippalīmadhupānācca tathā madhurabhojanāt /
plīhā vinaśyate rudra tathā sūraṇasevanāt // GarP_1,183.16 //
pippalīñca haridrāñca gomūtreṇa samanvitām /
prakṣipecca gudadvāre arśāṃsi vinivārayet // GarP_1,183.17 //
ajādugdhamārdrakañca pītaṃ plīhādināśanam /
saindhavañca viḍaṅgāni somarājī tu sarṣapāḥ // GarP_1,183.18 //
rajanī dve viṣañcaiva gomūtreṇaiva peṣayet /
kuṣṭhanāśaśca tallepānnimbapatrādinā tathā // GarP_1,183.19 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe tryaśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 184
hariruvāca /
rajanīkadalīkṣāralepaḥ sidhmavināśanaḥ /
kuṣṭhasya bhāgamekantu pathyābhāgadvayaṃ tathā /
uṣṇodakena saṃpīya kaṭiśūlavināśanam // GarP_1,184.1 //
abhayā navanītañca śarkarāpippalīyutam /
pānādarśoharaṃ syācca nātra kāryā vicāraṇā // GarP_1,184.2 //
āṭarūṣakapatreṇa ghṛtaṃ mṛdvagninā pacet /
cūrṇaṃ kṛtvā tu lepo 'yaṃ arśarogaharaḥ paraḥ // GarP_1,184.3 //
guggulutriphalāyuktaṃ pītvā naśyedbhagandaram /
ajājīśṛṅgaverañca dathā maṇḍaṃ vipācayet // GarP_1,184.4 //
lavaṇena tu saṃyuktaṃ mūtrakṛcchravināśanam /
yavakṣāraṃ śarkarā ca mūtrakṛcchravināśakṛt // GarP_1,184.5 //
citāgniḥ khañjarīṭasya viṣṭhā pheno hayasya ca /
saubhāñjanaṃ vāsanetraṃ nara etaistu dhūpitaḥ /
adṛśyastridaśaiḥ sarvaiḥ kiṃ punarmānavaiḥ śiva // GarP_1,184.6 //
tilatailaṃ yavāndagdhvā maṣīṃ kṛtvā tu lepayet /
tenaiva saha tailena agnidagdhaḥ sukhī bhavet // GarP_1,184.7 //
lajjāloḥ śarapuṅkhāyā lepaḥ sājyo 'gnināśanaḥ /
oṃ namo bhagavate ṭha ṭha chindhi chindhi jvalanaṃ prajvalitaṃ nāśaya nāśaya huṃ phaṭ // GarP_1,184.8 //
kare baddhaṃ tu nirguṇḍyā mūlaṃ jvaraharaṃ drutam /
mūlañca śvetaguñjāyāḥ kṛtvā tatsaptakhaṇḍakam // GarP_1,184.9 //
haste badhvā nāśayecca arśāṃsyeva na saṃśayaḥ /
viṣṇukrāntājamūtreṇa cauravyāghnādirakṣaṇam // GarP_1,184.10 //
brahmadaṇḍyāstu mūlāni sarvakarmāṇi kārayet /
triphalāyāstu cūrṇaṃ hi sājyaṃ kuṣṭhavināśanam // GarP_1,184.11 //
ājyaṃ punarnavābilvaiḥ pippalībhi sādhitam /
hareddhakkāṃ śvāsakāsau pītaṃ strīṇāñca garbhakṛt // GarP_1,184.12 //
bhakṣayedvā narībījaṃ payasājyena pācitam /
ghṛtaśarkarayā yuktaṃ śukraḥ syādakṣayastataḥ // GarP_1,184.13 //
viḍaṅgaṃ madhukaṃ pāṭhāṃ māṃsīṃ sarjarasaṃ tathā /
rahidrāṃ triphalāñcaiva mapāmārgaṃ manaḥ śilām // GarP_1,184.14 //
udumbaraṃ dhātakīñca tilatailena paṣeyet /
yoniṃ liṅgaṃ ca mrakṣeta strīpusoḥ syātpriyaṃ mithaḥ // GarP_1,184.15 //
namaste īśavaradāya ākarṣiṇi vikarṣiṇi mugdhe svāhā iti /
yonilaṅgasya tailena śaṅkara mlakṣaṇāttataḥ // GarP_1,184.16 //
punarnavāmṛtā dūrvā kanakañcaindravāruṇī /
bīje naiṣāṃ jātikāyā rasena rasamardanam // GarP_1,184.17 //
mūṣāya madhyagaṃ kṛtvā rasaṃ māraṇamīritam /
madhvājyasahitaṃ dugdhaṃ valīpalitanāśanam // GarP_1,184.18 //
madhvājyaṃ guḍatāmrañca kāravellarasastathā /
dahanācca bhavedraupyaṃ suvarṇakaraṇaṃ śṛṇu // GarP_1,184.19 //
pītaṃ dharattūpuṣpañca sīsakañca palaṃ matam /
lāṅgalikāyāḥ śākhā ca svarṇañca dahanādbhavet // GarP_1,184.20 //
dhattūrabījatailena dīpaprajvalanāddhara /
samādhāvupaviṣṭantu gaganastho na paśyati // GarP_1,184.21 //
vṛṣasya mṛnmayasyaiva yukto bheko nigṛhyate /
śaṅkarāvayavairyukto dhūpaṃ ghrātvā ca garjati /
vismayaṃ kurute caiva vṛṣavannātra saṃśayaḥ // GarP_1,184.22 //
rātrau ca sārṣapaṃ tailaṃ kīṭaṃ khadyo tanāmakam /
tābhyāṃ dīpaḥ prajvalito vāgmijvālakalāpavat // GarP_1,184.23 //
cūrṇaṃ chucchundarīdhaṃ dagdhvā rudra pralepayet /
tapyate takṣaṇāddagdho yadi samyakpralepayet /
candanena bhavenmokṣaḥ pānāllepātsukhī bhavet // GarP_1,184.24 //
kuñjarasya madāktasya svayaṃ netre śivavāñjayet /
yuddhe vijayate so 'pi mahāśūraśca jāyate // GarP_1,184.25 //
dantaṃ ḍuṇḍubhasarpasya mukhe saṃgṛhya vai kṣipet /
tiṣṭhate ca jalāntastu nirvikalpaṃ sthale yathā // GarP_1,184.26 //
kumbhīranetradaṃṣṭrāśca asthīni rudhiraṃ tathā /
vasātailasamāyuktamekatra tanniyojayet /
ātmānaṃ mlakṣayettena jale tiṣṭheddinatrayam // GarP_1,184.27 //
kumbhīrakasya netrāṇi hṛdayaṃ kacchapasya ca /
mūṣikasya vasāsthīni śiśumāravasā tathā /
etānyekatra saṃlepājjale tiṣṭhedyathā gṛhe // GarP_1,184.28 //
lohacūrṇaṃ takrapītaṃ pāṇḍurogaharaṃ bhavet /
taṇḍulīya kagokṣūramūlaṃ pītaṃ payonvitam // GarP_1,184.29 //
kamalādiharaṃpitaṃ mukharogaharaṃ tathā /
jātīmūlaṃ takrapītaṃ kolamūlaṃ tvajīrṇanut // GarP_1,184.30 //
satakraṃ kuśamalaṃ vā markaṭī mūlameva vā /
kāñjikena ca vākucyā mūlaṃ vai dantaroganut // GarP_1,184.31 //
tathendravāruṇīmūlaṃ vāripītaṃ viṣādihṛt /
surabhikāmūlapā nādvā tannāśo bhavecchiva // GarP_1,184.32 //
śirorogaharaṃ lepādguñjācūrṇaṃ sakāñjikam /
balā cātibalā yaṣṭī śarkarā madhusaṃyutā // GarP_1,184.33 //
vandhyāgarbhakarī pītā nātra kāryā vicāraṇā /
śvetāparājitāmūlaṃ pippalīśuṇṭhikāyutam // GarP_1,184.34 //
paripiṣṭaṃ śirolepācchiraḥ śūlavināśanam /
nirguṇḍikāśikhāṃ pītvā gaṇḍamālāṃ vināśayet // GarP_1,184.35 //
ketakīpatrajaṃ kṣāraṃ guḍena saha bhakṣayet /
takreṇa śarapuṅkhāṃ vā pītvā plīhāṃ vināśayet // GarP_1,184.36 //
mātulaṅgasya niryāsaṃ guḍājyena samanvitam /
vātapittajaśūlāni hanti vai pānayogataḥ /
śuṇṭhī sauvarcalaṃ hiṅgu pītaṃ hṛdayaroganut // GarP_1,184.37 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaidyaśāstre caturaśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 185 /
hariruvāca /
āṃ gaṇapataye iti ayaṃ gaṇapaternmantro dhanavidyāpradāyakaḥ // GarP_1,185.1 //
imamaṣṭasahasrañca japtvā baddhvā śikhāṃ tataḥ /
vyavahāre jayaḥ syācca śataṃ jāpānnṛṇāṃ priyaḥ // GarP_1,185.2 //
tilānāṃ tu ghṛtāktānāṃ kṛṣṇānāṃ rudra homayet /
aṣṭottarasahasrantu rājā vaśyastribhirdinaiḥ // GarP_1,185.3 //
aṣṭamyāñca caturdaśyāmupoṣyābhyarcya vighnarāṭ /
tilākṣatānāṃ juhuyādaṣṭottarasahasrakam /
apājitaḥ syādyuddhe ca sarve tañca siṣevire // GarP_1,185.4 //
japtvā cāṣṭasahasrantu tataścāṣṭaśatena hi /
śikhāṃ baddhvā rājakule vyavahāre jayo bhavet // GarP_1,185.5 //
hrīṅkāraṃ savisargañca prātaḥ kāle narastu yaḥ /
strīṇāṃ lalāṭe vinyasya vaśatāṃ nayati dhruvam // GarP_1,185.6 //
susamāhitacittena vinyasya pramadālaye /
sotkāmāṃ kāminīṃ kuryānnātra kāryā vicāraṇā // GarP_1,185.7 //
juhuyādayutaṃ yastu śuciḥ prayatamānasaḥ /
dṛṣṭimātre sadā tasya vaśyamāyānti yoṣitaḥ // GarP_1,185.8 //
manaḥ śilāpatrakañca sagorocanakuṅkumam /
kṛta ebhiśca tilake vaśyamāyānti yoṣitaḥ // GarP_1,185.9 //
bhṛṅgarāṭ sahadevā ca vacā śvetāparājitā /
tenaiva tilakaṃ kṛtvā trailokyaṃ vaśatāṃ nayet // GarP_1,185.10 //
gorocanā mīnapittamābhyāñca kṛtavartikaḥ /
yaḥ pumāṃstilakaṃ kuryādvāmahastakaniṣṭhayā /
sa karoti vaśe sarvaṃ trailokyaṃ nātra saṃśayaḥ // GarP_1,185.11 //
gorocanā mahādeva ! dhātuśoṇitabhāvitā /
etairvaitilakaṃ kṛtvā sā naraṃ yaṃ nirīkṣate /
tatkṣaṇāttaṃ vaśe kuryā nnātra kāryā vicāraṇā // GarP_1,185.12 //
nāgeśvarañca śaileyaṃ tvakpatrañca harītakī /
candanaṃ kuṣṭhasūkṣmailāraktaśālisamanvitā // GarP_1,185.13 //
etairdhūpo vaśakaraḥ smarabāṇaiḥ smārārdanaḥ /
ratikāle mahādeva pārvatīpriya śaṅkara // GarP_1,185.14 //
nijaśukraṃ gṛhī tvā tu vāmahastena yaḥ pumān /
kāminīcaraṇaṃ vāmaṃ liṃpetsa syātstriyāḥ priyaḥ // GarP_1,185.15 //
saindhavañca mahādeva pārāvatamalaṃ madhu /
ebhirlipte tu liṅge vai kāminīvaśakṛdbhavet // GarP_1,185.16 //
puṣpāṇi pañcaraktāni gṛhītvā yāni kāni ca /
tattulyañca priyaṅguñca peṣayedekayogataḥ /
anena liptaliṅgasya kāminīvaśatāmiyāt // GarP_1,185.17 //
hayagandhā ca mañjiṣṭhā mālatīkusumāni ca /
śvetasaṣarpa etaiśca liptaliṅgaḥ striyāḥ priyaḥ // GarP_1,185.18 //
mūlantu kākajaṅghāyā dugdhapītantu śoṣanut /
aśvagandhānāgabalāguḍamāṣaniṣeviṇaḥ /
rūpaṃ bhavedyathā tadvannavayauvanacāriṇām // GarP_1,185.19 //
lauhacūrṇasamāyuktaṃ triphalācūrṇameva vā /
madhunā sevitaṃ rudra pariṇāmākhyaśūlanut // GarP_1,185.20 //
kvathitodakapānantu śambūkakṣārakaṃ tathā /
mṛgaśṛṅgaṃ hyagnidagdhaṃ gavyājyena samanvitam /
pīta hṛtpṛṣṭhaśūlānāṃ bhavennāśakaraṃ śiva // GarP_1,185.21 //
hiṅgu sauvarcalaṃ śuṇṭhī vṛṣadhvaja mahauṣadham? /
ebhistu kvathitaṃ vāri pītaṃ vai sarvaśūlanut // GarP_1,185.22 //
apāmārgasya vai mūlaṃ sāmudralavaṇānvitam /
āsvādi tamajīrṇasya śūlasya syādvimardanam // GarP_1,185.23 //
vaṭarohāṅkuro rudra taṇḍulodakagharṣitaḥ /
pītaḥ satakro 'tīsāraṃ kṣayaṃ nayati śaṅkara // GarP_1,185.24 //
aṅkoṭamūlaṃ karṣārdhaṃ piṣṭaṃ taṇḍulavāriṇā /
sarvātīsāragrahaṇīṃ pītaṃ harati bhūtapa // GarP_1,185.25 //
marīcaśuṇṭhikuṭajatvakcūrṇañca guḍānvitam /
kramāttaddviguṇaṃ pītaṃ grahaṇīvyādhināśanam // GarP_1,185.26 //
śvetāparājitāmūlaṃ haridrāsikthataṇḍulāḥ /
apāmārgatrikaṭukameṣāñca vaṭikā śiva /
viṣūcikāmahāvyādhiṃ haratyeva na saṃśayaḥ // GarP_1,185.27 //
triphalāguru bhūteśa śilājatu harītakī /
ekaikameṣāṃ cūrṇantu madhunā ca vimiśritam /
pītaṃ sarvañca mehantu kṣayaṃ nayati śaṅkara // GarP_1,185.28 //
arkakṣīraprasthamekaṃ tilatailaṃ tathaiva ca /
manaḥ śilāmarīcānāṃ sindūrasya palaṃ palam // GarP_1,185.29 //
cūrṇaṃ kṛtvā tāmrapātre tvātapaiḥ śoṣayettataḥ /
pītaṃ snuhīgataṃ dugdhaṃ saindhavaṃ śūlanudbhavet // GarP_1,185.30 //
trikaṭutriphalānaktaṃ tilatailaṃ tathaiva ca /
manaḥ śilā nimbapatraṃ jātīpuṣpamajāpayaḥ // GarP_1,185.31 //
tanmūtraṃ saṅkhanābhiśca candanaṃ gharṣayettataḥ /
ebhiśca vartikāṃ kṛtvā tvakṣiṇī cāñjayettataḥ // GarP_1,185.32 //
naśyate paṭalaṃ kācaṃ puṣpañca timirādikam /
vibhītakasya vai cūrṇaṃ samadhu śvāsanāśanam // GarP_1,185.33 //
pippalītriphalācūrṇaṃ madhusaindhavasaṃyutam /
sarvarogajvaraśvāsaśoṣapīnasahṛdbhavet // GarP_1,185.34 //
devadārośca vai cūrṇaṃ ajāmatreṇa bhāvayet /
ekaviṃśativāraṃvaitvakṣiṇī tena cāñjayet /
rātryandhatā paṭalatā naśyennirlomatā tathā // GarP_1,185.35 //
pippalīketakaṃ rudra haridrāmalakaṃ vacā /
sarvākṣirogā naśyeyuḥ sakṣīrādañjanāttataḥ // GarP_1,185.36 //
kākajaṅghāśigrumūle mukhena vidhṛte śiva /
carvitvā dantakīṭānāṃ vināśo hi bhaveddhara // GarP_1,185.37 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe mantratantravaidyaprayodṛpañcāśītyadhiśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 186
hariruvāca /
pītaḥ sāro guḍūcyāśca madhunā ca pramehanut /
pītaṃ gohālikāmūlaṃ tiladadhyājyasaṃyutam // GarP_1,186.1 //
niruddhamūtraṃ kvathitaṃ nivartayati śaṅkara /
tathā hikkāṃ haretpītaṃ sauvarcalayutañca vai // GarP_1,186.2 //
gorakṣakarkaṭīmūlaṃ piṣṭaṃ śītodakena ca /
pītaṃ dinatrayeṇaiva nāśayedrudra śarkarām // GarP_1,186.3 //
piṣṭvā vai mālatīmūlaṃ grīṣmakāle samāhitam /
sādhitaṃ chāgadugdhena patiṃ śarkasyānvitam /
harenmūtranirodhañca haredvai pāṇḍuśarkarām // GarP_1,186.4 //
dvijayaṣṭyāśca vai mūlaṃ piṣṭaṃ taṇḍulavāriṇā /
gaṇḍamālāṃ harellepādasādhyaṃ galagaṇḍakam // GarP_1,186.5 //
rasāñjanaṃ harītakyāścūrṇaṃ tenaiva guṇṭhanāt /
nāśayetpuruṣo vyādhīnnātra kāryā vicāraṇā // GarP_1,186.6 //
karavīramūlalepādvai lepātpūgaphalasya ca /
puṃvyādhirnaśyate rudra yogamanyaṃ vadāmyaham // GarP_1,186.7 //
dantīmūlaṃ haridrā ca citrakaṃ tasya lepanāt /
bhagandaravināśaḥ syādanyaṃ yogaṃ vadāmyaham /
jalaukājagdharaktañca bhagandaramumāpate // GarP_1,186.8 //
triphalājalaghṛṣṭañca mārjārāsthi vilepitam /
tato na prastravedraktaṃ nātra kāryā vicāraṇā // GarP_1,186.9 //
haridrānekavārañca snuhīkṣīreṇa bhāvitā /
vaṭikār'śovināśāya tallepādvṛṣabhadhvaja /
ghoṣāphalaṃ saindhavañca piṣṭvā cārśoharaṃ param // GarP_1,186.10 //
gavyājyaṃ sādhitaṃ pītaṃ palāśakṣāravāriṇā /
triguṇena trikaṭukaṃ arśāṃsi kṣapayecchiva // GarP_1,186.11 //
bilvasya ca phalaṃ dagdhaṃ raktārśaḥ pravināśanam /
jagdhavā kṛṣṇatilāneva navanītayutānapi // GarP_1,186.12 //
śuṇṭhīcūrṇaṃ yavakṣārayuktaṃ tulyaguḍānvitam /
agnivṛddhiṃ karotyeva pratyūṣe vṛṣabhadhvaja // GarP_1,186.13 //
śuṇṭhyā ca kvathitaṃ vāri pītaṃ cāgniṃ karoti vai /
harītakīṃ saindhavañca citrakaṃ rudra pippalī // GarP_1,186.14 //
cūrṇamuṣṇodakenaiṣāṃ pītaṃ cātikṣudhākaram /
sājyaṃ sūkaramāṃsaṃ vai pītaṃ cātikṣudhākaram // GarP_1,186.15 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ṣaḍaśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 187
hariruvāca /
hastikarṇapalāśasya patrāṇi? cūrṇayeddhara /
sarvarogavinirmuktaṃ cūrṇaṃ palaśataṃ śiva // GarP_1,187.1 //
sakṣīraṃ bhakṣītaṃ kuryātsaptāhena vṛṣadhvaja /
naraṃ śrutidharaṃ rudra mṛgendragativikramam // GarP_1,187.2 //
padmarāgapratīkāśaṃyuktaṃ daśaśatāyuṣā /
ṣoḍaśābdākṛtiṃ rudra satataṃ dugdhabhojanāt // GarP_1,187.3 //
madhusarpiḥsamāyuktaṃ dugdhamāyuṣkaraṃ bhavet /
tajjagdhaṃ madhunā sārdhaṃ daśavarṣa sahasriṇam // GarP_1,187.4 //
kuryānnaraṃ śrutidharaṃ pramadājanavallabham /
dadhnā nityaṃ bhakṣitantu vajradehakaraṃ bhavet // GarP_1,187.5 //
keśarājisamāyuktaṃ naraṃ varṣasahasriṇam /
tacca kāñjikasaṃyuktaṃ naraṃ kuryācca bhakṣitam // GarP_1,187.6 //
śatavarṣaṃ divyadehaṃ valīpalitavarjitam /
jagdhaṃ triphalayā kṣaudraṃ cakṣuṣmantaṃ karoti vai // GarP_1,187.7 //
andhaḥ paśyettu cūrṇasya sājyasyaiva tu bhakṣaṇāt /
mahiṣīkṣīrasaṃyuktastallepaḥ kṛṣṇakeśakṛt // GarP_1,187.8 //
khalvāṭasya ca vai keśā bhavanti vṛṣabhadhvaja /
tailayuktena cūrṇena valīpalitanāśanam // GarP_1,187.9 //
tadudvartanamātreṇa sarvarāgaḥ pramucyate /
sacchāgakṣīracūrṇena dṛṣṭiḥ syānmāsato 'ñjanāt // GarP_1,187.10 //
palāśasya ca bījāni śrāvaṇe vituṣāṇi ca /
gṛhītvā navanītena teṣāṃ cūrṇaṃ ca bhakṣayet // GarP_1,187.11 //
karṣārdhamekaṃ seveta natvā nityaṃ hariṃ prabhum /
purāṇaṣaṣṭidhānyasya pathyamambu pibanhara /
jīvedvarṣasahasrāṇi valīpalitavarjitaḥ // GarP_1,187.12 //
bhṛṅgarājasya vai mūlaṃ puṣyarkṣe tu samāhṛtam /
vidhāya tasya cūrṇaṃ vai sasauvīrañca bhakṣayetaṃ // GarP_1,187.13 //
māsamātraprayogeṇa valīpalitavarjitaḥ /
śatāni pañca jīvecca naro nāgabalo bhavet /
bhavecchrutidharo rudra puṣyarkṣe caiva bhakṣaṇāt // GarP_1,187.14 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe āyuṣkarayogodṛsaptāśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 188
hariruvāca /
nirvraṇaḥ syātpūyaṃhīno prahāro ghṛpūritaḥ /
apāmārgasya vai mūlaṃ hastābhyāñca vimarditam /
tadrasena prahārasya raktastrāvo na pūraṇāt // GarP_1,188.1 //
rudra lāṅgalikāmūlaṃ cekṣudarbhastathaiva ca /
tena vraṇamukhaṃ liptaṃ śalyaṃ niḥ sa rati vraṇāt /
cirakālapraviṣṭo 'pi tena mārgeṇa śaṅkara // GarP_1,188.2 //
bālamūlaṃ meṣaśṛṅgīmūlaṃ vā vārigharṣitam /
tena liptaṃ ciraṃ jātaṃ vraṇaṃ nāḍyāḥ praśāmyati // GarP_1,188.3 //
jagdhaṃ māhiṣapadhnā ca yuktaṃ kodravabhaktakam /
hiṅgumūlasya vai cūrṇaṃ dattaṃ nāḍīvraṇāpaham // GarP_1,188.4 //
brahmayaṣṭiphalaṃ piṣṭaṃ vāriṇā tenalepitam /
tena ghṛṣṭaṃ raktadoṣaḥ praṇaśyati na saṃśayaḥ // GarP_1,188.5 //
yavabhasma viḍaṅgañca gandhapāṣāṇameva ca /
śuṇṭhireṣāñcaiva cūrṇaṃ bhvitaṃ rudhireṇavai // GarP_1,188.6 //
kṛkalāsasya talliptaṃ vidradhiṃ nāśayecchiva /
saubhāñjanasya bījāni tvatasīmasinā saha // GarP_1,188.7 //
saurasarṣapayuktāni sarvāṇyetāni śaṅkara /
piṣṭānyanamlatakreṇa granthikaṃ nāśayeddhi vai // GarP_1,188.8 //
śvetāparājitāmūlaṃ piṣṭaṃ taṇḍulavāriṇā /
tena nasyapradānātsyādbhūtavṛndasya vidravaḥ // GarP_1,188.9 //
agastyapuṣpanasyaṃ vai samarīcaṃ tu śūlahṛt /
bhujaṅgacarma vai hiṅgu nimbapatraṃ tathā yavāḥ /
gaurasarṣama ebhiḥ syāllepo bhūtaharaḥ śiva // GarP_1,188.10 //
gorocanā marīcāni pippalī saindhavaṃ madhu /
añjanaṃ kṛtamebhiḥ syādgrahabhūtaharaṃ śiva // GarP_1,188.11 //
guggulūlūkapucchābhyāṃ dhūpo grahaharo bhavet /
cāturthikajvarairmukto kṛṣṇavastrāvaguṇṭhitaḥ // GarP_1,188.12 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vraṇāci dṛmāṣṭāśītyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 189
hariruvāca /
śvetāparājitāpuṣparasenākṣṇośca pūraṇe /
paṭalaṃ nāśamāyāti nātra kāryā vicāraṇā // GarP_1,189.1 //
mūlaṃ gokṣurakasyaiva carvitvā nīlalohita /
dantakīṭavyathā naśyetsurāsuravimardan // GarP_1,189.2 //
nārī puṣpādine pītvā gokṣīreṇopavāsataḥ /
śvetārkasya tu vai mūlaṃ tasyāstadgulmaśūlanut // GarP_1,189.3 //
śvetārkapuṣpaṃ vidhinā gṛhītaṃ pūrvamantritam /
ṛtuśuddhā ca lalanā kaṭau baddhvā prasūyate // GarP_1,189.4 //
hastabaddhaṃ palāśasya apāmārgasya vā hara /
mūlaṃ sarvajvaraharaṃ bhūtapretādinudbhavet // GarP_1,189.5 //
pītaṃ vṛścikamūlañca prātaḥ paryuṣitāmbunā /
sārdhaṃ vināśayeddāhajvarañca parameśvara // GarP_1,189.6 //
śikhāyāñcaiva tadbaddhaṃ bhavedaikāhikāhinut /
pītaṃ paryuṣitādbhiśca bhavetsarvaviṣāpahṛt // GarP_1,189.7 //
yasya lajjālukāmūlaṃ dīyate ca svaretasā /
sārdhaṃ sa vairaṃ saṃyāti pumānstrī vā na saṃśayaḥ // GarP_1,189.8 //
piṣṭvā gavyaghṛtenaiva pāṭhāmūlaṃ pibettu yaḥ /
sarvaṃ viṣaṃ vinaśyecca nātra kāryā vicāraṇā // GarP_1,189.9 //
mūlaṃ paryuṣitodena śirīṣasya yathā tathā /
raktacitrakamūlasya rasasya bharaṇāddhara /
karṇayoḥ kāmalāvyādhināśaḥ syānnātra saṃśayaḥ // GarP_1,189.10 //
śvetakokilākṣamūlaṃ chāgīkṣīreṇa saṃyutam /
trisaptāhena vai pītaṃ kṣayarogaṃ kṣayaṃ nayet // GarP_1,189.11 //
nārikelasya vai puṣpaṃ chāgakṣīreṇa saṃyutam /
pibecca trividhastasya raktavāto vinaśyati // GarP_1,189.12 //
kuryātsudarśanāmūlaṃ mālyena susamāhṛtam /
kaṇṭhabaddha tryāhikādigrahabhūtavināśanam // GarP_1,189.13 //
puṣpaṃ dhavalaguñjāyā gṛhītaṃ mūlameva ca /
mukhe tu nihitaṃ rudra harennānāviṣaṃ bahu // GarP_1,189.14 //
haste baddhaṃ kāṇḍayuktaṃ kaṇṭhe baddhaṃ grahādihṛt /
kṛṣṇāyāntu caturdaśyāṃ kaṭibaddhaṃ samāhṛtam /
siṃhādiśvāpadādbhītiṃ harecca nīlalohita // GarP_1,189.15 //
viṣṇukrāntāmūlamīśa karṇabaddhantu dhārayet /
paṭṭasūtreṇa bhūteśa makarādibhayaṃ na vai // GarP_1,189.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekonanavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 190
hariruvāca /
aparājitāyā mūlañca gomūtreṇa samanvitam /
pītañcāśu haratyeva gaṇḍamālāṃ na saṃśayaḥ // GarP_1,190.1 //
athendravāruṇīmūlaṃ vidhinā pītamīśvara /
jiṅgiṇyairaṇḍakaṃ rudra śūkaśimbyā samanvitam /
śītodakañca tatryastaṃ bāhugrīvāvyathāṃ haret // GarP_1,190.2 //
māhiṣaṃ navanītañca aśvagandhā ca pippalī /
vacā kuṣṭhadvayaṃ lepo liṅgasrotastanārtihṛt // GarP_1,190.3 //
kuṣṭhanāgabalācūrṇaṃ navanītasamanvitam /
tallepo yuvatīnāñca kuryādvṛttojakau śubhau // GarP_1,190.4 //
indravāruṇikāmūlaṃ yasya nāmnā sudūrataḥ /
niḥ kṣipyate samutpāṭya tasya plīhā vinaśyati // GarP_1,190.5 //
punarnavāyāḥ śuklāyā mūlaṃ taṇḍulavāriṇā /
pītaṃ vidradhinutsyācca nātra kāryā vicāraṇā // GarP_1,190.6 //
kadalīdalakṣārantu pānīyena prasādhitam /
tasyādanādvinaśyanti udaravyādhayo 'khilāḥ // GarP_1,190.7 //
kadalyā mūlamādāya guḍājyena samanvitam /
agninā sādhitaṃ jagdhamudarasthakrimīnharet // GarP_1,190.8 //
nityaṃ nimbadalānāñca cūrṇamāmalakasya ca /
pratyūṣe bhakṣayeccaiva tasya kuṣṭhaṃ vinaśyati // GarP_1,190.9 //
harītakīviḍaṅgañca haridrā sitasarṣapāḥ /
somarājasya mūlāni karañjasya ca raundhavam /
gomūtrapiṣṭānyetāni kuṣṭharogaharāṇi vai // GarP_1,190.10 //
ekaśca triphalābhāgastathā bhāgadvayaṃ śivā /
somarājasya bījānāṃ jagdhaṃ pathyena dadrunut // GarP_1,190.11 //
amlatakraṃ sagomūtraṃ kvathitaṃ lavaṇānvitam /
kāṃsyaghṛṣṭaṃ kharaṃ lepātkuṣṭhadadruvināśanam // GarP_1,190.12 //
haridrā haritālaśca dūrvāgomūtrasaindhavam /
ayaṃ lepo hanti dadruṃ pāmānaṃ ca garaṃ tathā // GarP_1,190.13 //
soma rājasya bījāni navanītayutāni ca /
madhunāsvāditāni syuḥ śuklakuṣṭhaharāṇi vai /
takrānnapānato rudra nātra kāryā vicāraṇā // GarP_1,190.14 //
śvetāparā jitāmūlaṃ vartitaṃ cāsya vāriṇā /
tallepo rudra māsena śuklakuṣṭhavināśanaḥ // GarP_1,190.15 //
māhiṣaṃ navanītañca sindūraṃ samarīcakam /
pāmā vilepanānnaśyeddur nāmā vṛṣabhadhvaja // GarP_1,190.16 //
viśuṣkagāmbhārīmūlaṃ pakvaṃ kṣīreṇa saṃyutam /
bhakṣitaṃ śuklapittasya vināśakaramīśvara // GarP_1,190.17 //
mūlakasya tu bījāni hyapā mārgarasena vai /
piṣṭāni tena lepena sidhmakaṃ rudra naśyati // GarP_1,190.18 //
kadalīkṣārasaṃyuktaharidrā sidhmakāpahā /
rambhāpāmārgayoḥ kṣāra eraṇḍena vimiśritaḥ /
tadabhyaṅgānmahādeva ! sadyaḥ sidhma vinaśyati // GarP_1,190.19 //
kūṣmāṇḍanālakṣāraśca sagomūtraśca tattvataḥ /
jalapiṣṭā haridrā ca siddhā mandānalenahi // GarP_1,190.20 //
māhiṣeṇa purīṣeṇa veṣṭitā vṛṣabhadhvaja /
asyā udvartanaṃ kuryādaṅgasauṣṭhavamīśvara // GarP_1,190.21 //
tilasarṣapasaṃyuktaṃ haridrādvayakuṣṭhakam /
tenodvartitadehaḥ syāddurgandhaḥ surabhiḥ pumān // GarP_1,190.22 //
manoharaścānudinaṃ dūrvāṇāṃ kākajaṅghāyā /
arjunasya tu puṣpāṇi jambūpatrayutāni ca /
salodhrāṇi ca tallepo dehadurgandhatāṃ haret // GarP_1,190.23 //
yuktaṃ lodhrabhavairnoraiścūrṇantu kanakasya ca /
tenodvartitadehasya na syādgrīṣmaprabādhikā // GarP_1,190.24 //
dugdhenoṣasi sekaśca gharmadoṣaśca naśyati /
kākajaṅghodvartanantu hyaṅgarāgakaraṃ bhavet // GarP_1,190.25 //
madhuyaṣṭī śarkarā ca vāsakasya raso madhu /
etatpītaṃ raktapittakāmalāpāṇḍuroganut // GarP_1,190.26 //
raktapittaṃ haretpīto vāsakasya raso madhu /
prātaḥ kāle toyapānātpīnasaṃ dāruṇaṃ haret // GarP_1,190.27 //
bibhītakasya vai cūrṇaṃ pippalyāḥ saindhavasya ca /
pītaṃ sakāñjikaṃ hanti svarabhedaṃ maheśvara // GarP_1,190.28 //
cūrṇamāmalakaṃ sevyaṃ pītaṃ gavyapayo 'nvitam /
manaḥ śilā balāmūlaṃ kolapaṇa ca gugguluḥ // GarP_1,190.29 //
jātipatraṃ kolapatraṃ tathā caiva manaḥ śilā /
ebhiścaiva kṛtā vartirbadaryagnau maheśvara /
dhūmapānaṃ kāsaharaṃ nātra kāryā vicāraṇā // GarP_1,190.30 //
triphalāpippalīcūrṇaṃ bhakṣitaṃ madhunāyutam /
bhojanādau hi samadhu pipāsājva(tva)ritaṃ haret // GarP_1,190.31 //
bilvamūlañca samadhuguḍūcīkvathitaṃ jalam /
pītaṃ harecca trivadhaṃ chardiṃ naivātrasaṃśayaḥ /
pītā dūrvā chardinutsyātpiṣṭātaṇḍulavāriṇā // GarP_1,190.32 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe navatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 191
hariruvāca /
punarnavāyā mūlañca śvetaṃ puṣye samāhṛtam /
vāri pītaṃ tasya pārśva bhavaneṣu na pannagāḥ // GarP_1,191.1 //
tārkṣyamūrtiṃ vahedyo vai bhallūkadantanirmitām /
sa pannagairna dṛśyeta yāvajjīvaṃ vṛṣadhvaja // GarP_1,191.2 //
pibecchalmalimūlaṃ yaḥ puṣyarkṣe rudra vāriṇā /
tasminnapāstadaśanā nāgāḥ syurnātra saṃśayaḥ // GarP_1,191.3 //
puṣye lajjālukāmūle hastabaddhe tu pannagān /
gṛhṇīyāllepato vāpi nātra kāryā vicāraṇā // GarP_1,191.4 //
puṣyeśvetārkamūlantu pītaṃ śītena vāriṇā /
naśyetu daṃśakaviṣaṃ karavīrādijaṃ viṣam // GarP_1,191.5 //
mahākālasya vai mūlaṃ piṣṭaṃ tatkāñjikena vai /
voḍrāṇāṃ ḍuṇḍubhānāṃ ca tallopo harate viṣam // GarP_1,191.6 //
taṇḍulīyakamūlaṃ ca piṣṭaṃ taṇḍulavāriṇā /
ghṛtena saha pītantu haretsarvāviṣāṇi ca // GarP_1,191.7 //
nīlīlajjālukāmūlaṃ piṣṭaṃ taṇḍulavāriṇā /
pītaṃ taddaṃśakaviṣaṃ naśyedekena vobhayoḥ // GarP_1,191.8 //
kūṣmāṇḍakasya svarasaḥ saguḍaḥ sahaśarkaraḥ /
pītaḥ sadugdho hanyācca daṃśakasyaviṣaṃ ca vai // GarP_1,191.9 //
tathā kodravamūlasya mohasya hara eva ca /
yaṣṭīmadhusamāyuktā tathā pītā ca śarkarā // GarP_1,191.10 //
sadugdhā ca trirātreṇa mūṣakānāṃ viṣaṃ haret /
culukatrayapānācca vāriṇaḥ śītalasya vai // GarP_1,191.11 //
tāmbūladagdhamukhasya lālāstrāvo vinaśyati /
ghṛtaṃ saśarkaraṃ ṣītvā madyapānamado na vai // GarP_1,191.12 //
kṛṣṇāṅkolasya mūlena pītaṃ sukvathitaṃ jalam /
tato naśyadgaraviṣaṃ trirātreṇa maheśvara // GarP_1,191.13 //
uṣṇaṃ gavyaghṛtaṃ caiva saindhavena samanvitam /
nāśayettanmahādeva vedanāṃ vṛścikodbhavām // GarP_1,191.14 //
kusubhaṃ kaṅkumañcaiva haritālaṃ manaḥ śilā /
karañjaṃ piṣitaṃ caiva hyarkamūlaṃ ca śaṅkara // GarP_1,191.15 //
viṣaṃnṛṇāṃ vinaśyettu eteṣāṃ bhakṣaṇācchiva /
dīpatailapradānācca daṃśairākīṭajaiḥ śiva /
kharjūrakaviṣaṃ naśyettadā vai nātra saṃśayaḥ // GarP_1,191.16 //
daṃśasthānaṃ vṛścikasya śuṇṭhī tagarasaṃyutā /
naśyenmadhumakṣikāyā eteṣāṃ lepato viṣam // GarP_1,191.17 //
śatapuṣpā saindhavañca sājyaṃ vā tena lepayet /
śirīṣasya tu bījaṃvai siddha kṣīreṇa gharṣitam // GarP_1,191.18 //
tallepena mahādeva naśyetkukkurajaṃ viṣam /
jvalitāgnirvāriseko tathā dardurajaṃ viṣam // GarP_1,191.19 //
dhattūrakarasonmiśraṃ kṣīrādyaguḍapānataḥ /
śūnāṃ viṣaṃ vinaśyettu śaśāṅkāṅkitaśekhara // GarP_1,191.20 //
vaṭanimbaśamīnāñca valkalaiḥ kvathitaṃ jalam /
tatsekānmukhadantānāṃ naśyedvai viṣavedanā // GarP_1,191.21 //
lepanāddevadārośca gairikasya ca lepanāt /
nāgeśvaro daridre dve tathā mañjiṣṭhakā hara /
ebhirlepādvinaśyettu lūtāviṣamumāpate // GarP_1,191.22 //
karañjasya tu bījāni varuṇacchadameva ca /
tilāśca sarṣapā hanyurviṣaṃ vai nātra saṃśayaḥ // GarP_1,191.23 //
ghṛtaṃ kumārīpatraṃ vai dattaṃ salavaṇaṃ hara /
turaṅgamaśarīrāṇāṃ kaṇḍūrnaśyeddaśāhataḥ // GarP_1,191.24 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ekanavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 192
hariruvāca /
citrakasyāṣṭabhāgāśca śūraṇasya ca ṣoḍaśa /
śuṇṭhyā bhāgāśca catvāro maricānāṃ dvayaṃ tathā // GarP_1,192.1 //
tritayaṃ pippalīmūlaṃ viḍaṅgānāṃ catuṣṭayam /
aṣṭau muśalikābhāgāstriphalāyāścatuṣṭayam /
dviguṇena guḍenaiṣāṃ modakāniha kārayet // GarP_1,192.2 //
tadbhakṣaṇamajīrṇaṃ hi pāṇḍurogañja kāmalam /
atīsārāṃśca mandāgniṃ plīhāñcaiva nivārayet // GarP_1,192.3 //
bilvāgnimanthaḥ śyonākapāṭalāpāribhadrakam /
prasāraṇyaśvagandhā ca bṛhatī kaṇṭakārikā // GarP_1,192.4 //
balā cātibalā rāsnā śvadaṃṣṭrā ca punarnavā /
eraṇḍaḥ śārivā parṇo guḍūcī kapikacchukā // GarP_1,192.5 //
eṣāṃ daśapalānbhāgānkvāthayetsalile 'male /
tena pādāvaśeṣeṇa tailapātre vipācayet // GarP_1,192.6 //
ājaṃ vā yadi gavyaṃ kṣīraṃ dattvā caturguṇam /
śatāvarīṃ saindhavañca tailatulyaṃ pradāpayet // GarP_1,192.7 //
dravyāṇiyāni peṣyāṇi tāni vakṣyāmi tacchṛṇu /
śatapuṣpā devadārurbalā parṇo vacāguru // GarP_1,192.8 //
kuṣṭhaṃ māṃsī saindhavañca palamekaṃ punarnavā /
pāne nasye tathābhyaṅge tailametatpradāpayet // GarP_1,192.9 //
hṛcchūlaṃ pārśvaśūlañca gaṇḍamālāñca nāśayet /
apasmāraṃ vātaraktaṃ vapuṣmāṃśca pumānbhavet // GarP_1,192.10 //
garbhamaśvatarī vindyātkiṃ punarmānuṣī hara /
aśvānāṃ vātabhagnānāṃ kuñjarāṇāṃ nṛṇāṃ tathā /
tailametatprayoktavyaṃ sarvavātavikāriṇām // GarP_1,192.11 //
hiṅgutumburuśuṇṭhībhiḥ siddhaṃ tailantu sārṣapam /
etaddhi puraṇaṃ śreṣṭhaṃ karṇaśūlāpahaṃ param // GarP_1,192.12 //
śuṣkamūlakaśuṇṭhīnāṃ kṣāro hiṅgulanāgaram /
takraṃ caturguṇaṃ dadyāttailametadvipācayet // GarP_1,192.13 //
bādhiryaṃ karṇaśūlañca pūyastrāvañca karṇayoḥ /
krimayaśca vinaśyanti tailasyāsya prapūraṇāt // GarP_1,192.14 //
śuṣkamūlakaśuṇṭhīnāṃ kṣāro hiṅgulanāgaram /
śatapuṣpā vacā kuṣṭhaṃ dāruśigrurasāñjanam // GarP_1,192.15 //
sauvarcalaṃ yavakṣāraṃ sāmudraṃ saindhavaṃ tathā /
granthikaṃ viḍamustaṃ ca madhu śuktaṃ caturguṇam // GarP_1,192.16 //
mātuluṅgarasaścaiva kadalīrasa eva ca /
tailamebhirvipaktavyaṃ karṇaśūlāpahaṃ param // GarP_1,192.17 //
bādhiryaṃ karṇanādaśca pūyastrāvaśca dāruṇam /
pūraṇādasya tailasya krimayaḥ karṇayorhara // GarP_1,192.18 //
sadyo vināśamāyānti śaśāṅkakṛtaśekhara /
kṣāratailamidaṃ śreṣṭhaṃ mukhadantamalāpaham // GarP_1,192.19 //
candanaṃ kuṅkumaṃ māṃsī karpūraṃ jātipatrikā /
jātīkaṅkolapūgānāṃ lavaṅgasya phalāni ca // GarP_1,192.20 //
agurūṇi ca kastūrī kuṣṭhaṃ tagarapādikā /
gorocanā priyaṅguśca balā caiva tathā nakhī // GarP_1,192.21 //
saralaṃ saptaparṇaṃ ca lākṣā cāmalakī tathā /
tathā tu padmakaṃ caiva hyetaistailaṃ prasādhayet // GarP_1,192.22 //
prasvedamaladurgandhakaṇḍū kuṣṭhaharaṃ param /
gacchati strīśataṃ rudra bandhyāpi labhate sutam // GarP_1,192.23 //
yavānī citrakaṃ dhānyaṃ tryūṣaṇaṃ jīrakaṃ tathā /
sauvarcalaṃ viḍagañca pippalīmūlarājikam // GarP_1,192.24 //
ebhiḥ pacedraghṛtaprasthaṃ jalaprasthāṣṭasaṃyutam /
tathār'śogulmaśvayathuṃ hanti vahniṃ karoti vai // GarP_1,192.25 //
maricaṃ trivṛtaṃ kuṣṭhaṃ haritālaṃ manaḥ śilā /
devadāru haridre dve kuṣṭhaṃ māṃsī ca candanam // GarP_1,192.26 //
viśālā karavīrañca arkakṣīraṃ śakṛdrasaḥ /
eṣāñca kārṣiko bhāgo viṣasyārdhapalaṃ bhavett // GarP_1,192.27 //
prasthaṃ saṭukatailasya gomūtre 'ṣṭaguṇe pacet /
mṛtpātre lohapātre vā śanairmṛdvagninā pacet // GarP_1,192.28 //
pāmā vicarcikā caiva dadrurvisphocakānica /
abhyaṅgena praṇaśyanti komalatvañca jāyate // GarP_1,192.29 //
prabhūtānyapi śvitrāṇi tailenānena mardayet /
cirotthitamapi śvitraṃ vinaṣṭaṃ tatkṣaṇādbhavet // GarP_1,192.30 //
paṭolapatraṃ kaṭukā mañjiṣṭhā śārivā niśā /
jātīśamīnimbapatraṃ madhukaṃ kvathitaṃ ghṛtam // GarP_1,192.31 //
ebhirlepātsayurarujo vraṇā vistrāviṇaḥ śiva /
śaṅkhapuṣpī vacā somo brāhmī brahmasuvarcalāḥ // GarP_1,192.32 //
abhayā ca guḍūcī ca āṭarūṣakavākucī /
etairakṣasamairbhāgairghṛtaprasthaṃ vipācayet // GarP_1,192.33 //
kaṇṭakāryā rasaprasthaṃ kṣīraprasthasamanvitam /
etadbrāhmīghṛtaṃ nāma smṛtimedhākaraṃ param // GarP_1,192.34 //
agnimantho vacā vāsā pippalī madhu saindhavam /
saptarātraprayogeṇa kinnarairiva gīyate // GarP_1,192.35 //
apāmārgaḥ guḍūcī ca vacā kuṣṭhaṃ śatāvarī /
śaṅkhapuṣpābhayā sājyaṃ viḍaṅgaṃ bhakṣitaṃ samam /
tribhirdinairnaraṃ kuryādgranthāṣṭaśatadhāriṇam // GarP_1,192.36 //
adbhirvā payasājyena māsamekantu sevitā /
vacā karyānnaraṃ prājñaṃ śrutidhāraṇasaṃyutam // GarP_1,192.37 //
candrasūryagrahe pītaṃ palamekaṃ payo 'nvitam /
vacāyāstatkṣaṇaṃ kuryānmahāprajñāyutaṃ naram // GarP_1,192.38 //
bhūnimbanimbatriphalāparpaṭaiśca śṛtaṃ jalam /
paṭolīmustakābhyāñca vāsakena ca nāśayet // GarP_1,192.39 //
visphoṭakāni raktañca nātra kāryā vicāraṇā /
katakasya phalaṃ śaṅkhaṃ saindhavaṃ tryūṣaṇaṃ vacā // GarP_1,192.40 //
phenī rasāñjanaṃ kṣaudraṃ viḍaṅgāni manaḥ śilā /
eṣāṃ vartirhanti kācaṃ timiraṃ paṭalaṃ tathā // GarP_1,192.41 //
prasthadvayaṃ māṣakasya kvāthaśca droṇamambhasām /
caturbhāgāvaśeṣeṇa tailaprasthaṃ vipācayet // GarP_1,192.42 //
kāñjikasyāḍhakaṃ dattvā piṣṭānyetāni dāpayet /
punarnavā gokṣurakaṃ saindhavaṃ tryūṣaṇaṃ vacā // GarP_1,192.43 //
lavaṇaṃ suradāruśca mañjiṣṭhā kaṇṭakārikā /
nasyātpānāddharatyeva karṇaśūlaṃ sudāruṇam // GarP_1,192.44 //
bādhiryaṃ sarvarogāṃśca hyabhyaṅgācca maheśvara /
paladvayaṃ saindhavañca śuṇṭhī citrakapañcakam // GarP_1,192.45 //
sauvīrapañcaprasthaṃ ca tailaprasthaṃ pacettataḥ /
asṛgdarasvaraplīhāsarvavātavikāranut // GarP_1,192.46 //
udumbaraṃ vaṭaṃ plakṣaṃ jambūdvayamathārjunam /
pippalī ca kadambañca palāśaṃ lodhratindukam // GarP_1,192.47 //
madhūkamāmrasarjañca badaraṃ padmakeśaram /
śirīṣabījaṅkatakametatkvāthena sādhitam /
tailaṃ hanti vraṇāṃllepāccirakālabhavānapi // GarP_1,192.48 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe dvinavatyadhika śatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 193
hariruvāca /
palāṇḍujīrake kuṣṭhamaśvagandhājamodakam /
vacā trikaṭukañcaiva lavaṇaṃ cūrṇamuttamam // GarP_1,193.1 //
brāhmīrasairbhāvitañca sarpirmadhusamanvitam /
saptāhaṃ bhakṣitaṃ kuryānnirmalāñca matiṃ parām // GarP_1,193.2 //
siddhārthakaṃ vacā hiṅgu karañjaṃ devadāru ca /
mañjiṣṭhā triphalā viśvaṃ śirīṣo rajanīdvayam // GarP_1,193.3 //
priyaṅgunimbatrikraṭu gomūtreṇaiva gharṣitam /
nasayamālepanañcaiva tathā codvartanaṃ hitam // GarP_1,193.4 //
apasmāraviṣonmādaśoṣālakṣmījvarāpaham /
bhūtebhyaścabhayaṃ hanti rājadvāreṣu yojanāt // GarP_1,193.5 //
nimbaṃ kuṣṭhaṃ haridre dve śigru sarṣapajaṃ tathā /
devadāru paṭolañca dhānyaṃ takreṇa gharṣitam // GarP_1,193.6 //
dehaṃ tailākta gātraṃ vai nayedudvartanena ca /
pāmāḥ kuṣṭhāni naśyeyuḥ kaṇḍūṃ hanti ca niścitam // GarP_1,193.7 //
sāmudraṃ saindhavaṃ kṣāro rājikā lavaṇaṃ viḍam /
kaṭuloharajaścaivaṃ trivṛtsūraṇakaṃ samam /
dadhigomūtrapayasā mandapāvakapācitam // GarP_1,193.8 //
balāgnivardhakaṃ cūrṇaṃ pibeduṣṇena vāriṇā /
jīrṇe 'jīrṇe tu bhuñjati māṃsyādighṛtamuttamam // GarP_1,193.9 //
nābhiśūlaṃ mūtraśūlaṃ gulmaplīhabhavañca yat /
sarvaśūlaharaṃ cūrṇaṃ jaṭharānaladīpanam /
pariṇāmasamutthasya śūlasya ca hitaṃ param // GarP_1,193.10 //
abhayāmalakaṃ drākṣā pippalī kaṇṭakārikā /
śṛṅgī punarnavā śuṇṭhī jagdhā kāsaṃ nihanti vai // GarP_1,193.11 //
abhayāmalakaṃ drākṣā pāṭhā caiva vibhītakam /
śarkarāyā samaṃ caiva jagdhaṃ jvaraharaṃ bhavet // GarP_1,193.12 //
triphalā badaraṃ drākṣā pippalī ca virekakṛt /
harītakī soṣṇānīralavaṇañca virekakṛt // GarP_1,193.13 //
kūrmamatsyāśvamahiṣagośṛgālāśca vānarāḥ /
viḍālabarhikākāśca varāholūkakukkuṭāḥ // GarP_1,193.14 //
haṃsa eṣāñca viṇmūtraṃ māṃsaṃ vā roma śoṇitam /
dhūpaṃ dadyājjvarārtebhya unmattebhyaśca śāntaye // GarP_1,193.15 //
etānyauṣadhajātāni kathitāni umāpate /
nighnanti tāśca rogāṃśca vṛkṣamindrāśaniryathā // GarP_1,193.16 //
auṣadhaṃbhagavānviṣṇuḥ saṃsmṛto roganudbhavet /
dhyāto 'rcitaḥ stuto vāpi nātra kāryā vicāraṇā // GarP_1,193.17 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe trinavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 194
hariruvāca /
sarvavyādhiharaṃ vakṣye vaiṣṇavaṃ kavacaṃ śubham /
yena rakṣā kṛtā śambhordaityānkṣapayataḥ purā // GarP_1,194.1 //
praṇamya devamīśānamajaṃ nityamanāmayam /
devaṃ sarveśvaraṃ viṣṇuṃ sarvavyāpinamavyayam // GarP_1,194.2 //
badhnāmyahaṃ pratisaraṃ namaskṛtya janārdanam /
amoghāpratimaṃ sarvaṃ sarvaduḥ khanivāraṇam // GarP_1,194.3 //
viṣṇurmāmagrataḥ pātu kṛṣṇo rakṣatu pṛṣṭhataḥ /
harirme rakṣatu śiro hṛdayañca janārdanaḥ // GarP_1,194.4 //
mano mama hṛṣīkeśo jihvāṃ rakṣatu keśavaḥ /
prātu netre vāsudevaḥ śrotre saṅkarṣaṇo vibhuḥ // GarP_1,194.5 //
pradyumnaḥ pātu me ghrāṇamaniruddhastu carma ca /
vanamālī galasyāntaṃ śrīvatso rakṣatāmadhaḥ // GarP_1,194.6 //
pārśvaṃ rakṣatu me cakraṃ vāmaṃ daityanivāraṇam /
dakṣiṇantu gadā devī sarvāsuranivāriṇī // GarP_1,194.7 //
udaraṃ musalaṃ pātu pṛṣṭhaṃ me pātu lāṅgalam /
ūrdhvaṃ rakṣatu me śārṅgaṃ jaṅghe rakṣatu nandakaḥ // GarP_1,194.8 //
pārṣṇo rakṣatu śaṅkhaśca padmaṃ me caraṇāvubhau /
sarvakāryārthasiddhyarthaṃ pātu māṃ garuḍaḥ sadā // GarP_1,194.9 //
varāho rakṣatu jale viṣameṣu ca vāmanaḥ /
aṭavyāṃ narasiṃhaśca sarvataḥ pātu keśavaḥ // GarP_1,194.10 //
hiraṇyagarbho bhagavānhiraṇyaṃ me prayacchatu /
sāṃkhyācāryastu kapilo dhātusāmyaṃ karotu me // GarP_1,194.11 //
śvetadvīpanivāsī ca śvetadvīpaṃ nayatvajaḥ /
sarvānsūdayatāṃ śatrūnmadhukaiṭabhamardanaḥ // GarP_1,194.12 //
sadākarṣatu viṣṇuśca kilbiṣaṃ mama vigrahāt /
haṃso matsyastathā kūrmaḥ pātu māṃ sarvatodiśam // GarP_1,194.13 //
trivikramastu me devaḥ sarvapāpāni kṛntatu /
tathā nārāyaṇo devo buddhiṃ pālayatāṃ mama // GarP_1,194.14 //
śeṣo me nirmalaṃ jñānaṃ karotvajñānanāśanam /
vaḍavāmukho nāśayatāṃ kalmaṣaṃ yatkṛtaṃ mayā // GarP_1,194.15 //
padbhyāṃ dadātu paramaṃ sukhaṃ mūrdhni mama prabhuḥ /
dattātreyaḥ prakurutāṃ saputrapaśubāndhavam // GarP_1,194.16 //
sarvānarīnnāśayatu rāmaḥ paraśunā mama /
rakṣoghnastu daśarathiḥ pātu nityaṃ mahābhujaḥ // GarP_1,194.17 //
śatrīnhalena me hanyādrāmo yādavanandanaḥ /
pralambakeśicāṇūrapūtanākaṃsanāśanaḥ /
kṛṣṇasya yo bālabhāvaḥ sa me kāmānprayacchatu // GarP_1,194.18 //
andhakāratamoghoraṃ puruṣaṃ kṛṣṇaṣiṅgalam /
paśyāmi bhayasantrastaḥ pāśahastamivāntakam // GarP_1,194.19 //
tato 'haṃ puṇḍarīkākṣamacyutaṃ śaraṇaṃ gataḥ /
dhanyo 'haṃ nirbhayo nityaṃ yasya me bhagavānhariḥ // GarP_1,194.20 //
dhyātvā nārāyaṇaṃ devaṃ sarvopadravanāśanam /
vaiṣṇavaṃ kavacaṃ baddhvā vicarāmi mahītale // GarP_1,194.21 //
apradhṛṣyo 'smi bhūtānāṃ sarvadevamayo hyaham /
smaraṇāddevadevasya viṣṇoramitatejasaḥ // GarP_1,194.22 //
siddhirbhavatu me nityaṃ yathāmantramudāhṛtam /
yo māṃ paśyati cakṣurbhyāṃ yañcaḥ paśyāmi cakṣuṣā /
sarveṣāṃ pāpaduṣṭānāṃ viṣṇurbadhnātu cakṣuṣī // GarP_1,194.23 //
vāsudevasya yaccakraṃ tasya cakrasya ye tvarāḥ /
te hi cchindantu pāpānme mama hiṃsantu hiṃsakān // GarP_1,194.24 //
rākṣaseṣu piśāceṣu kāntāreṣvaṭavīṣu ca /
vivāde rājamārgeṣu dyūteṣu kalaheṣu ca // GarP_1,194.25 //
nadīsantāraṇe ghore saṃprāpte prāṇasaṃśaye /
agnicauranipāteṣu sarvagrahanivāraṇe // GarP_1,194.26 //
vidyutsarpaviṣodvege roge vai vighnasaṅkaṭe /
japyametajjapennityaṃ śarīre bhayamāgate // GarP_1,194.27 //
ayaṃ bhagavato mantro mantrāṇāṃ paramo mahān /
vikhyātaṃ kavacaṃ guhyaṃ sarpapāpapraṇāśanam /
svamāyākṛtinirmāṇaṃ kalpāntagahanaṃ mahat // GarP_1,194.28 //
anādyanta ! jagadbīja ! padmanābha ! namo 'stu te /
oṃ kālāya svāhā / oṃ kālapuruṣāya svāhā / oṃ kṛṣṇāya svāhā /
oṃ kṛṣṇarūpāya svāhā / oṃ caṇḍāya svāhā / oṃ caṇḍarūpāya svāhā /
oṃ pracaṇḍāya svāhā / oṃ pracaṇarūpāya svāhā / oṃ sarvāya svāhā /
oṃ sarvarūpāya svāhā / oṃ namo bhuvaneśāya trilokadhātre iha viṭi siviṭi siviṭi svāhā/ oṃ namaḥ ayokhetaye ye ye saṃjñāpaya daityadānavayakṣarākṣasabhūtapiśācakūṣmāṇḍāntāpasmārakacchardanaduddharrāṇāmekāhikadvyāhikatryāhikacāturthikamauhūrtikadinajvararātrijvarasandhyājvarasarvajvarādīnāṃ lūtākīṭakaṇṭakapūtanābhujaṅgasthāvarajaṅgamaviṣādī nāmidaṃ śarīraṃ mama pathyaṃ tvaṃ kuru sphuṭa sphuṭa sphuṭa prakoṭa laphaṭa vikaṭadaṃṣṭra pūrvato rakṣatu oṃ hai hai hai hai dinakarasahasrakālasamāhato jaya paścimato rakṣa oṃ nivi nivi pradīptajvalanajvālākāra mahākapila uttarato rakṣa oṃ vili vili mili mili garuḍi garuḍi gaurīgāndhārīviṣamohaviṣamaviṣamāṃ mahohayatu svāhā dakṣiṇato rakṣa māṃ paśya sarvabhūtabhayopadravebhyo rakṣa rakṣa jaya jaya vijaya tena hīyate riputrāsāhaṅkṛtavādyato bhayanudabhayato 'bhayaṃ diśatucyutaṃ /
tadudaramakhilaṃ viśantu yugaparivartasahasrasaṃkhyeyo 'staṃhaṃsamiva praviśanti raśmayaḥ /
vāsudevasaṅkarṣaṇapradyumnāścāniruddhakaḥ /
sarvajvarānmamaghnantu viṣṇurnārāyaṇo hariḥ // GarP_1,194.29 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaiṣṇavakavacakathanaṃ nāma caturnavatyuttaraśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 195
hariruvāca /
salvakāmapradāṃ vidyāṃ saptarātreṇa tāṃ śṛṇu /
namastubhyaṃ bhagavate vāsudevāya dhīmahi // GarP_1,195.1 //
pradyumnāyāniruddhāya namaḥ saṅgarṣaṇāya ca /
namo vijñānamātrāya paramānandamūrtaye // GarP_1,195.2 //
ātmārāmāya śāntāya nivṛttadvaitadṛṣṭaye /
tvadrūpāṇi ca sarvāṇi tasmāttubhyaṃ namo namaḥ // GarP_1,195.3 //
hṛṣīkeśāya mahate namaste 'nantamūrtaye /
yasminnidaṃ yataścaitattiṣṭhatyagre 'pi jāyate // GarP_1,195.4 //
mṛnmayīṃ vahasi kṣoṇīṃ tasmai te brahmaṇe namaḥ /
yanna spṛśanti na viduḥ manobuddhīndriyāsavaḥ /
antarbahistvaṃ carasi vyomatulyaṃ namāmyaham // GarP_1,195.5 //
oṃ namo bhagavate mahāpurāṣāya mahābhūtapataye sakalasattvabhāvivrīḍanikarakamalareṇūtpalanibhadharmākhyavidyayā? caraṇāravindayugala parameṣṭhin namaste /
avāpa vidyādharatāṃ citraketośca vidyayā // GarP_1,195.6 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākye ācārakāṇḍe pañcanavatyadhikaśatatamo 'dhyāyaḥ

_____________________________________________________________

śrīgaruḍamahāpurāṇam- 196
hariruvāca /
avāpa japtvā cendratvaṃ viṣṇudharmākhyavidyayā /
sarvāñchatrūnvinirjitya tāñca vakṣye maheśvara // GarP_1,196.1 //
pādayorjānunorūrvorudare hṛdyathorasi /
mukhe śirasyānupūrvamoṅkā rādīni vinyaset // GarP_1,196.2 //
namo nārāyaṇāyeti viparyāsamathāpi ca /
karanyāsaṃ tataḥ kuryāddvādakṣaravidyayā // GarP_1,196.3 //
praṇavādiyakārāntamaṅgulyaṃ guṣṭhaparvasu /
nyaseddhṛdaya oṅkāraṃ manuṃ mūrdhni samastakam // GarP_1,196.4 //
oṅkārantu bhruvormadhye śikānetrādimūrdhataḥ /
oṃ viṣṇave iti imaṃ mantranyāsamudīrayet // GarP_1,196.5 //
ātmānaṃ paramaṃ dhyāyeccheṣaṃ yacchaktibhiryutam /
mama rakṣāṃ hariḥ kuryānmatsyamūrtirjale 'vatu // GarP_1,196.6 //
trivikramastathākāśe sthale rakṣatu vāmanaḥ /
aṭavyāṃ narasiṃhastu rāmo rakṣatu parvate // GarP_1,196.7 //
bhūmau rakṣatu vārāhau vyomni nārāyaṇo 'vatu /
karmabandhācca kapilo datto rogācca rakṣatu // GarP_1,196.8 //
hayagrīvo devatābhyaḥ kumāro makaradhvajāt /
nārado 'nyārcanāddevaḥ kūrmo vai nairṛte sadā // GarP_1,196.9 //
dhanvantīraścāpathyācca nāgaḥ krodhavaśātkila /
yajño rogātsamastācca vyāso 'jñānācca rakṣatu // GarP_1,196.10 //
buddhaḥ pāṣaṇḍasaṃghātātkalkī rakṣatu kalmaṣāt /
pāyānmadhyandine viṣṇuḥ prātarnārāyaṇo 'vatu // GarP_1,196.11 //
madhuhā cāparāhne ca sāyaṃ rakṣatu mādhavaḥ /
hṛṣīkeśaḥ pradoṣe 'vyātpratyūṣe 'vyājjanārdanaḥ // GarP_1,196.12 //
śrīdharo 'vyādardharātre padmanābho niśīthake /
cakrakaumodakībāṇā ghnantu śatrūṃśca rākṣasān // GarP_1,196.13 //
śaṅkhaḥ padmaṃ ca śatrubhyaḥ śārṅgaṃ vai garuḍastathā /
buddhīndriyamanaḥ prāṇānpāntu pārśvavibhūṣaṇaḥ // GarP_1,196.14 //
śeṣaḥ sarpasvarūpaśca sadā sarvatra pātu mām /
vidikṣu dikṣu ca sadā nārasiṃhaśca rakṣatu // GarP_1,196.15 //
etaddhārayamāṇaśca yaṃ yaṃ paśyati cakṣuṣā /
sa vaśī syādvipāpmā ca rogamukto divaṃ vrajet // GarP_1,196.16 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe ṣaṇṇavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 197
dhanvantariruvāca /
gāruḍaṃ saṃpravakṣyāmi garuḍena hyudīritam /
kaśyapāya sumitreṇa viṣahṛdyena gāruḍaḥ // GarP_1,197.1 //
pṛthivyāpastathā tejo vāyurākāśamevaca /
kṣityādiṣveva vargāśca hyete vai maṇḍalādhipāḥ // GarP_1,197.2 //
pañcatattve sthitā devāḥ prāpyante viṣṇusevakaiḥ /
dīrghasvaravibhinnāśca napuṃsakavivarjitāḥ // GarP_1,197.3 //
saṣaḍaṅgaḥ śivaḥ prokto hṛcchiraśca śikhā kramāt /
kavacaṃ netramastraṃ syānnyāsaḥ svasthalasaṃsthitiḥ // GarP_1,197.4 //
sarvasiddhipradasyānte kālavahnira dho 'nilaḥ /
ṣaṣṭhasvarasamāyuktamardhendusaṃyutaṃ param // GarP_1,197.5 //
parāparavibhinnāśca śivasyordhvādha īritāḥ /
repheṇāṅgeṣu sarvatra nyāsaṃ kuryādyathāvidhi // GarP_1,197.6 //
hṛdi pāṇitale dehe karṇe netre karoti ca /
japāttu sarvasiddhiḥ syāccaturvaktrasamāyutām // GarP_1,197.7 //
caturaśrāṃ suvistāraṃ pītavarṇāntu cintayet /
pṛthivīṃ cendradevatyāṃ madhye varuṇamaṇḍalam // GarP_1,197.8 //
madhye padmaṃ tathāyuktamardhacandraṃ suśītalam /
indranīladyutiṃ saumyamathavāgneyamaṇḍalam // GarP_1,197.9 //
trikoṇaṃ svasthikairyuktaṃ jvālāmā lānalaṃ smaret /
bhinnāñjananibhākāraṃ svavṛttaṃ bindubhūṣitam // GarP_1,197.10 //
kṣīrormisadṛśākāraṃ śuddhasphaṭikavarcasam /
plāvayantaṃ jagatsarvaṃ vyomāmṛtamanuṃsmaret // GarP_1,197.11 //
vāsukiḥ śaṅkhapālaśca sthitau pārthivamaṇḍale /
karkoṭaḥ padmanābhaśca vāruṇe tau vyavasthitau // GarP_1,197.12 //
āgneye cāpi kulikastakṣaścaiva mahābjakau /
vāyumaṇḍalasaṃsthau ca pañca bhūtāni vinyaset // GarP_1,197.13 //
aṅguṣṭhādikaniṣṭhāntamanulomavilomataḥ /
parvasandhiṣu ca nyasyā jayā ca vijayā tathā // GarP_1,197.14 //
āsyādisvapurasthāne nyasyācchivapaḍaṅgakam /
kaniṣṭhādau hṛdādau ca śikhāyāṃ karayornyaset // GarP_1,197.15 //
vyāpakantu tatvapūrvaṃ kramādaṅguliparvasu /
bhūtānāñca punarnyāsaḥ śivāṅgāni tathaiva ca // GarP_1,197.16 //
praṇavādinamaścānte nāmnaiva ca samanvitaḥ /
sarvamantreṣu kathito vidhiḥ sthāpanapūjane // GarP_1,197.17 //
ādyākṣaraṃ tannāmnaśca mantro 'yaṃ parikīrtitaḥ /
aṣṭānāṃ nāgajātīnāṃ mantraḥ sānnidhyakārakaḥ // GarP_1,197.18 //
oṃ svāhā kramaśaścaiva pañcabhūtapurogatam /
eṣa sākṣādbhavettārkṣyaḥ sarvakarmaprasādhakaḥ // GarP_1,197.19 //
karanyāsaṃ svaraiḥ kṛtvā śarīre tu punarnyaset /
jvalantaṃ cintayetprāṇamātmasaṃśuddhikārakam // GarP_1,197.20 //
bījantu cintayetpaścādvarṣāntamamṛtātmakam /
evañcāpyāyanaṃ kṛtvā mūrdhni sañcintya cātmanaḥ // GarP_1,197.21 //
pṛthivīṃ pādayordadyāttaptakāñcanasaprabhām /
aśeṣabhuvanākīrṇāṃ lokapālasamanvitām // GarP_1,197.22 //
etāṃ bhagavatīṃ pṛthvīṃ svadehe vinyased budhaḥ /
śyāmavarṇamayaṃ dhyāyetpṛthivīdviguṇaṃ bhavet // GarP_1,197.23 //
jvālāmālākulaṃ dīptamābrahmabhuvanāntakam /
nābhigrīvāntare nyasya trikoṇaṃ maṇḍalaṃ raveḥ // GarP_1,197.24 //
bhinnāñjananibhākāraṃ nikhilaṃ vyāpya saṃsthitam /
ātmamūrtisthitaṃ dhyāyedvāyavyaṃ tīkṣṇamaṇḍalam // GarP_1,197.25 //
sikhopari sthitaṃ divyaṃ śuddhasphaṭikavarcasam /
apramāṇamahāvyomavyāpakaṃ cāmṛtopamam // GarP_1,197.26 //
bhūtanyāsaṃ purā kṛtvā nāgānāñca yathākramam /
lakārāntā binduyutā mantrā bhūtakrameṇa tu // GarP_1,197.27 //
śivabījaṃ tato dadyāttato dhyāyecca maṇḍalam /
yoyasya kramākhyāto maṇḍalasya vicakṣaṇaḥ /
tasya taccintayedvarṇaṃ karmakāle vidhānavit // GarP_1,197.28 //
pādapakṣaistathā cañcatkṛṣṇanāgairvibhūṣitam /
tārkṣyaṃ dhyāyettato nityaṃ viṣe sthāvarajaṅgame // GarP_1,197.29 //
grahabhūtapiśāce ca ḍākinīyakṣarākṣase /
nāgairviveṣṭitaṃ kṛtvā svadehe vinyasecchivam // GarP_1,197.30 //
dvidhā nyāsaḥ samākhyāto nāgānāṃ caiva bhūtayoḥ /
evaṃ dhyātvā karma kuryādātmatattvādikaṃ kramāt // GarP_1,197.31 //
tritattvaṃ pratham dattvā sivatattvaṃ tataḥ param /
yathā dehe tathā deve aṅgulīnāṃ ca parvasu // GarP_1,197.32 //
dehe nyāsaṃ purā kṛtvā hyanulomavilomataḥ /
kandaṃ nālaṃ tathā padmaṃ dharmaṃ jñānādimeva ca // GarP_1,197.33 //
dvitīyasvarasambhinnaṃ vargāntena tu pūjayet /
śaumiti karṇikāmadhye mūrdhni repheṇa saṃyutam // GarP_1,197.34 //
akacaṭatapayaśā vargāḥ pūrvādike nyaset /
patrāntakesarānte tu dvau dvau pūrvādikau tathā // GarP_1,197.35 //
keśare tu svarānnyasyādīśāntānṣoḍaśārcayet /
vāmādyāḥ śaktayaḥ proktāstritattvantu tato nyaset // GarP_1,197.36 //
āvāhayettato mardhni śivamaṅgaṃ tataḥ param /
karṇikāyāṃ nyaseddevaṃ sāṃgaṃ tatra puraḥ saram // GarP_1,197.37 //
pṛtivī paścime patre āpaścottarasaṃsthitāḥ /
tejastu dakṣiṇe patre vāyuṃ pūrveṇa pūjayet // GarP_1,197.38 //
svabījaṃ mūrtirūpantu prāguktaṃ pārakalpayet /
yaṃ vāyumūlaṃ nairṛtye rephastvanalasaṃsthitaḥ // GarP_1,197.39 //
vaṃ ca tvīśe sadā pūjya oṃ hṛdisthañca pūjayet /
tanmātrānbhūtamātrāṃstānbahireva prapūjayet // GarP_1,197.40 //
śivāṅgāni tataḥ paścāddhyātvā saṃpūjayettataḥ /
āgneyyāṃ hṛdayaṃ pūjya śira īśānagocare // GarP_1,197.41 //
nairṛtye tu śikhāṃ dadyādvāyavyāṃ kavacaṃ nyaset /
astrantu bāhyato dadyānnetramuttarasaṃsthitam // GarP_1,197.42 //
patrāgre karṇikagre tu bījāni paripūjayet /
anantādikulīrāntā aṣṭau nāgāḥ kramātsthitāḥ // GarP_1,197.43 //
pūrvādikakrameṇaiva tvīśaparyantameva ca /
pūjayecca sadā mantrī vidhānena pṛthakpṛthak // GarP_1,197.44 //
hṛdi padme vidhānena śilādau dattamaṇḍale /
etatkāryaṃ samuddiṣṭaṃ nityanaimittike 'pi ca // GarP_1,197.45 //
ātmānaṃ cintayennityaṃ kāmarūpaṃ manoharam /
plāvayantaṃ jagatsarvaṃ sṛṣṭisaṃhārakārakam // GarP_1,197.46 //
jvālāmālābhiruddīptaṃ ābrahmabhuvanāntakam /
daśabāhuṃ caturvaktraṃ piṅgākṣaṃ śūlapāṇinam // GarP_1,197.47 //
daṃṣṭrākarālamatyugraṃ trinetraṃ śaśiśekharam /
bhairavantu smaretsiddhyai garuḍaṃ sarvakarmasu // GarP_1,197.48 //
nāgānāṃ nāśanārthāya garuḍaṃ bhīmabhīṣaṇam /
pādau pātālaṃ saṃsthau ca diśaḥ pakṣāstu saṃśritāḥ // GarP_1,197.49 //
sapta svargā urasi ca brahmāṇḍaṃ kaṇṭhamāśritam /
pūrvādīśānaparyantaṃ śirastasya vicintayet // GarP_1,197.50 //
sadāśivaśikhāntasthaṃ śaktitritayameva ca /
parātparaṃ śivaṃ sākṣāttārkṣyaṃ bhuvananāyakam // GarP_1,197.51 //
trinetramugrarūpañca viṣanāgakṣayaṅkaram /
grasanaṃ bhīmavaktraṃ ca garuḍaṃ mantravigraham // GarP_1,197.52 //
kālāgnimiva dīptaṃ ca cintayetsarvakarmasu /
evaṃ nyāsavidhiṃ kṛtvā yadyanmanasi cintayet // GarP_1,197.53 //
tattadeva bhavetsādhyaṃ naro vai garuḍāyate /
pretā bhūtāstathā yakṣā nāgā gandharvarākṣasāḥ /
darśanāttasya naśyanti jvarāścāturthikādayaḥ // GarP_1,197.54 //
dhanvantariruvāca /
evaṃ sa garuḍaṃ proce garuḍaḥ kaśyapāya ca /
maheśvaro yathā gaurīṃ prāha vidyāṃ tathā śṛṇu // GarP_1,197.55 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe saptanavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 198
bhairava uvāca /
nityaklinnāmatho vakṣye tripurāṃ bhuktimuktidām /
oṃ hrīṃ āgaccha devi aiṃ hrīṃ hrīṃ rekhākāraṇam /
oṃ hrīṃ kledinī bhaṃ namaḥ madanakṣobhiṇā tathā /
ai yaṃ yaṃ krīṃ vā guṇarekhayā hrīṃ madanāntare ca /
aiṃ hrīṃ hrīṃ ca nirañjanā vāgati madanāntarekhe khanetrāvalīti ca /
vegavati mahāpretāsanāya ca pūjayet /
oṃ hrīṃ kraiṃ naiṃ kraiṃ nityaṃ madadrave krīṃ namaḥ /
aiṃ hrīṃ tripurāyai namaḥ /
oṃ hrīṃ krīṃ paścimavaktraṃ oṃ aiṃ hrīṃ hrīṃ ca tathottaram /
aiṃ hrīṃ dakṣiṇamūrdhvaṃvaktraṃ tu paścimam /
oṃ hrīṃ pāśāya krīṃ aṅkuśāya aiṃ kapālāya namaḥ /
ādyaṃ bhayaṃ aiṃ hrīṃ ca tathā śiraḥ tathā śikhāyai kavace /
aiṃ hrīṃ krīṃ astrāyaphaṭ // GarP_1,198.1 //
pūrve kāmarūpāya asitāṅgāya bhairavāya namo brahmāṇyai /
dakṣiṇe cai kandāya vai namaḥ rurubhaivāya māheśvaryā vā āvāhayet // GarP_1,198.2 //
tathā paścime caṇḍāya vai namaḥ /
kaumāryai cottare colkāya krodhāya namaḥ vaiṣṇavyai // GarP_1,198.3 //
agnikoṇe aghorāyonmattabhairavāyeti vārāhyai /
rakṣaḥ koṇe sārāya kapāline bhairavāya māherndyai // GarP_1,198.4 //
vāyukoṇe jālandharāya bhīṣaṇāya bhairavāya cāmuṇḍāyai /
īśakoṇake vaṭukāya saṃhārañcaṇḍikāñca prapūjayet // GarP_1,198.5 //
ratiprītikāmadevānpañcabāṇānyajedatha /
dhyānārcanājjapyahomāddevī siddhā ca sarvadā // GarP_1,198.6 //
nityā ca tripurā vyādhiṃ hanyājjvālāmukhīkramāt /
jvālāmukhīkramaṃ vakṣye sā pūjyā madhyataḥ śubhā // GarP_1,198.7 //
nityāruṇā madanāturā mahāmohā prakṛtyapi /
mahendrāṇī ca kalanākarṣiṇī bhāratī tathā // GarP_1,198.8 //
brahmāṇī caiva māheśī kaumārī vaiṣṇavī tathā /
vārāhī caiva māhendrī cāmuṇḍā cāparājitā // GarP_1,198.9 //
vijayā cājitā caivamohinī tvaritā tathā /
stambhinī jṛmbhiṇī pūjyā kālikā padmabāhyataḥ /
jvālāmukhīkramaṃ cārcedviṣādiharaṇaṃ bhavet // GarP_1,198.10 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe aṣṭanavatyadhikaśatatamodhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 199
bhairava uvāca /
atha cūḍāmaṇiṃ vakṣye śubhāśubhaviśuddhaye /
sūryaṃ devīṃ gaṇaṃ soma smṛtvā tu vilikhennaraḥ // GarP_1,199.1 //
trirekhā gomūrtrikābhā athavā praśravākyataḥ /
diśasthānaprasūto vā dhvajādīngaṇayetkramāt // GarP_1,199.2 //
dhvajo dhūmo 'tha siṃhaśca śvā vṛṣaḥ kharadantinau /
dhvāṅkṣaśca aṣṭamo jñeyo nāma mantraiśca tānnyaset // GarP_1,199.3 //
dhvajasthāne dhvajaṃ dṛṣṭvā rājyacintādhanādikam /
dhvajasthāne sthito dhūmro dhātucintā ca lābhakṛt // GarP_1,199.4 //
dhvajasthāne sthite siṃhe dhanalābhādikaṃ bhavet /
sthite śunidhvajasthāne dāsīcintāsukhādikam // GarP_1,199.5 //
dhvajasthāne vṛṣaṃ dṛṣṭvā sthānacintā ca lābhakam /
dhvajasthāne kharaṃ dṛṣṭvā duḥ khakleśādikaṃ bhavet // GarP_1,199.6 //
dhvajasthāne gajaṃ dṛṣṭvā sthānacintājayādikam /
dhvajasthāne tathā dhvāṅkṣe kleśacintā dhanakṣayaḥ // GarP_1,199.7 //
dhūmrasthāne dhvajaṃ dṛṣṭvā pūrvaṃ duḥ khaṃ tato dhanam /
dhūmre dhūmraṃ tathā dṛṣṭvā kaliduḥ khādikaṃ bhavet // GarP_1,199.8 //
dhūmrasthāne sthite siṃhe manaścintādhanādikam /
dhūmrasthāne śuni sthite jayalābhādikaṃ bhavet // GarP_1,199.9 //
dhūmrasthāne vṛṣaṃ dṛṣṭvā nārīgo 'śvadhanādikam /
dhūmrasthāne kharaṃ dṛṣṭvā vyādhiścāpi dhanakṣayaḥ // GarP_1,199.10 //
dhūmrasthāne gaje dṛṣṭe rājyalābhajayādikam /
dhūmrasthāne sthite dhvāṅkṣe dhanarājyavināśanam // GarP_1,199.11 //
siṃhasthāne dhvajaṃ dṛṣṭvā rājyalābhādi nirdiśet /
siṃhasthāne sthite dhūmre kanyāprāptirdhanādikam // GarP_1,199.12 //
siṃhasthāne sthite siṃhe jayo mitrasamāgamaḥ /
kauleyake siṃhagate strīcintā grāmalābhakam // GarP_1,199.13 //
siṃha sthāne vṛṣaṃ dṛṣṭvā gṛhakṣetrārthalābhakam /
siṃhasthāne gajaṃ dṛṣṭvā grāmasvāmitvameva ca // GarP_1,199.14 //
siṃhasthāne gajaṃ dṛṣṭvā ārogyāyuḥ sukhādikam /
siṃhasthānesthite dhvāṅkṣe kanyādhānyaguṇādikam // GarP_1,199.15 //
śunaḥ sthāne dhvajaṃ dṛṣṭvā sthānacintāsukhādikam /
śunaḥ sthāne sthite dhūmre kalahaṃ kāryanāśanam // GarP_1,199.16 //
śunaḥ sthāna sthite siṃhe kāryāsiddhirbhaviṣyati /
sthite śuni śunaḥ sthāne dhananāśo bhaviṣyati // GarP_1,199.17 //
śunaḥ sthāne vṛṣaṃ dṛṣṭvā rogī rogādvi mucyate /
śunaḥ sthāne kharaṃ dṛṣṭvā kalahasya bhayaṃ bhavet // GarP_1,199.18 //
śunaḥ sthāne gajaṃ dṛṣṭvā putrabhāryāsamāgamaḥ /
śvasthāne ca sthite dhvāṅkṣe pīḍāsyātkulanāśanam // GarP_1,199.19 //
vṛṣasthāne dhvajaṃ dṛṣṭvā rājapūjāsukhādikam /
vṛṣasthāne sthite dhūmre rājapūjāsukhādikam // GarP_1,199.20 //
vṛṣasthāne sthite siṃhe saubhāgyañca dhanādikam /
sthite śuni vṛṣasthāne balaśrīkāma īritaḥ // GarP_1,199.21 //
vṛṣasthāne vṛṣaṃ dṛṣṭvā kīrtituṣṭisukhādikam /
vṛṣasthāne kharaṃ dṛṣṭvā mahālābhādikaṃ bhavet // GarP_1,199.22 //
vṛṣasthāne gajaṃ dṛṣṭvā strīgajādisamāgamaḥ /
vṛṣasthāne sthite dhvāṅkṣe sthānamānasamāgamaḥ // GarP_1,199.23 //
kharasthāne dhvajaṃ dṛṣṭvā rogaśokādikaṃ bhavet /
kharasthāne sthite dhūmre taskarādibhayaṃ bhavet // GarP_1,199.24 //
kharasthāne sthite siṃhe pūjāśrīvijayādikam /
sthite śunikharasthāne santāpadhananāśanam // GarP_1,199.25 //
kharasthāne vṛṣaṃ dṛṣṭvā sukhaṃ priyasamāgamaḥ /
kharasthāne kharaṃ dṛṣṭvā duḥ khīpīḍādi nirdiśet // GarP_1,199.26 //
kharasthāne gajaṃ dṛṣṭvā sukhaputtrādikaṃ bhavet /
kharasthāne sthite dhvāṅkṣe kalaho vyādhireva ca // GarP_1,199.27 //
gajasthāne dhvajaṃ dṛṣṭvā strījayaśrīsukhādikam /
gajasthānesthite dhūmre dhanadhānyasamāgamaḥ // GarP_1,199.28 //
gajasthāne sthite siṃhe jayasiddhisamāgamaḥ /
sthite śuni gajasthāne ārogyaṃ sukhasampadaḥ // GarP_1,199.29 //
gajasthāne vṛṣaṃ dṛṣṭvā rājamānadhanādikam /
gajasthāne kharaṃ dṛṣṭvā pūrvaṃ duḥ khaṃ tataḥ sukham // GarP_1,199.30 //
gajasthāne gajaṃ dṛṣṭvā kṣetradhānyasukhādikam /
gajasthānesthite dhvāṅkṣe dhanadhānyasamāgamaḥ // GarP_1,199.31 //
dhvāṅkṣasthāne dhvajaṃ dṛṣṭvā kāryanāśo bhaviṣyati /
dhvāṅkṣasthāne sthite dhūmre kaliduḥ khaṃ gamiṣyati // GarP_1,199.32 //
dhvāṅkṣasthāne sthite siṃhe vigraho duḥ khameva ca /
dhvāṅkṣasthāne sthite śvāne gṛhabhaṅgabhayādikam // GarP_1,199.33 //
dhvāṅkṣasthāne vṛṣaṃ dṛṣṭvā sthānabhraṃśabhayādikam /
dhvāṅkṣasthāne kharaṃ dṛṣṭvā dhananāśaparājayau // GarP_1,199.34 //
dhvāṅkṣasthāne gajaṃ dṛṣṭvā dhanakīrtyādikaṃ bhavet /
dhvāṅkṣasthāne sthite dhvāṅkṣe videśagamanādikam // GarP_1,199.35 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe navanavatyadhikaśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 200
bhairava uvāca /
vakṣye vāyujayaṃ devi jayā jayavideśakam /
vāyvagnijalaśakrākhyaṃ maṅgalānāñcatuṣṭayam // GarP_1,200.1 //
vāmadakṣiṇasaṃsthaśca vāyuśca bahulo bhavet /
ūrdhvavāhī bhavedagniradhastu varuṇo bhavet // GarP_1,200.2 //
mahendro madhyasaṃsthastu śuklapakṣe tu vāmagaḥ /
kṛṣṇapakṣe dakṣiṇaga udayasya tryahantryaham // GarP_1,200.3 //
vahetpratipadādye ca viparīte bhavennatiḥ /
udayaḥ sūryamārgeṇa candreṇāstamayo yadi // GarP_1,200.4 //
vardhante guṇasaṃghātā anyathā vighnamaucitam /
saṃkrāntyaḥ ṣoḍaśaproktā divā rātrau varānane // GarP_1,200.5 //
yadā ca saṃkramedvāyurardhārdhaprahare sthitaḥ /
svāsthyāhānistadā jñeyā vāyurbhramati dehiṣu // GarP_1,200.6 //
dakṣiṇe ca puṭe vāyurhito bhojanamaithune /
khaḍgahasto jayedyuddhe ripūnkāmasamanvitaḥ // GarP_1,200.7 //
vāmeva gamanaṃ śreṣṭhaṃ sarvakāryeṣu bhūṣitam /
vāyurvahati tatrasthaḥ praśro bhūtasya śobhanaḥ // GarP_1,200.8 //
māhendre vāruṇe vāte ko 'pi doṣo na jāyate /
anāvṛṣṭirdakṣavāhe vṛṣṭiḥ syādvāmavāhake // GarP_1,200.9 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe dviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 201
dhanvantariruvāca /
hayāyurvedamākhyāsye hayaṃ sarvārthalakṣaṇam /
kākatuṇḍaḥ kṛṣṇajihvo vṛkṣāsyaścoṣṇatālukaḥ // GarP_1,201.1 //
karālo hīnadantaśca śṛṅgī viraladantakaḥ /
ekāṇḍaścaiva jātāṇḍaḥ kañcukī dvikhurī stanī // GarP_1,201.2 //
mārjārapādo vyāghrābhaḥ kuṣṭhavidradhisannibhaḥ /
yamajo vāmanaścaiva mārjāraḥ kapilocanaḥ // GarP_1,201.3 //
etaddoṣī hayastyājya uttamo 'śvasturuṣkajaḥ /
madhyamaḥ pañcahastaśca kanīyāṃśca trihastakaḥ // GarP_1,201.4 //
asaṃhatā ye ca vāhā hrasvakarṇāstathaiva ca /
śabalābhāḥ prabhāveṣu na dīnāścirajīvinaḥ // GarP_1,201.5 //
revantapūjanāddhomādrakṣyāśca dvijabhājenāt /
saralaṃ nimbapatrāṇi guggulaṃ sarṣapānghṛtam? // GarP_1,201.6 //
tilañcaiva vacāṃ higuṃ badhnīyādvājino gale /
āgantujaṃ doṣajantu vraṇaṃ dvividhamīritam // GarP_1,201.7 //
cirapākaṃ vātajantu śleṣmajaṃ kṣiprapākakam? /
kaṇṭhadāhātmakaṃ pittācchoṇitānmandavedanam // GarP_1,201.8 //
āgantujantu śastrādyairduṣṭavraṇaviśodhanam /
eraṇḍamūlaṃ dviniśaṃ citrakaṃ viśvabheṣajam // GarP_1,201.9 //
rasonaṃ saindhavaṃ vāpi takrakāñjikapoṣitam /
tilasaktukapiṇḍikā dadhiyuktā sasaindhavā /
nimbapatrayutaṃ piṇḍaṃ vraṇaśodhanaropaṇam // GarP_1,201.10 //
paṭolaṃ nimbapatrañca vacā citrakameva ca /
pippalīśṛṅgaverañca cūrṇamekatra kārayet // GarP_1,201.11 //
etatpānātkrimiśleṣmamandānilavināśanam /
nimbapatraṃ paṭo lañca triphalā khadiraṃ tathā // GarP_1,201.12 //
kvāthayitvā tato vāhaṃ sṛtaraktaṃ vicakṣaṇaḥ /
tryahameva pridātavyaṃ hayakuṣṭhopaśāntaye // GarP_1,201.13 //
savraṇeṣu ca kuṣṭheṣu tailaṃ sarṣapajaṃ hitam /
laśunādikaṣāyaśca pānabhuktyupaśāntaye // GarP_1,201.14 //
mātuluṅgarasopetaṃ māṃsīnāṃ rasakena vā /
sadyo dadyāttatra nasyamanyairvātaiḥ susaṃyutaiḥ // GarP_1,201.15 //
paladvayaṃ prathame 'hni ekaikapalavṛddhitaḥ /
yāvaddināni pūrṇāni palānyaṣṭādaśottame // GarP_1,201.16 //
adhame 'ṣṭapalāni syurmadhyame syuścaturdaśa /
śarannidāghayornaivadeyaṃ naiva tu dāpayet // GarP_1,201.17 //
tailena vātike roge śarkarājyapayonvitaiḥ /
kaṭutailaiḥ kaphe vyoṣaiḥ pitte catriphalāmbubhiḥ // GarP_1,201.18 //
śāliṣaṣṭikadugdhāśī hayo hina jugupsitaḥ /
pakvajambūnibho hemavarṇo 'śvo na jugupsitaḥ // GarP_1,201.19 //
ardhapraharaṇe dhurye gugguluṃ prāśayeddhayam /
bhojayetpāyasaṃ dugdhaṃ satvaraṃ susthiro hayaḥ // GarP_1,201.20 //
vikāre bhojane dugdhaṃ śālyannaṃ vātale dadet /
karṣamāṃsarasaiḥ pitte madhumudgarasājyakaiḥ // GarP_1,201.21 //
kaphe mudgānkulatthānvā kaṭutiktānkaphe haye /
bādhirye vyādhite grāse tridoṣādau tu gugguluḥ // GarP_1,201.22 //
ghāsairdūrvā sarvaroge prathame 'hni palaṃ dadet /
vivardhayettataḥ karṣamekāhni palapañcakam // GarP_1,201.23 //
pāne ca bhojane caiva aśītipalakaṃ param /
madhye ṣaṣṭiścādhameṣu catvāriṃśacca bhogiṣu // GarP_1,201.24 //
vraṇe kuṣṭheṣu khañjeṣu triphalākvāthasaṃyutam /
mandāgnau śotharoge ca gavāṃ mūtreṇa yojitam // GarP_1,201.25 //
vātapitte vraṇe vyādhau gokṣīraṃ ghṛtasaṃyutam /
deyaṃ kṛśānāṃ puṣṭyarthaṃ māṃsairyuktaṃ ca bhojanam // GarP_1,201.26 //
supiṣṭāyāḥ pradātavyaṃ guḍūcyāḥ palapañcakam /
prabhāte ghṛtasaṃyuktaṃ śaradgīṣme ca vājinām // GarP_1,201.27 //
rogaghnaṃ puṣṭidaṃ cāpi balatejovivardhanam /
tadevāśvāyadātavyaṃ kṣīrayuktamathāpi vā // GarP_1,201.28 //
guḍūcīkalpayogena śatāvaryaśvagandhayoḥ /
catvāri trīṇi madhyasya jaghanyasya palāni hi // GarP_1,201.29 //
akasmādyatra vāhānāmekarūpaṃ yadā bhavet /
mriyate ca yadā kṣipramupasargaṃ tamādiśet // GarP_1,201.30 //
homādyai rakṣayā viprabhojanairbalikarmaṇā /
śāntyopasargaśāntiḥ syāddharītakyādikalpataḥ // GarP_1,201.31 //
harītakī gavāṃ mūtraistailena lavaṇānvitā /
ādau pañca tataḥ pañca vṛddhyā pūrṇaśatāvadhi /
uttamā ca śataṃ mātrāstvaśītiḥ ṣaṣṭireva vā // GarP_1,201.32 //
gajāyurvedamākhyāsye uktāḥ kalpā gaje hitāḥ /
gaje caturguṇā mātrāstābhirgajarugardanaḥ // GarP_1,201.33 //
gajo pasargavyādhīnāṃ śamanaṃ śāntikarma ca /
pūjayitvā surānviprānratnairgāṃ kapilāṃ dadet // GarP_1,201.34 //
dantidantadvaye mālāṃ nibandhīyādupoṣitaḥ /
mantreṇa mantritānvaidyairvacāsiddhārthakāṃstathā // GarP_1,201.35 //
sūryādiśivadurgāśrīviṣṇvarcā rakṣayedgajam /
baliṃ dadyācca bhūtebhyaḥ snāpayecca caturghaṭaiḥ // GarP_1,201.36 //
bhojanaṃ mantritaṃ dadyādbhasmanoddhūnayedgajamam /
bhūtarakṣā śubhā medhyā vāraṇaṃ rakṣayetsadā // GarP_1,201.37 //
triphalāpañcakole ca daśamūlaṃ viḍaṅgakam /
śatāvarīguḍūcī ca nimbavāsakakiṃśukāḥ // GarP_1,201.38 //
gajarogavināśāya hito rūkṣaḥ kaṣāyakaḥ /
āyurvedadvayoktānāmuktaṃ saṃkṣepasārataḥ // GarP_1,201.39 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe gajāśvāyurvedanirūpaṇaṃ nāmaikādhikadviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 202
hariruvāca /
ekaṃ punarnavāmūlamapāmārgasya vā śiva /
sarasaṃ yoniniḥ kṣiptaṃ varāṅgasya vyathāṃ haret /
prasūtivedanāñcaiva taruṇīnāṃ vyathāṃ haret // GarP_1,202.1 //
bhūmi kūṣmāṇḍamūlaṃ vai śālicūrṇamathāpi vā /
saptāhaṃ dugdhapītaṃ syātstrīṇāṃ bahupayaskaram // GarP_1,202.2 //
rudrendravāruṇīmulaṃ lepātstrīstanavedanā /
naśyeta ghṛtapakvā ca kāryāvaśyantu polikā // GarP_1,202.3 //
bhakṣitā sā maheśāna yoniśūlaṃ vināśayet /
pralepitā kāravellamūlenaiva vinirgatā // GarP_1,202.4 //
yoniḥ praveśamāyāti nātra kāryā vicāraṇā /
nīlīpaṭolamūlāni sājyāni tilavāriṇā // GarP_1,202.5 //
piṣṭānyeṣāṃ pralepo vai jvālāgardabharāganat /
pāṭhāmūlaṃ rudra pītaṃ piṣṭaṃ taṇḍulavāriṇā // GarP_1,202.6 //
pāparogaharaṃ syācca kuṣṭhapānaṃ tathaiva ca /
vāsyodakañca samadhu pītamantargatasya vai // GarP_1,202.7 //
pāparogasya santāpanivṛktiṃ kurute śiva /
ghṛtatulyā rudra lākṣā pītā kṣīreṇa vai saha // GarP_1,202.8 //
pradaraṃ harate rogaṃ nātra kāryā vicāraṇā /
dvijayaṣṭī trikaṭukaṃ cūrṇaṃ pītaṃ harecchiva // GarP_1,202.9 //
tilakvāthena saṃyuktaṃ raktagulmaṃ striyā hara /
kusumasya nibaddhañca taruṇīnāṃ maheśvara // GarP_1,202.10 //
raktotpalasya vai kandaṃ-śarkarātilasaṃyutam /
pītaṃ saśarkaraṃ strīṇāṃ dhārayedgarbhapātanam // GarP_1,202.11 //
raktastrāvasya nāśaḥ syācchītodakaniṣevaṇāt /
pītantu kāñjika rudra kvathitaṃ śarapuṅkhayā // GarP_1,202.12 //
hiṅgustraindhavasaṃyuktaṃ śīghraṃ strīṇāṃ prasūtikṛt /
mātuluṅgasya vai mūlaṃ kaṭibaddhaṃ prasūtikṛt // GarP_1,202.13 //
apāmārgasya vai mūle garbhavatyāstu nāmataḥ /
utpāṭyamāne sakale puttraḥ syādānyathā sutā // GarP_1,202.14 //
apāmārgasya vai mūle nārīṇāṃ śirasi sthite /
garbhaśūlaṃ vinaśyeta nātra kāryā vicāraṇā // GarP_1,202.15 //
karpūra-madanaphala-madhukaiḥ pūritaḥ śiva /
yoniḥ subhā syādvṛddhāyā yuvatyāḥ kiṃ punarhara // GarP_1,202.16 //
yasya bālasya tilakaḥ kṛto gaurocanākhyayā /
śarkarā-kuṣṭhapānañca dattaṃ sa syācca nirbhayaḥ /
viṣa-bhūta-grahādibhyo vyādhibhyo bālakaḥ śiva // GarP_1,202.17 //
śaṅkha-nābhi-vacā-kuṣṭha-lohānāṃ dhāraṇaṃ sadā /
bālānāmupasargebhyo rudra rakṣākaraṃ bhavet // GarP_1,202.18 //
palāśacūrṇaṃ samadhu gavyājyāmalakānvitam /
saviḍaṅgaṃ pītamātraṃ naraṃ kuryānmahāmatim // GarP_1,202.19 //
māsaikena mahādeva jarā-maraṇavarjitaḥ // GarP_1,202.20 //
palāśabījaṃ saghṛtaṃ tila-madhvanvitaṃ samam /
saptāhaṃ bhakṣitaṃ rudra jarāṃ nayati saṃkṣayam // GarP_1,202.21 //
rudrāmalakacūrṇaṃ vai madhu-taila ghṛtānvitam /
jagdhvā māsaṃ yuvā syācca naro vāgīśvarī bhavet // GarP_1,202.22 //
śivāmalakacūrṇaṃ vai madhunā udakena vā /
balāni kuryānnāsāyāḥ pratyūṣe bhakṣitaṃ śiva // GarP_1,202.23 //
kuṣṭhacūrṇaṃ sājya-madhu prātarjagdhvā bhavennaraḥ /
sākṣātsurabhideho vai jīvedvarṣasahasrakam // GarP_1,202.24 //
māṣasya vidalānye vituṣāṇi maheśvara /
ghṛtabhāvitaśuṣkāṇi payasā sādhitāni vai // GarP_1,202.25 //
samādhvājyapayobhiśca bhakṣayitvā ca kāmayet /
strīṇāṃ śataṃ mahādeva tatkṣaṇānnātra saṃśayaḥ // GarP_1,202.26 //
rasaścairaṇḍatailena gandhakena śubho bhavet /
trikālodakasaṃghuṣṭo balakṛdbhakṣaṇādbhavet // GarP_1,202.27 //
dugdhaṃ vituṣamāṣaiśca śimbābījaiśca sādhitam /
apāmārgasya tailena pītaṃ strīśatakāmakṛt // GarP_1,202.28 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe nānāvidhoṣadhaprayogānirūpaṇaṃ nāma dvyuttaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 203
hariruvāca /
yā gaurdveṣṭiṃ svakaṃ vatsaṃ tasyā deyaṃ svakaṃ payaḥ /
lavaṇena samāyuktaṃ tasyā vatsaḥ priyo bhavet // GarP_1,203.1 //
śuno 'sthi kaṇṭhabaddhaṃ hi mahiṣāṇāṃ gavā tathā /
kṛmijālaṃ pātayati sakalaṃ nātra saṃśayaḥ // GarP_1,203.2 //
gojaṅganābhipātaḥ syādguñjāmūlasya bhakṣaṇāt // GarP_1,203.3 //
varuṇaphalasyarasaṃ kareṇa mathitaṃ śiva /
catuṣpāda-dvipadayoḥ kṛmijālaṃ nipātayet // GarP_1,203.4 //
vraṇañca śamayedrudra jayāyāḥ pūraṇāt tathā /
gajamūtrasya vai pānaṃ go-mahiṣyupasarganut // GarP_1,203.5 //
samasūra śālibījaṃ pītaṃ takreṇa gharṣitam /
kṣīre go-mahīṣasyaiva goḥ puṃsaśca hitaṃ bhavet // GarP_1,203.6 //
patrañca śarapuṅkhāyā dattaṃ salavaṇaṃ śiva /
vārisphoṭaṃ hayānāñca kesarāṇāṃ vināśayet // GarP_1,203.7 //
ghṛtakumārīpatrameva dattaṃ salakṣaṇaṃ hara /
turagama-kesarāṇāṃ kaṇḍūnaṃśyenna saṃśayaḥ // GarP_1,203.8 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe nānauṣadhaprayoganirūpaṇaṃ nāma tryuttaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 204
sūta uvāca /
evaṃ dhanvantariḥ prāha suśrutāyaca vaidyakam /
ata nāmāni vakṣyāmi oṣadhīnāṃ samāsataḥ // GarP_1,204.1 //
sthirā vidārigandhā ca śālapaṇyaśumatyapi /
lāṅgalī kalasī caiva kroṣṭupucchā guhā matā // GarP_1,204.2 //
punarnavātha parṣābhūḥ kaṭhilyā kāruṇā tathā /
eraṇḍaścoruvūkaḥ syādāmardo vardhamānakaḥ // GarP_1,204.3 //
jhaṣā nāgabalā jñeyā śvadaṃṣṭrā gokṣuro mataḥ /
śatāvarī varā bhīru pīvarīndīvarī varī // GarP_1,204.4 //
vyāghrī tu bṛhatī kṛṣṇā haṃsapādī madhustravā /
dhāmanī kaṇṭakārī syātkṣudrā siṃhī nidigdhikā // GarP_1,204.5 //
vṛścikā tryamṛtā kālī viṣaghnī sarpadaṃṣṭrikā /
markaṭī cātmaguptā syādārṣeyī kapikacchukā // GarP_1,204.6 //
mudgaparṇo kṣudrasahā māṣaparṇo mahāsahā /
tyajā parā ca mahā jñeyā daṇḍayonyaṅkasaṃjñayā /
nyagrodhastu vaṭo jñeyaḥ aśvatthaḥ kapilo mataḥ // GarP_1,204.7 //
plakṣo 'tha gardabhāṇḍaḥ syātparkaṭī ca kapītanaḥ /
pārthastu kakubho dhanvi vijñeyor'junanāmabhiḥ // GarP_1,204.8 //
nandīvṛkṣaḥ prarohī syātpuṣṭikārīti cocyate /
vañjulo vetaso jñeyo bhallātaścāpyaruṣkaraḥ // GarP_1,204.9 //
lodhraḥ sāravako dhṛṣṭastirīṭaścāpi kīrtitaḥ /
bṛhatphalā mahājambūrjñeyā bālaphalā parā // GarP_1,204.10 //
tṛtīyā jalajambūḥ syānnādeyī sā ca kīrtitā /
kaṇā kṛṣṇopakuñcī ca śauṇḍī māgadhiketi ca // GarP_1,204.11 //
kathitā pippalī tajjñaistanmūlaṃ granthikaṃ smṛtam /
ūṣaṇaṃ maricaṃ jñeyaṃ śuṇṭhī viśvaṃ mahauṣadham // GarP_1,204.12 //
vyoṣaṃ kaṭutrayaṃ vidyāttryūṣaṇaṃ tacca kīrtyate /
lāṅgalī halinī ca syāccheyasī gaja pippalī // GarP_1,204.13 //
trāyantī trāyamāṇā syādutsāyā suvahā smṛtā /
citrakaḥ syācchikhī vahniragnisaṃjñābhirucyate // GarP_1,204.14 //
ṣaḍgranthogrā vacā jñeyā śvetā haimavatīti ca /
kuṭajo vṛkṣakaḥ śakro vatsako girimāllikā // GarP_1,204.15 //
kaliṅgendrayavāriṣṭaṃ tasya bījāni lakṣayet /
mustakto meghanāmā syātkauntī jñeyā hareṇukā // GarP_1,204.16 //
elā ca bahulā proktā sūkṣmailā ca tathā truṭiḥ /
padmā bhārṅgo tathā kāñjī jñeyā brāhmaṇayaṣṭikā // GarP_1,204.17 //
mūrvā madhurasā jñeyā tejanī tiktavallikā /
mahānimbo bṛhannimbo dīpyakaḥ syādyavānikā // GarP_1,204.18 //
viḍaṅgaṃ krimaśatruḥ syādrāmaṭhaṃ hiṅgurucyate /
ajājī jīrakaṃ jñeyā kāravī copakuñcikā // GarP_1,204.19 //
vijñeyā kaṭukā tiktā tathā kaṭukarohiṇī /
tagaraṃ syānnataṃ vakraṃ cocaṃ tvacavarāṅgakam // GarP_1,204.20 //
udīcyaṃ bālakaṃ proktaṃ hrīberaṃ cāmbunāmabhiḥ /
patrakaṃ dalasaṃjñābhiścārakaṃ taskarāhvayam // GarP_1,204.21 //
hemābhaṃ nāgasaṃjñābhirnāgakeśara ucyate /
asṛkkuṅkumamākhyātaṃ tathā kāśmīrabāhlikam // GarP_1,204.22 //
ayo lohaṃ samuddiṣṭaṃ yaugikairlohanāmabhiḥ /
puraṃ kuṭanaṭaṃ vidyānmahiṣākṣaḥ palaṅkaṣā // GarP_1,204.23 //
kāśmarī kaṭphalā jñeyā śrīparṇo ceti kīrtitā /
śallakī gajabhakṣyā ca patrī ca surabhī stravaḥ // GarP_1,204.24 //
dhātrīmāmalakīṃ vidyādakṣaścaiva vibhītakaḥ /
pathyābhayā ca vijñeyā pūtanā ca harītakī // GarP_1,204.25 //
triphalā phalamevoktā tacca jñeyaṃ phalatrikam /
udakīryo dīrghavṛntaḥ karañjaśceti kīrtitaḥ // GarP_1,204.26 //
yaṣṭī yaṣṭyāhvayaṃ proktaṃ madukaṃ madhuyaṣṭikā /
dhātakī tāmraparṇo syātsamaṅgā kuñjarā matā // GarP_1,204.27 //
sitaṃ malayajaṃ śītaṃ gośīrṣaṃ sitacandanam /
vidyādraktaṃ candanaṃ ca dvitīyaṃ raktacandanam // GarP_1,204.28 //
kākolī ca smṛtā vīrā vayasyā cārkapuṣpikā /
śṛṅgī karkaṭaśṛṅgī ca mahāghoṣā ca kīrtitā // GarP_1,204.29 //
tugākṣīrī śubhā vāṃśī vijñeyā vaṃśalocanā /
mṛdvikā ca smṛtā drākṣā tathā gostanikā matā // GarP_1,204.30 //
syāduśīraṃ mṛṇālañca sevyaṃ lāmajjakaṃ tathā /
sārañca gopavallī ca gopī bhadrā ca kathyate // GarP_1,204.31 //
dantī kaṭaṅkaṭerī ca jñeyā dāruniśeti ca /
haridrā rajanī proktā pītikā rātrināmikā // GarP_1,204.32 //
vṛkṣādanī chinnaruhā nīlavallī rasāmṛtā /
vasukoṭaśca vijñeyo vāśiraḥ kāmpillo mataḥ // GarP_1,204.33 //
pāṣāṇabhedako 'riṣṭo hyasmabhitkuṭṭabhedakaḥ /
ghaṇṭākaḥ śuṣkako jñeyo vaco 'tha sūcako mataḥ // GarP_1,204.34 //
suraso bījakaścaiva pītaśālo 'bhidhīyeta /
vajravṛkṣo mahāvṛkṣaḥ snuhī snukca sudhā guḍā // GarP_1,204.35 //
tulasīṃ surasāṃ vidyādupastheti ca kathyate /
kuṭherako 'pyarjunakaḥ parṇo saugandhiparṇikraḥ // GarP_1,204.36 //
nīlaśca sindhuvāraśca nirguṇḍīti sugandhikā /
jñeyā sugandhiparṇoti vāsantī kulajeti ca // GarP_1,204.37 //
kālīyakaṃ pītakāṣṭhaṃ katakākhyaḥ punaḥ smṛtaḥ /
gāyatrīkhadiro jñeyastadbhedaḥ kandaro mataḥ // GarP_1,204.38 //
indī varaṃ kuvalayaṃ padmaṃ nīlotpalaṃ smṛtam /
saugandhikaṃ śatadalamabjaṃ kamalamucyate // GarP_1,204.39 //
ajavarṇo bhavedūrjo vājikarṇo 'śvakarṇakaḥ /
śleṣmāntakastathā śelurbahuvāraśca kathyate // GarP_1,204.40 //
sunandakaḥ kakudbhadraṃ chatrākī chatrasaṃjñakā /
kabarī kumbhako dhṛṣṭaḥ kṣudvidho dhanakṛttathā // GarP_1,204.41 //
kṛṣṇārjakaḥ karālaśca kālamānaḥ prakīrtitaḥ /
prācī balā nadīkrāntā kākajaṅghātha vāyasī // GarP_1,204.42 //
jñeyā mūṣikaparṇo tu bhramantī cākhuparṇikā /
viṣamuṣṭirdrāvaṇañca keśamuṣṭirudāhṛtā // GarP_1,204.43 //
kiṃlihīṃ kaṭukīṃ vidyādantakaścāmlavetasaḥ /
aśvatthā bahupatrā ca vijñeyā cāmalakyapi // GarP_1,204.44 //
arūṣakraṃ patra śūkaṃ kṣīrī rājādanaṃ matam /
mahāpatraṃ dāḍimaṃ ca tameva karakaṃ vadet // GarP_1,204.45 //
masūrī vidalī śaṣpā kālindīti nirucyate /
kaṇṭakākhyā mahāśyāmā vṛkṣapādīti vakṣyate // GarP_1,204.46 //
vidyā kuntī nikumbhā ca tribhaṅgī tripuṭī trivṛt /
saptalā yavatiktā ca carmā carmakaseti ca // GarP_1,204.47 //
śaṅkhinī sukumārī ca tiktākṣī cākṣipīlukam /
gavākṣī cāmṛtā śvetā girikarṇo gavādinī // GarP_1,204.48 //
kāmpillako 'tha raktāṅgo guṇḍā rocaniketi ca /
hemakṣīrī smṛtā pītā gaurī vai kāladugdhikā // GarP_1,204.49 //
gāṅgerukī nāgabalā viśālā cendravāruṇī /
tārkṣyaṃ śailaṃ nīlavarṇamañjanañca rasāñjanam // GarP_1,204.50 //
niryāso yaśca śālmalyāḥ sa mocarasasaṃjñakaḥ /
pratyakpuṣpī kharī jñeyā apāmārgo mayūrakaḥ // GarP_1,204.51 //
siṃhāsyavṛṣavāsākamāṭarūṣakamādiśet /
jīvako jīvaśākaśca karburañca śaṭīṃ viduḥ // GarP_1,204.52 //
kaṭphalaṃ somavṛkṣaḥ syādagnigandhā sugandhikā /
śatāṅgaṃ śatapuṣpā ca miṃsirmadhurikāmatā // GarP_1,204.53 //
jñeyaṃ puṣkaramūlañca puṣkaraṃ puṣkarāhvayam /
yāso 'tha dhanvayāsaśca duṣparśo 'tha durālabhā // GarP_1,204.54 //
vākucī somarājī ca somavallīti kīrtitā /
mārkavaḥ keśarājaśca bhṛṅgarājo nigadyate // GarP_1,204.55 //
proktastveḍagajastajjñaiścakramardakasaṃjñakhaḥ /
suraṅgītagaraḥ snāyuḥ kalanāśā tu vāyasī // GarP_1,204.56 //
mahākālaḥ smṛto belastaṇḍulīyo ghanastanaḥ /
ikṣvākustiktatumbī syāttiktālaburnigadyate // GarP_1,204.57 //
dhāmārgavo 'tha koṣātakyatha yāminī /
vidyātkośatakībhedaṃ kṛtabhedanasaṃjñakā // GarP_1,204.58 //
tathā jīmūtakākhyā ca khuḍḍāko devatāḍakaḥ /
gṛdhranakhī gṛdhranakhī hiṅgukākādanī matā // GarP_1,204.59 //
aśvāriścaiva boddhavyaḥ karavīro 'śvamārakaḥ /
sindhuḥ saindhavasindhūtthamaṇimanthamudāhṛtam // GarP_1,204.60 //
kṣāro yavāgrajaścaiva yavakṣāro 'bhidhīyate /
sarjikā sarjikākṣāro dvitīyaḥ parikīrtitaḥ // GarP_1,204.61 //
kāśīśaṃ puṣpakāśīśaṃ vijñeyaṃ nettrabheṣajam /
dhātukāśīśakāśī ca saṃjñeyaṃ tacca kīrtitam // GarP_1,204.62 //
saurāṣṭrī mṛttikākṣāraṃ kākṣī vai paṅkaparpaṭī /
vidyātsamākṣikaṃ dhātu tāpyaṃ tāpyutthasambhavam // GarP_1,204.63 //
śilā manaḥ śilā jñeyā nepālī kulaṭīti ca /
ālaṃ manastālakaṃ vā haritālaṃ vinirdiśet // GarP_1,204.64 //
gandhako gandhapāṣāṇo rasaḥ pārada ucyate /
tāmramaudumbaraṃ śulbaṃ vidyānmlecchamukhaṃ tathā // GarP_1,204.65 //
adrisārastvayastīkṣṇaṃ lohakañcāpi kathyate /
mākṣikaṃ madhu ca kṣaudraṃ tacca puṣparasaṃ smṛtam // GarP_1,204.66 //
jyeṣṭhantu sodakaṃ tatsyātkāñjikantu suvīrakam /
sītā sitopalā caiva matsyaṇḍīśarkarā smṛtā // GarP_1,204.67 //
tvagelāpatrakaistulyaistrisugandhi trijātakam /
nāgakeśarasaṃyuktaṃ taccaturjātamiṣyate // GarP_1,204.68 //
pippalī pippalīmūlaṃ cavyacitrakanāgaraiḥ /
kathitaṃ pañcakolañca kolakaṃ kolasaṃjñayā // GarP_1,204.69 //
priyaṅguḥ kaṅgukā jñeyā koradūṣaśca kodravaḥ /
tripuṭaḥ puṭasaṃjñaśca kalāpo laṅgako mataḥ // GarP_1,204.70 //
satīno vartulaścaiva veṇuścāpi prakīrtitaḥ /
picukaṃ pitalaṃ cākṣaṃ biḍālapadakaṃ tathā // GarP_1,204.71 //
vidyātkarṣaṃ tathā cāpi suvarṇaṃ kavalagraham /
palārdhaṃ śuktimicchanti tathāṣṭaumāṣakāstviti // GarP_1,204.72 //
palaṃ bilvañca muṣṭiḥ syāddve pale prasṛtiṃ vadet /
añjaliṃ kuḍavañcaiva vidyātpalacatuṣṭayam // GarP_1,204.73 //
aṣṭamānaṃ palānyaṣṭau tacca mānamiti smṛtam /
caturbhiḥ kuḍavaiḥ prastha prasthāścatvāra āḍhakaḥ // GarP_1,204.74 //
kāśapātrañca saṃprokto droṇaścacaturāḍhake /
tulā palaśataṃ proktaṃ bhāgo viṃśatpalaḥ smṛtaḥ // GarP_1,204.75 //
mānamevaṃ vidhaṃ proktaṃ prasthadravyeṣu paṇḍitaiḥ /
dravadravyeṣu coddiṣṭaṃ dviguṇaṃ parikīrtitam // GarP_1,204.76 //
bhadradāru devakāṣṭhaṃ dāru syāddevadārukam /
kuṣṭhamāmayamākhyātaṃ māṃsīñca naladaṃśanam // GarP_1,204.77 //
śaṅkhaḥ śuktinakhaḥ śaṅkho vyāghro vyāghranakhaḥ smṛtaḥ /
puraṃ palaṅkaṣaṃ vidyānmahiṣākṣañca gugguluḥ // GarP_1,204.78 //
raso gandharaso bole sarjaḥ sarjaraso mataḥ /
priyaṅguḥ phalinī śyāmā gaurī kānteti cocyate // GarP_1,204.79 //
karañjau naktamālaḥ syātpūtikaścirabilvakaḥ /
śigruḥ śobhāñjano nāma jñānamānaśca kīrtitaḥ // GarP_1,204.80 //
jayā jayantī śaraṇī nirguṇḍī sindhuvārakaḥ /
moraṭā pīluparṇo ca tuṇḍī syāttuṇḍikerikā // GarP_1,204.81 //
madano gālavo bodho ghoṭā ghoṭī ca kathyate /
caturaṅgula sampāko vyādhighātābhisaṃjñakaḥ // GarP_1,204.82 //
vidyādāragvadhaṃ rājavṛkṣaṃ raivatasaṃjñakam /
dantī kākendutiktā syātkaṇṭakī ca vikaṅkataḥ // GarP_1,204.83 //
nimbo 'riṣṭaḥ samākhyātaḥ paṭolaṃ kolakaṃ viduḥ /
vayasthā ca viśalyā ca cchinnā chinnaruhā matā // GarP_1,204.84 //
vaśā dantyamṛtā ceti guḍūcīnāmasaṃgrahaḥ /
kirātatiktakaścaiva bhūnimbaḥ kāṇḍatiktakaḥ // GarP_1,204.85 //
sūta uvāca /
nāmānyetāni ca hare vanyānāṃ bheṣajāṃ tathā /
ato vyākaraṇaṃ vakṣye kumāroktañca śaunaka // GarP_1,204.86 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe caturattaradviśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 205
kumāra uvāca /
atha vyākaraṇaṃ vakṣye kātyāyana samāsataḥ /
siddhaśabdavivekāya bālavyutpattihetave // GarP_1,205.1 //
suptiṅantaṃ padaṃ khyātaṃ supaḥ sapta vibhaktayaḥ /
svaujasaḥ prathamā proktā sā prātipadikātmake // GarP_1,205.2 //
sambodhane ca liṅgādāvukte karmaṇi kartari /
arthavatprātipadikaṃ dhātupratyayavarjitam // GarP_1,205.3 //
amauśaso dvitīyā syāttatkarma kriyate ca yat /
dvitīyā karmaṇi proktāntarāntareṇa saṃyute // GarP_1,205.4 //
ṭābhyāṃbhisastṛtīyā syātkaraṇe kartarīritā /
yena kriyate karaṇaṃ tatkartā yaḥ karoti saḥ // GarP_1,205.5 //
ṅebhyāṃbhyasaścaturtho syātsampradāne ca kārake /
yasmai ditsā dhārayate rocate sampradānakam // GarP_1,205.6 //
pañcamī syānṅasibhyāṃbhyohyapādāne ca kārake /
yato 'paiti samādatte upādatte bhayaṃ yataḥ // GarP_1,205.7 //
ṅasosāmaśca ṣaṣṭhī syātsvāmisambandhamukhyake /
ṅayoḥ supo vai saptamī syātsā cādhikaraṇe bhavet // GarP_1,205.8 //
ādhāraścādhikaraṇaṃ rakṣārthānāṃ prayogataḥ /
īpsitaṃ cānīpsitaṃ yattadapādānakaṃ smṛtam // GarP_1,205.9 //
pañcamī paryupāṅyoge itararte 'nyadiṅmukhe /
enayoge dvitīyā syātkarmapravacanīyakaiḥ // GarP_1,205.10 //
vīpsetthambhāvacihne 'bhirbhāgenaiva paripratī /
anureṣu sahārthe ca hīne 'nūpaśca kathyate // GarP_1,205.11 //
dvitīyā ca caturtho syācceṣṭāyāṃ gatikarmaṇi /
aprāṇe hi vibhaktī dbe manyakarmaṇyanādare // GarP_1,205.12 //
namaḥ svastisvadhāsvāhālaṃvaṣaḍyoga īritā /
caturtho caiva tādarthye tumarthādbhāvavācinaḥ // GarP_1,205.13 //
tṛtīyā sahayoge syātkutsiteṅge viśeṣaṇe /
kāle bhāve saptamī syādetairyoge 'piṣaṣṭhyati // GarP_1,205.14 //
svāmīśvarādhipatibhiḥ sākṣidāyādaprasūtaiḥ /
nirdhāraṇe dve vibhakto ṣaṣṭhī hetuprayogake // GarP_1,205.15 //
smṛtyarthakarmaṇi tathā karoteḥ pratiyatnake /
hiṃsārthānāṃ prayoge ca kṛti karmaṇi kartari // GarP_1,205.16 //
na kartṛkarmaṇoḥ ṣaṣṭhī niṣṭhayoḥ prātipadike /
dvividhaṃ prātipadikaṃ nāma dhātustathaiva ca // GarP_1,205.17 //
bhūvāndibhyastiṅo laḥ syāllakārā daśa vai smṛtāḥ /
tiptasūjhi prathamo madhyaḥ sipthasthottamapūruṣaḥ // GarP_1,205.18 //
mibvasmastu parasmai hi padānāṃ cātmanepadam /
tātāñjha prathamo madhya sthāsāthāndhvamathottamaḥ // GarP_1,205.19 //
ādeśā iḍbahimahi dhātutotha ṇijādivat /
nāmni prayujyamāne 'pi prathamaḥ puruṣo bhavet // GarP_1,205.20 //
madhyamo yuṣmadi prokta uttamaḥ puruṣo 'smadi /
bhūvādyā dhātavaḥ proktāḥ sanādyantāstathā tataḥ // GarP_1,205.21 //
laḍīrito vartamāne smenātīte ca dhātutaḥ /
bhūte 'nadyatane laṅvā loḍādyāśiṣi dhātutaḥ // GarP_1,205.22 //
vidhyādāvevānumato loḍvācyo mantraṇe bhavet /
nimantraṇādhīṣṭasaṃpraśre prārthaneṣu tathāśiṣi // GarP_1,205.23 //
liṅatīte parokṣe syālliḍ bhūte ḷḍ bhaviṣyati /
syādanadyatane tadvadbhaviṣyati tu dhātutaḥ // GarP_1,205.24 //
dātorḷṅ kriyātipattau liṅarthe leṭ prakīrtitaḥ /
kṛtastriṣvapi vartante bhāve karmaṇi kartari // GarP_1,205.25 //
sadṛśāstavyatā ṇyadyadanīyāśca tṛjādayaḥ // GarP_1,205.26 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vyākaraṇanirūpaṇaṃ nāma pañcottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 206
sūta uvāca /
siddhodāharaṇaṃ vakṣye saṃhitādipuraḥ saram /
viprāḥ svasāgatā vīdaṃ suttamaṃ syātpitṝṣabhaḥ // GarP_1,206.1 //
ḷkāro viśrutā sevaṃ lāṅgalīṣā manīpayā /
gaṅgodakaṃ tavalkāra ṛṇārṇaṃ prārṇamityapi // GarP_1,206.2 //
śītārtaśca tavalkāraḥ saindrī saukāra ityapi /
vadhvāsanañca pitrartho lanubandho naye jayet // GarP_1,206.3 //
nāyako lavaṇaṃ gāvasta ete na ta īśvarāḥ /
devīgṛhamatho atra a avehi paṭū imau // GarP_1,206.4 //
amī aśvāḥ ṣaḍasyeti tanna vāk ṣaḍdalāni ca /
taccarettallu nātīti tajjalaṃ tacchmaśānakam // GarP_1,206.5 //
sugannatra pacannatra bhavāṃśchādayatīti ca /
bhavājjhanatkaraścaiva bhavāṃstarati saṃsmṛtam // GarP_1,206.6 //
bhavāṃllikhati tāñcakre bhavāñśete 'pyanīdṛśaḥ /
bhavāṇḍīnaṃ tvantarasi tvaṅkaroṣi sadārcanam // GarP_1,206.7 //
kaścaretkaṣṭakāreṇa ka kuryātka phale sthitaḥ /
kaḥśete caiva kaḥṣaṇḍaḥ kasko yāti ca gauravam // GarP_1,206.8 //
ka ihātra ka evāhurdevā āhuśca bho vraja /
svabhūrviṣṇurvrajati ca gīṣpatiścaiva dhūrpatiḥ // GarP_1,206.9 //
asmāneṣa vrajetsasyādṛksāma sa ca gacchati /
kuṭīcchāyā tathā chāyā sandhayo 'nye tathedṛśāḥ // GarP_1,206.10 //
samāsāḥ ṣaṭ samākhyātāḥ sa dvijaḥ karmadhārayaḥ /
dvigustrivedī grāmaśca ayaṃ tatpuruṣaḥ smṛtaḥ // GarP_1,206.11 //
tatkṛtaśca tadarthaśca vṛkabhītiśca yaddhanam /
jñānadakṣeṇa tattvajño bahuvrīhirathāvyayī // GarP_1,206.12 //
bhāvo 'dhistri yathoktaṃ tu dvandvo devarṣimānavāḥ /
taddhitāḥ pāṇḍavaḥ śaivo brāhayaṃ ca brahmatādayaḥ // GarP_1,206.13 //
devāgnisakhipatyaṃśukroṣṭusvāyambhuvaḥ pitā /
nā praśastāścarā gaurglaurabajantāśca puṃsyapi // GarP_1,206.14 //
halantaścāśvayukkṣmābhuṅmarutkravyānmṛgāvidhaḥ /
ātmā rājā yuvā panthāḥ pūṣabrahmahaṇau halī // GarP_1,206.15 //
viḍve dhā uśanānaḍvānmadhuliṭ kāṣṭhataṭ tathā /
banavāryasthivastūni jagatsāmāhanī tathā // GarP_1,206.16 //
karmasarpirvapusteja ajjhalantā napuṃsake /
jāyā jarā nadī lakṣmīḥ śrīstrībhūmirvadhūrapi // GarP_1,206.17 //
bhrūḥ punarbhūstathā dhenuḥ svasā mātā ca nau striyaḥ /
vāksragdiṅmutkrudhaḥ prāyo yuvatiḥ kukubhastathā // GarP_1,206.18 //
dyodivau prāvṛṣaścaiva sumāna uṣṇigastriyām /
guṇadravyakriyāyogātstrīliṅgāṃśca vadāmi te // GarP_1,206.19 //
śuklakīlālapāścaiva śuciśca grāmaṇīḥ sudhīḥ /
paṭuḥ kamalabhūḥ kartā sumato bahavaḥ sunauḥ // GarP_1,206.20 //
satyā nāgnyastathā puṃso hyabhakṣayata dīrghapāt /
sarvaviśvobha ye cobhau ekonyānyatarāṇi ca // GarP_1,206.21 //
ḍataro ḍatamo nemastvaḥ samo 'tha simetarau /
pūrvaścaivādharaścaiva dakṣiṇaścottarāvarau // GarP_1,206.22 //
paraścāntaramapyetadyattyatkimadasastvidam /
yuṣmadasmattatprathamacaramālpatayārdhakāḥ // GarP_1,206.23 //
tathā katipayo dvau cetyevaṃ sarvādayastathā /
śṛṇotyādyā juhotiśca jahātiśca dadhātyapi // GarP_1,206.24 //
dīpyatiḥ stūyatiścaiva puttrīyati dhanīyati /
truṭyati mriyate caiva cicīṣati ninīṣati // GarP_1,206.25 //
sarve tiṣṭhanti sarvasmai sarvasmātsarvanto gataḥ /
sarveṣāṃ caiva sarvasminnevaṃ viśvādayastathā // GarP_1,206.26 //
pūrve pūrvāśca pūrvasmātpūrvasminpūrva īritaḥ /
sūta uvāca /
suptiṅantuṃ siddharūpaṃ nāmamātreṇa darśitam /
kātyāyanaḥ kumārāttu śrutvā vistaramabravīt // GarP_1,206.27 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamān- ācāradṛ nāma ṣaḍuttaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 207
sūta uvāca /
vāsudevaṃ guruṃ natvā gaṇaṃ śambhuṃ sarasvatīm /
mātrāvarṇaprabhedena cchando vakṣye 'lpabuddhaye // GarP_1,207.1 //
sarvādimadhyāntagalau mnau bhyau jrau stau trikā gaṇāḥ /
āryā catuṣkalādyantasarvamadhye caturgaṇāḥ // GarP_1,207.2 //
vyañjanānto visargāntau dīrgho yuktaparo guruḥ /
sānusvāraśca pādānto vā ityukto dvimātrakaḥ // GarP_1,207.3 //
yadā nāpi kramaṃ yoge laghutāpi kvacidguroḥ /
ślokacāryādisaṃjñā syādyatirvicchedasaṃjñikā // GarP_1,207.4 //
jñeyaḥ pādaśca turyāṃśo yuk samaṃ viṣamantvayuk /
samamardhasamaṃ vṛttaṃ viṣamañca tṛtīyakam // GarP_1,207.5 //
iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe chandaḥ śāstrechandaḥsaṃjñāparibhāṣānirūpaṇaṃ nāma saptottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 208
sūta uvāca /
āryālakṣma tvaṣṭa gaṇāḥ sadā jo viṣame na hi /
ṣaṣṭhe jo nlau vāpi bhavet padaṃ ṣaṣṭhe dvitīyalāt // GarP_1,208.1 //
āditaḥ saptame hrasvā dvitīyārdhe śare tataḥ /
trigaṇāṅghriśca pathyā syādvipulā vahnilaṅghanāt // GarP_1,208.2 //
gmadhye dvituryau jau capalā mukhapūrvādicāpalā /
dvitīyārdhe sajaghanā āryājāteśca lakṣaṇam // GarP_1,208.3 //
āryā prathamārdhalakṣma gītiḥ syācceddaladvaye /
upagītirdvitīyārdhādudgītirvyatyayādbhavet // GarP_1,208.4 //
āryāgītiścāntagururgotijāteśca lakṣaṇam /
ṣaṭ kalā viṣame cetsyuḥ same 'ṣṭau na nirantarāḥ /
samā parāśritā na syādvaitālīye ralau guruḥ // GarP_1,208.5 //
anter yau pūrvavadidamaupacchandasikaṃ matam // GarP_1,208.6 //
bhādgau syādāpātalikā jñeyātho dakṣiṇāntikā /
parāśrito dvitīyo laḥ pādeṣu nikhileṣvapi // GarP_1,208.7 //
udīcyavṛttirasame prācyavṛttistu yugmake /
sapañcamaścaturthāṃśe yugapattau pravṛttakam // GarP_1,208.8 //
udīcyādyaṅghrisaṃyogādyugmapādaikapādikā /
cāruhāsinyayugmāṅghrau vaitālīyasya saṃgrahaḥ // GarP_1,208.9 //
vaktraṃ nādyānnasau syātāṃ caturthādyagaṇo bhavet /
pathyāvaktraṃ jena same viparītādiranyathā // GarP_1,208.10 //
usame naśca capalā vipulā laghusaptamā /
nikhile vā saitavasya mrau ntau cābdhestatpūrvakau // GarP_1,208.11 //
ṣoḍaśalo 'caladhṛtirmātrāsamakamucyate // GarP_1,208.12 //
navamalastathā go 'ntyaḥ jo nlauvāthāmbudheryathā /
viślokaḥ syāttaccatuṣkadviguṇādvānavāsikā // GarP_1,208.13 //
bāṇāṣṭanavakeṣu syāllaścitrā ṣoḍaśātmikā /
samamātrāsamādiṣṭaṃ padākulakamīritam // GarP_1,208.14 //
vṛttamātrā vinā varṇairlā varṇā gurubhirvinā /
guruvo lairdale nityaṃ pramāṇamiti niścitam // GarP_1,208.15 //
aṣṭāviṃśātilā gantā prathamārdhe dvitīyake /
triṃśadasyāṃ śikhā gantā khañjātadvyatyayādbhavet // GarP_1,208.16 //
ṣoḍaśānaṅgakrīḍā gā dvātriṃśaccarame ca lāḥ /
saptaviṃśātilā gantā dalayo rucirā dvayoḥ // GarP_1,208.17 //
mātrāvṛttāni coktāni varṇavṛttāni vacmi vai // GarP_1,208.18 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe chandaḥ śāstre āryāvṛttādichandolakṣaṇanirūpaṇaṃ nāmāṣṭottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 209
sūta uvāca /
śrīrukthā gena sā jñeyā utyukthā strī gurudvayam /
mo nārī ro mṛgī madhyā magau kanyā pratiṣṭhayā // GarP_1,209.1 //
bho gau paṅktiḥ suprātiṣṭhā tanumadhyā tayau smṛtā /
nayābhyāṃ bālalalitā gāyatrīcchanda eva hi // GarP_1,209.2 //
masagairmadalekhā syāduṣṇikchandaḥ smṛtaṃ budhaiḥ /
bhau gau citrapadā khyātā vidyunmālā mamau gagau // GarP_1,209.3 //
māṇavakaṃ bhāttalagā mnau gau haṃsarutaṃ smṛtam /
samānikā rajagalā jaralā gaḥ pramāṇikā /
ābhyāmanyadvitānaṃ syādanuṣṭupchanda īritam // GarP_1,209.4 //
ranasaiḥ syāddhalamukhī nau maḥ śiśubhṛtā bhavet /
bṛhatīchanda ityuktaṃ smau jagau sa virājitam // GarP_1,209.5 //
paṇavaṃ syānmanayagairmayūrasāriṇī bhavet /
rajābhyāñca ragābhyāñca rukmavatī bhamau sagau // GarP_1,209.6 //
mattā mabhasagairyuktā narajā go manoramā /
paṅkticchandaḥ samākhyātaṃ jasatā gāvupasthitam // GarP_1,209.7 //
tau jo gāvindravajrā syājjatajgā gupapūrvikā // GarP_1,209.8 //
upajātayo 'nyādyantāḥ sumukhī najajā lagau /
bhabhabhā gau dodhakaṃ syācchālinī matatā gagau // GarP_1,209.9 //
abdhilokaiśca vicchedo vātorṃmo mamatā gagau /
śrīrbhatau nanagāḥ proktā pañcabhiḥ ṣaḍūbhireva ca // GarP_1,209.10 //
maganā no go bhramaravilāsitamudāhṛtam /
rathoddhatār nau ralagāḥ svāgatā ranabhā gagau // GarP_1,209.11 //
vṛttā nanau sagau gaḥ syānnau ralau gaḥ samadrikā /
rajarā lgau śyenikā syājjasatā gau śikhaṇḍitam /
triṣṭupchandaḥ samākhyātaṃ piṅgalena mahātmanā // GarP_1,209.12 //
ranau bhasau candravartma vaṃśasthaṃ syājjatau jarau /
tato jarāvindravaṃśā vedasaistoṭakaṃ smṛtam /
nbhau bhrau drutavilambitaṃ puṭaśca syānnanau mayau // GarP_1,209.13 //
vasuvedaiśca viratirmuditavadanā tviyam /
nanararaiḥ samākhyātā nayanā yastathā bhavet // GarP_1,209.14 //
sā tu kusumavicitrā jaloddhatagatī rasaiḥ /
jasau jasau ca pādeṣu catūraiḥ stragviṇī matā // GarP_1,209.15 //
bhujaṅgaprayātaṃ vṛttaṃ catubhiryaiḥ prakīrtitam /
prayaṃvadā nabhajraiśca maṇimālā tayau tayau // GarP_1,209.16 //
guhavaktraiśca sannidrā lalitā syāttabhau jarau /
pramitākṣarā sajasasairujjvalā tu nanau bharau // GarP_1,209.17 //
mamau yayau vaiśvadevī pañcāśvaiśca yatirbhavet /
mabhau samau jaladharamālābdhyantyairyatibhavet // GarP_1,209.18 //
nau tatau gaḥ kṣamāvṛttaṃ turagaiśca rasairyatiḥ /
praharṣiṇī manau jrau gā vahnibhirdaśabhiryatiḥ // GarP_1,209.19 //
jabhau sajau go rucirā caturbhiśca grahairyatiḥ /
mattamayūraṃ matayāḥ sagau devagrahairyatiḥ // GarP_1,209.20 //
mañjubhāṣiṇī sajsā jgau sunandinī sajasā magau /
nanau tatau candrikā gaḥ saptabhiśca rasairyatiḥ // GarP_1,209.21 //
asambādhā matanasā gagau bāṇagrahairyatiḥ /
nanarāḥ so ladhuguruḥ svaraiḥ proktāparājitā // GarP_1,209.22 //
nanau bhanau praharaṇakalikeyaṃ lagau tathā /
vasantatilakā siṃhonnatā tabhjā jagau guruḥ // GarP_1,209.23 //
bhajau sanau gagāvinduvadanātha sukeśaram /
naranā ralagāḥ pāde śarkarī pratipāditā // GarP_1,209.24 //
caturdaśalaghuḥ syācca śreṣṭhā śaśikalā sagā /
rasagrahayatiḥ sraksrā vasuśailayatistathā // GarP_1,209.25 //
syānmaṇiguṇanikaro mālinī nanamā yayau /
vasusvarayatiḥ syācca najau bhajrāḥ prabhadrakam // GarP_1,209.26 //
elā sayau nanau yaḥsyāccitralekhāsvarāṣṭakaiḥ /
marau mayau yaśca bhavedukteyamati śarkarī // GarP_1,209.27 //
svarātkhaṃ vṛṣabhagajajṛmbhitaṃ bhrananā nagau /
najabhajarā vāṇinī gaḥ piṅgalenāṣṭirīritā // GarP_1,209.28 //
rasarudraiḥ śikhariṇī yamau nasabhalā guruḥ /
vasugrayatiḥ pṛthvī jasau jasayalā guruḥ // GarP_1,209.29 //
daśasvarairvaṃśapatrapatitaṃ bhraunnabhā lagau /
ṣaḍvedāśvaiśca hariṇī nasamā rasalā guruḥ // GarP_1,209.30 //
mandākrāntabdhiṣaḍnagairmabhanāstatagā guruḥ /
nardaṭakaṃ najabhajā jalau go yatireva ca // GarP_1,209.31 //
saptartvabdhiḥ kokilakamatyaṣṭiḥ syācca pūrvavat /
bhūtartvaśvaiḥ kusumitalatā mtau nyau yayau dhṛtiḥ // GarP_1,209.32 //
rasartvaśvairyamau nsau rau meghavisphūrjitā ragau /
śārdūlavikrīḍitaṃ maḥ sūryaśvaiḥ sajsatāstagau // GarP_1,209.33 //
chando hyatidhṛtiḥ proktamata ūrdhvaṃ kṛtirbhavet /
saptāśvartuḥ suvadanā bhrau manau yabhalā guruḥ // GarP_1,209.34 //
vṛttaṃ rajau rajau pāde rajau go laḥ kṛtirbhavet /
trisaptakaiḥ snagdharā syātprakṛtirmnabhanaistriyaiḥ // GarP_1,209.35 //
digarkairbhadrakaṃ bhrau nrau naranā go yathākṛtiḥ /
najau bhaśvāśvalalitaṃ jabhau jabhalagā bhavet // GarP_1,209.36 //
mattākrīḍañcāṣṭabāṇadaśakairmau tanau nanau /
nalau guruśca vikṛtiśchinnā saṃkṛtirucyate // GarP_1,209.37 //
pañcāśvārkairbhatau tanvī nasabhā bhanayā gaṇāḥ /
krauñcapadā bāṇaśaravasuśailairbhamau sabhau // GarP_1,209.38 //
nau nau go 'tikṛtiḥ proktā cchando hyutkṛtirucyate /
vasvīśāśvairmamatanaiḥ syādbhujaṅgavijṛmbhitam // GarP_1,209.39 //
nanarasairlagayuktaiśca apavāhākhyakaṃ yatiḥ /
guhaiḥ ṣaḍbhī rasairbāṇairmonāḥ ṣaṭsagagā gaṇāḥ // GarP_1,209.40 //
caṇḍavṛttiprapāto 'sau daṇḍako nau tato 'garaḥ /
raphevṛddhāntakādasya vyālajīmūtakādayaḥ // GarP_1,209.41 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe samavṛttalakṣaṇādinirūpaṇaṃ nāma navottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 210
sūta uvāca /
sasasalagāśca viṣame pāde yadyupacitrakam /
same bhau bhagagāḥ syuśca drutamadhyā bhabhau bhagau // GarP_1,210.1 //
gaḥ pāde viṣame 'nyatra najau jyau ca gaṇau smṛtau // GarP_1,210.2 //
viṣame vegavatī sā gaḥ same bhau bho gagau gaṇāḥ /
pāde 'same tajau ro gaḥ same masau jagau garuḥ /
bhavedbhadravirāṭ ketumatī tu viṣame sajau // GarP_1,210.3 //
sagau same bhrau nagagā ākhyānakī tvathāsame /
tau jo gagau same pāde jatajā gurukadvayam // GarP_1,210.4 //
viparītākhyānakaṃ syādviṣame jastajau gagau /
tatau jagau same gaḥ syāt piṅgalena hyudāhṛtam // GarP_1,210.5 //
pāde 'tha viṣame caiva puṣpitāgrā nanau rayau /
same najau jarau gaśca vaitālīyaṃ vadanti hi /
vṛttañcāparavaktrākhyamaupacchandasikaṃ param // GarP_1,210.6 //
vāṅmatī rajarā yaḥ syādayugme jarajā ragau // GarP_1,210.7 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍer'ddhasamavṛttalakṣaṇādinirūpaṇaṃ nāma daśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 211
sūta uvāca /
prathamo 'ṣṭākṣaraiḥ pādo dvitīyo dvādaśākṣaraiḥ /
tṛtīyaḥ ṣoḍaśārṇaiśca viṃśadvarṇaiścaturthakaḥ // GarP_1,211.1 //
sāmānyalakṣaṇaṃ padacaturūrdhvābhiradhasya hi // GarP_1,211.1 //
āpīḍaḥ sarvalaḥ proktaḥ pūrvapādāntagadvayaḥ // GarP_1,211.2 //
dvitīye 'ṣṭākṣaraiḥ pāde kalikā prathamer'kaje /
lavalī syāttṛtīye 'tha pūrvavaccāṣṭa kākṣare /
proktā cāmṛtadhāreyaṃ caturaṣṭākṣare sati // GarP_1,211.3 //
(iti padacaturūrdhvaprakaraṇam) /
sajau salau ca prathame nasajā go dvitīyake /
tṛtīye bhanabhā gaśca caturthe sajasā jagau // GarP_1,211.4 //
pūrvavatsyātsaurabhakaṃ tṛtīye 'ghrau ranau bhagau /
lalitañcādgatāvatsyātṛtīyeṃ'ghrau nanau sasau // GarP_1,211.5 //
(ityudgatāprakaraṇam) /
upasthitapracupitaṃ prathame 'ghrau masau jabhau /
gau dvitīye sanajarā gastṛtīye nanau ca saḥ /
nau najau yaścaturthe syāccheṣa pādāśca pūrvavat // GarP_1,211.6 //
tṛtīrye 'ghrau viśeṣaśca vṛttaṃ syānnau sanau nasau // GarP_1,211.7 //
ārṣabhaṃ tajarāḥ pāde tṛtīye 'nyacca pūrvavat /
pūrvavatprathamaṃ śeṣe tajrāḥ śuddhavirāḍbhavet // GarP_1,211.8 //
(ityupasthitapracupitaprakaraṇam) /
viṣamākṣarapādaṃ vā pañcaṣaṭkādi yāvakam /
chando 'tra noktā gātheti daśadharṃmādivadbhavet // GarP_1,211.9 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe viṣamavṛttalakṣaṇādinirūpaṇaṃ nāmaikādaśottaradviśaśatatamo 'dhyāyaḥ


_____________________________________________________________
śrīgaruḍamahāpurāṇam- 212
sūta uvāca /
prastāra ādyago 'tho laḥ paratulyo 'tha pūrvagaḥ /
naṣṭamadhye sameṃ'ke laḥ same 'rdhe viṣame guruḥ // GarP_1,212.1 //
pratilomaguṇaṃ lādyaṃ dviruddiṣṭaka ekanut // GarP_1,212.2 //
saṃkhyā dvirardhe rūpe tu śūnyaṃ śūnye dvirīritam /
tāvadardhe tadguṇitaṃ dvirdvyūnantu tadantataḥ // GarP_1,212.3 //
pare pūrṇaṃ pare pūrṇaṃ meruḥ prastārato bhavet // GarP_1,212.4 //
lagasaṃkhyā vṛttasaṃkhyā cādyāṅgulamathordhvataḥ /
saṃkhyaiva dviguṇaikonācchandaḥ sāro 'yamīritaḥ // GarP_1,212.5 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamān- ācā- chandolakṣaṇaṃ nāma dvādaśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 213
sūta uvāca /
hareḥ śrutvābravīdbrahmā yathā vyāsāya śaunaka /
brāhmaṇādisamācāraṃ sarvadaṃ te tathā vade // GarP_1,213.1 //
śrutismṛtī tu vijñāya śrautaṃ karma samācaret /
śrautaṃ karma na ceduktaṃ tadā smārtaṃ samācaret // GarP_1,213.2 //
tatrāpyaśaktaḥ karaṇe sadācāraṃ caredvudhaḥ /
śrutismṛtī ha viprāṇāṃ locane karmadarśane // GarP_1,213.3 //
śrutyuktaḥ paramo dharmaḥ smṛtiśāstragato 'paraḥ /
siṣṭācāreṇa saṃprāptastrayo dharmāḥ sanātanāḥ // GarP_1,213.4 //
satyaṃ dānaṃ dayālobho vidyejyā pūjanaṃ damaḥ /
aṣṭau tāni pavitrāṇi śiṣṭācārasya lakṣaṇam // GarP_1,213.5 //
tejomayāni pūrveṣāṃ śarīrāṇīndriyāṇi ca /
na lipyate pātakena padmapatramivāmbhasā // GarP_1,213.6 //
nivāsamukhyā varṇānāṃ dharmācārāḥ prakīrtitāḥ /
satyaṃ yajñastapo dānametaddharmasya lakṣaṇam // GarP_1,213.7 //
adattasyānupādānaṃ dānamadhyayanaṃ japaḥ /
vidyā vittaṃ tapaḥ śaucaṃ kule janma tvarogitā // GarP_1,213.8 //
saṃsārocchittihetuśca dharmādeva pravartate /
dharmātsukhaṃ ca jñānaṃ ca jñānānmokṣo 'dhigamyate // GarP_1,213.9 //
ijyādhyayanadānāni yathāśāstraṃ sanātanaḥ /
brahmakṣattriyavaiśyānāṃ sāmānyo dharma ucyate // GarP_1,213.10 //
yājanādhyayane śuddhe viśuddhācca pratigrahaḥ /
vṛttitrayamidaṃ prāhurmunayaḥ śreṣṭhavarṇinaḥ // GarP_1,213.11 //
śastreṇājīvanaṃ rājño bhūtānāñcābhirakṣaṇam /
pāśupālyaṃ kṛṣiḥ paṇyaṃ vaiśyasyājīvanaṃ smṛtam // GarP_1,213.12 //
śūdrasya dvijaśuśrūṣā dvijānāmanupūrvaśaḥ /
gurau vāso 'gniśuśrūṣā svādhyāyo brahmacāriṇaḥ // GarP_1,213.13 //
triḥ snātā snāpitā bhaikṣyaṃ gurau prāṇāntikī sthitiḥ /
samekhalo jaṭī daṇḍī muṇḍī vā gurusaṃśrayaḥ // GarP_1,213.14 //
agnihotropacaraṇaṃ jīvanaṃ ca svakarmabhiḥ /
dharmadāreṣu kalpeta parvavarjaṃ ratikriyāḥ // GarP_1,213.15 //
devapitratitibhyaśca pūjādiṣvanukalpanam /
śrutismṛtyarthasaṃsthānaṃ dharmo 'yaṃ gṛhamedhinaḥ // GarP_1,213.16 //
jaṭitvamagnihotratvaṃ bhūśayyājinadhāraṇam /
vane vāsaḥ payomūlanīvāraphalavṛttitā // GarP_1,213.17 //
pratiṣiddhānnivṛttiśca triḥ snānaṃ vratadhāritā /
devatātithipūjā ca dharmo 'yaṃ vanavāsinaḥ // GarP_1,213.18 //
sarvārambhaparityāgo bhikṣānnaṃ vṛkṣamūlatā /
niṣparigrahatādrohaḥ samatā sarvajantuṣu // GarP_1,213.19 //
priyāpriyapariṣvaṅgesukhaduḥ khādhikāritā /
sabāhyābhyantare śaucaṃ vāgyamo dhyānacāritā // GarP_1,213.20 //
sarvaidriyasamāhāro dhāraṇādhyānanityatā /
bhāvasaṃśuddhiretyeṣa parivrāḍdharma ucyate // GarP_1,213.21 //
ahiṃsā sūnṛtā vāṇī satyaśauce kṣamā dayā /
varṇināṃ liṅgināṃ caiva sāmānyo dharma ucyate // GarP_1,213.22 //
yathoktakāriṇaḥ sarve prayānti paramāṃ gatim /
ā bodhātsvapanaṃ yāvat gṛhidharmaṃ ca vacmi te // GarP_1,213.23 //
brāhme muhūrte budhyeta dharmārthau cānucintayet /
kāyakleśāṃśca tanmūlānvedatattvārthameva ca // GarP_1,213.24 //
śarvaryante samutthāya kṛtaśaucaḥ samāhitaḥ /
snātvā sandhyāmupāsīta sarvakālamatandritaḥ // GarP_1,213.25 //
prātaḥ sandhyāmupā sīta dantadhāvanapūrvikām /
ubhe mūtrapurīṣe ca divā kuryādudaṅmukhaḥ // GarP_1,213.26 //
rātrau ca dakṣiṇe kuryādubhe sandhye yathā divā /
chāyāyāmandhakāre vā rātrau vāhani vā dvijaḥ // GarP_1,213.27 //
yathā tu samukhaḥ kuryātprāṇabādhābhayeṣu ca /
gomayāṅgāravalmīkaphālākṛṣṭe śubhe // GarP_1,213.28 //
mārgopajīvyacchāyāsu na mūtraṃ ca purīṣakam /
antarjalāddevagṛhādvalmīkānmūṣikasthalāt // GarP_1,213.29 //
pareṣāṃ śaucaśiṣṭācca śmaśānācca mṛdaṃ tyajet /
ekāṃ liṅge mṛdaṃ dadyādvāma haste mṛdaṃ dvidhā // GarP_1,213.30 //
ubhayordve ca dātavye mūtraśaucaṃ pracakṣate /
ekāṃ liṅge gude tistrastathā vāmakare daśa // GarP_1,213.31 //
pañca pāde daśaikasminkarayoḥ saptamṛttikāḥ /
ardhaprasṛtimātrā tu prathamā mṛttikā smṛtā // GarP_1,213.32 //
dvitīyā ca tṛtīyā ca tadardhā parikīrtitā /
upaviṣṭastu viṇmūtraṃ kartuṃ yastu na vindati // GarP_1,213.33 //
sa kuryādardhaśaucaṃ tu svasya śaucasya sarvadā /
divā śaucasya rātryardhaṃ yadvā pādo vidhīyate // GarP_1,213.34 //
svasthasya tu yathoddiṣṭamārtaḥ kuryādyathābalam /
vasā śukramasṛṅ majjā lālā viṇmūtrakarṇaviṭ // GarP_1,213.35 //
śleṣmāśradūṣikā svedo dvādaśaite nṛṇāṃ malāḥ /
manyeta yāvatā śuddhiṃ tāvacchaucaṃ samācaret // GarP_1,213.36 //
pramāṇaṃ śaucasaṃkhyāyā nādiṣṭairavaśiṣyate /
śaucaṃ tu dvividhaṃ proktaṃ bāhyamābhyantaraṃ tathā // GarP_1,213.37 //
mṛjjalābhyāṃ smṛtaṃ bāhyaṃ bhāvaśuddhirathāntaram /
trirācāmedapaḥ pūrvaṃ dviḥ pramṛjyāttato mukham // GarP_1,213.38 //
saṃmṛjyāṅguṣṭhamūlena tribhirāsyamupaspṛśet /
aṅguṣṭhena pradeśinyā ghrāṇaṃ paścādanantaram // GarP_1,213.39 //
aṅguṣṭhānāmikābhyāṃ ca cakṣuḥ śrotre punaḥ punaḥ /
kaniṣṭhāṅgaṣṭhayornābhiṃ hṛdayaṃ tu talena vai // GarP_1,213.40 //
sarvābhistu śiraḥ paścādbāhū cāgreṇa saṃspṛśet /
ṛco yajūṃṣi sāmāni triḥ paṭhanprīṇayetkramāt // GarP_1,213.41 //
atharvāṅgirasau pūrvaṃ dviḥ pramārṣṭyatha tansukham /
itihāsapurāṇāni vedāṅgāni vedāṅgāni yathākramam // GarP_1,213.42 //
khaṃ mukhe nāsike vāyuṃ netre sūryaṃ śrutī (tīrdi) diśaḥ /
prāṇagranthimatho nābhiṃ brahmāṇaṃ hṛdaye spṛśet // GarP_1,213.43 //
rudraṃ mūrdhnā samālabhya prīṇātyatha śikhāmṛṣīn /
bāhū yamendravaruṇakuberavasudhānalān // GarP_1,213.44 //
abhyukṣya caraṇau viṣṇumindraṃ viṣṇu karadvayam /
agnirvāyuśca sūryendugirayo 'ṅguliparvasu // GarP_1,213.45 //
gaṅgādyāḥ saritastāsu yā rekhāḥ karamadhyagāḥ /
uṣaḥ kāle tu saṃprāpte śaucaṃ kṛtvā yathārthavat // GarP_1,213.46 //
tataḥ snānarṃ pkurvīta dantadhāvanapūrvakam /
mukhe paryuṣite nityaṃ bhavatyaprayato naraḥ // GarP_1,213.47 //
tasmātsarvaprayatnena kuryādvai dantaghāvanam /
kadambabilvakhadirakaravīravaṭārjunāḥ // GarP_1,213.48 //
yūthī ca bṛhatī jātī karañjārkātimuktakāḥ /
jambūmadhūkā pāmārgaśirīṣodumbarāsanāḥ // GarP_1,213.49 //
kṣīrikaṇṭakivṛkṣādyāḥ praśastā dantadhāvane /
kaṭutiktakaṣāyāśca dhanārogyasukhapradāḥ // GarP_1,213.50 //
prakṣālya bhuktvā ca śucau deśe tyaktvā tadācāmet /
amāyāṃ ca tathā ṣaṣṭhyāṃ navamyāṃ pratipadyapi // GarP_1,213.51 //
varjayeddantakāṣṭhantu tathaivārkasya vāsare /
abhāve danta kāṣṭhasya niṣiddhāyāṃ tathā tithau // GarP_1,213.52 //
aṣāṃ dvādaśagaṇḍūṣaiḥ kurvīta mukhaśodhanam /
prātaḥ snānaṃ praśaṃsanti dṛṣṭādṛṣṭakaraṃ hitam // GarP_1,213.53 //
sarvamar hati śuddhātmā prātaḥ snāyī japādikam /
atyantamalinaḥ kāyo navacchidrasamanvitaḥ // GarP_1,213.54 //
stravatyeṣa divā rātrau prātaḥ snānaṃ viśodhanam /
manaḥ prasādajananaṃ rūpasaubhāgyavardhanam // GarP_1,213.55 //
śokaduḥ khapraśamanaṃ gaṅgāsnānavadācaret /
adya haste tu nakṣatre daśamyāṃ jyeṣṭhake site // GarP_1,213.56 //
daśapāpa harāyāṃ ca adatvā dānakalmaṣam /
viruddhācaraṇaṃ hiṃsā paradāropasevanam // GarP_1,213.57 //
pāruṣyānṛtapaiśunyamasambaddhābhibhāṣaṇam /
paradravyābhidhānaṃ ca manasāniṣṭacintanam // GarP_1,213.58 //
etaddaśāghaghātārthaṃ gaṅgāsnānaṃ karomyaham /
prātaḥ saṃkṣepataḥ snānaṃ vānaprasthagṛhasthayoḥ // GarP_1,213.59 //
yatestriṣavaṇaṃ snānaṃ sakṛtta brahmacāriṇaḥ /
ācamya tīrthamāvāhya snāyātsmṛtvāvyayaṃ harim // GarP_1,213.60 //
tisraḥ koṭyastu vijñeyā mandehā nāma rākṣasāḥ /
udayantaṃ durātmānaḥ sūryamicchanti khāditum // GarP_1,213.61 //
sa hanti sūryaṃ sandhyāyāṃ nopāstiṃ kurute tu yaḥ /
dahanti mantrapūtena toyenānalarūpiṇā // GarP_1,213.62 //
ahorātrasya yaḥ sandhiḥ sā sandhyā bhavatīti ha /
dvināḍikā bhavetsandhyā yāvadbhavati darśanam // GarP_1,213.63 //
gandhyākarmāvasāne tu svayaṃ homo vidhīyate /
svayaṃ homaphalaṃ yattu tadanyena na jāyate // GarP_1,213.64 //
ṛtvikputro gururbhrātā bhāgineyo 'tha viṭpatiḥ /
ebhireva hutaṃ yattu taddhutaṃ svayameva hi // GarP_1,213.65 //
brahmā vai gārhapatyāgnirdakṣaṇāgnistrilocanaḥ /
viṣṇurāhavanīyāgniḥ kumāraḥ satya ucyate // GarP_1,213.66 //
kṛtvā homaṃ yathākālaṃ saurānmantrāñjapettataḥ /
samāhitātmā sāvitrīṃ praṇavaṃ ca yathoditam // GarP_1,213.67 //
praṇave nityayuktasya vyāhṛtīṣu ca saptasu /
tripadāyāṃ ca sāvitryāṃ na bhayaṃ vidyate kvacit // GarP_1,213.68 //
gāyattrīṃ yo japennityaṃ kalyamutthāya mānavaḥ /
lipyate na sa pāpena padmapatramivāmbhasā // GarP_1,213.69 //
śvetavarṇā samuddiṣṭā kauśaiyavasanā tathā /
akṣasūtradharā devī padmāsanagatā śubhā // GarP_1,213.70 //
āvāhya yajupānena tejo 'sīti vidhānataḥ /
etadyajuḥ purā daivairdṛṣṭidarśanakāṅkṣibhiḥ // GarP_1,213.71 //
ādityamaṇḍalāntaḥ sthāṃ brahmalokasthitāmapi /
tatrāvāhya japitvāto namaskārādvisarjayet // GarP_1,213.72 //
pūrvāhna eva kurvīta devatānāṃ ca pūjanam /
na viṣṇoḥ paramo devastasmāttaṃ pūjayetsadā // GarP_1,213.73 //
brahmaviṣṇuśivāndevānna pṛthagbhāvayetsudhīḥ /
loke 'sminmaṅgalānyaṣṭau brāhmaṇo gaurhutāśanaḥ // GarP_1,213.74 //
hiraṇyaṃ sarpirāditya āpo rājā tathāṣṭamaḥ /
etāni satataṃ paśyedarcayecca pradakṣiṇam // GarP_1,213.75 //
vedasyādhyayanaṃ pūrvaṃ vicārobhyasanaṃ japaḥ /
taddānaṃ caiva śiṣyabhyo vedābhyāso hi pañcadhā // GarP_1,213.76 //
vedārthaṃ yajñaśāstrāṇi dharmaśāstrāṇi caiva hi /
mūlyena lekhayitvā yo dadyādyāti sa vaidikam // GarP_1,213.77 //
itihā sapurāṇāni likhitvāyaḥ prayacchati /
brahmadānasamaṃ puṇyaṃ prāpnoti dviguṇīkṛtam // GarP_1,213.78 //
mṛtīye ca tathā bhāge poṣyavargārthasādhanam /
mātā pitā gururbhrātā prajā dīnāḥ samāśritāḥ // GarP_1,213.79 //
abhyāgato 'tithiścāgniḥ poṣyavargā udāhṛtaḥ /
bharaṇaṃ poṣyavargasya praśastaṃ svargasādhanam // GarP_1,213.80 //
bharaṇaṃ poṣya vargasya tasmādyatnena kārayet /
sa jīvati varaścaiko bahubhiryopajīvyati // GarP_1,213.81 //
jīvanto mṛtakāstvanye puruṣāḥ svodarambharāḥ /
svakīyodarapūrtiśca kukkurasyāpi vidyate // GarP_1,213.82 //
arthebhyo 'pi vivṛddhebhyaḥ sambhūtebhyastatastataḥ /
kriyāḥ sarvāḥ pravartante parvatebhya ivāpagāḥ // GarP_1,213.83 //
sarvaratnākarā bhūmirdhānyāni paśavaḥ striyaḥ /
arthasya kāryayogitvādartha ityabhidhīyate // GarP_1,213.84 //
adroheṇaiva bhūtānāmalpadroheṇa vā punaḥ /
yā vṛttistāṃ samāsthāya vipro jīvedanāpadi // GarP_1,213.85 //
dhanaṃ tu trividhaṃ jñeyaṃ śuklaṃ śabalameva ca /
kṛṣṇaṃ ca tasya vijñeyo vibhāgaḥ saptadhā pṛthak // GarP_1,213.86 //
kramāyattaṃ prītidattaṃ prāptaṃ ca saha bhāryayā /
aviśeṣeṇa sarveṣāṃ varṇānāṃ trividhaṃ dhanam // GarP_1,213.87 //
vaiśeṣikaṃ dhanaṃ dṛṣṭaṃ brāhmaṇasya trilakṣaṇam /
yājanādhyāpane nityaṃ viśuddhaśca (ddhācca) pratigrahaḥ // GarP_1,213.88 //
trividhaṃ kṣatriyasyāpi prāhurvaiśeṣikaṃ dhanam /
śuddhārthaṃ labdhakarajaṃ daṇḍāptaṃ jayajaṃ tathā // GarP_1,213.89 //
vaiśeṣikaṃ dhanaṃ dṛṣṭaṃ vaiśyasyāpi vilakṣaṇam /
kṛṣigorakṣavāṇijyaṃ śūdrasyaibhyastvanugrahāt // GarP_1,213.90 //
kusīdakṛṣivāṇijyaṃ prakurvīta svayaṃ param (kṛtam) /
āpatkāle svayaṃ kurvannainasā yujyate dvijaḥ // GarP_1,213.91 //
bahavo vartanopāyā ṛṣibhiḥ parikīrtitāḥ /
sarveṣāmapi caivaiṣāṃ kusīdamadhikaṃ viduḥ // GarP_1,213.92 //
anāvṛṣṭyā rājabhayānmūṣikādyairupadravaiḥ /
kṛṣyādike bhavedbādhā sā kusīde na vidyate // GarP_1,213.93 //
śuklapakṣe tathā kṛṣṇe rajanyāṃ divasepi vā /
uṣṇe varṣati śīte vā vardhanaṃ na nivartate // GarP_1,213.94 //
deśaṃ gatānāṃ yā vṛddhirnānāpaṇyopajīvinām /
kusīdaṃ kurvataḥ samyak saṃsthitasyaiva jāyate // GarP_1,213.95 //
labdhalābhaḥ pitṝndevānbrāhmaṇāṃścaiva pūjayet /
te tṛptāstasya taddoṣaṃ śamayanti na saṃśayaḥ // GarP_1,213.96 //
vaṇikkusīdaṃ dadyādyo vastraṃ gāṅkāñcanādikam /
kṛṣīvalo 'nnapānādiyānaśayyāsanāni ca // GarP_1,213.97 //
rājabhyo viṃśatiṃ dattvā paśusvarṇādikaṃ śatam /
pādenāsya ca yāvakyaṃ kuryātsaṃcayamātmavān // GarP_1,213.98 //
ardhena cātmabharaṇaṃ nityanaimittikāṃnvitam /
pādaṃ cetyarthayāmasya mūlabhūtaṃ vivardhayet // GarP_1,213.99 //
vidyā śilpaṃ bhūtiḥ sevā gorakṣā vipaṇiḥ kṛṣiḥ /
vṛttirbhaikṣyaṃ kusīdaṃ ca daśa jīvanahetavaḥ // GarP_1,213.100 //
pratigrahārjitā vipre kṣatriye śastranirjitā /
vaiśye nyāyārjitāḥ svārthāḥ śūdre śuśrūṣayārjitāḥ // GarP_1,213.101 //
nadī bahūdakā śākamṛtparṇāni samitkuśāḥ /
āgneyo brahmaghoṣaśca viprāṇāṃ dhanamuttamam // GarP_1,213.102 //
ayācitopapanne tu nāsti doṣaḥ pratigrahe /
amṛtaṃ tadvidurdevāstasmāttannaiva varjayet // GarP_1,213.103 //
gurudravyāṃścaujjihīrṣurarciṣyande vatātithīn /
sarvataḥ pratigṛhṇīyānna tuṣyettu svayaṃ tataḥ // GarP_1,213.104 //
sādhutaḥ pratigṛhṇīyādatha vāsādhuto dvijaḥ /
guṇavānalpadoṣaśca nirguṇo hi nimajjati // GarP_1,213.105 //
evaṃ tvakṣavṛttyā vā kṛtvā bharaṇamātmanaḥ /
kuryādviśuddhiṃ parataḥ prāyaścittaṃ dvijottamaḥ // GarP_1,213.106 //
caturthe ca tathā bhāge snānārthaṃ mṛda māharet /
tilapuṣpakuśādīni snānaṃ cākṛtrime jale // GarP_1,213.107 //
nityaṃ naimittikaṃ kāmyaṃ kriyāṅgaṃ malakarṣaṇam /
mārjanācamāvagāhāścāṣṭasnānaṃ prakīrtitam // GarP_1,213.108 //
asnātastu pumānnārhe japāgnihavanādiṣu /
prātaḥ snānaṃ tadarthaṃ tu nityasnānaṃ prakīrtitam // GarP_1,213.109 //
cāṇḍālaśavaviṣṭhādyānspṛṣṭvā snānaṃ rajasvalām /
snānārhastu yadā snāti snānaṃ naimittikaṃ hi tat // GarP_1,213.110 //
puṣyasnānādikaṃ snānaṃ daivajñavidhicoditam /
taddhi kāmyaṃ samuddiṣṭaṃ nākāmastatprayojayet // GarP_1,213.111 //
japtukāmaḥ pavitrāṇi arciṣyandevatātithīn /
snānaṃ samācaredyastu kriyāṅgaṃ tacca kīrtitam // GarP_1,213.112 //
malāpakarṣaṇārthāya pravṛttistatra nānyathā /
saraḥ sudevakhāteṣu tīrtheṣu ca nadīṣu ca // GarP_1,213.113 //
snānameva kriyā yasmātkriyāsnānamataḥ param /
adbhirgātrāṇi śudhyanti tīrthasnānātphalaṃ labhet // GarP_1,213.114 //
mārjanānmajjanairmantraiḥ pāpamāśu praṇaśyati /
nityaṃ naimittikaṃ cāpi kriyāṅgaṃ malakarṣaṇam // GarP_1,213.115 //
tīrthābhāve tu kartavyamuṣṇodakaparodakaiḥ /
bhūmiṣṭhāduddhṛtaṃ puṇyaṃ tataḥ prastravaṇodakam // GarP_1,213.116 //
tato 'pi sārasaṃ puṇyaṃ tasmānnādeyamucyate /
tīrthatoyaṃ tataḥ puṇyaṃ gāgaṃ puṇyaṃ tu sarvataḥ // GarP_1,213.117 //
gāgaṃ payaḥ punātyāśu pāpamāmaraṇāntikam /
gayāyāṃ ca kurukṣetre yattoyaṃ samupasthitam // GarP_1,213.118 //
tasmāttu gāṅgamaparaṃ jānīyāttoyamuttamam /
putrajanmani yogeṣu tathā saṃkramaṇe raveḥ // GarP_1,213.119 //
rāhośca darśane snānaṃ praśastaṃ niśi nānyathā /
uṣasyuṣasi yatsnānaṃ sandhyāyāmudite ravau // GarP_1,213.120 //
prājāpatyena tattulyaṃ mahāpātakanāśanam /
yatphalaṃ dvādaśābdāni prājāpatye kṛte bhavet // GarP_1,213.121 //
prātaḥ snāyī tadāpnoti varṣeṇa śraddhayānvitaḥ /
ya icchedvipulān bhogāṃścandrasūryagrahopamān // GarP_1,213.122 //
prātaḥ snāyī bhavennityaṃ māsau dvau māghaphālgunau /
yastu māghaṃ samāsādya prātaḥ snāyī haviṣyabhuk // GarP_1,213.123 //
itipāpaṃ mahāghoraṃ māsādeva vyapohati /
mātaraṃ pitaraṃ vāpi bhrātaraṃ suhṛdaṃ gurum // GarP_1,213.124 //
yamuddiśya nimajjeta dvādaśāṃśaṃ labhettu saḥ /
tuṣyatyāmalakairviṣṇurekādaśyā viśeṣataḥ // GarP_1,213.125 //
śrīkāmaḥ sarvadā snānaṃ kurvotāmalakairnaraḥ /
santāpaḥ kīrtiralpāyurdhanaṃ nidhanameva ca // GarP_1,213.126 //
ārogyaṃ sarvakāmāptirabhyaṅgādbhāskarādiṣu /
upoṣitasya vratinaḥ kṛttakeśasya nāpitaiḥ // GarP_1,213.127 //
tāvacchrīstiṣṭhati prītā yāvattailaṃ na saṃspṛśet /
evaṃ snātvā pitṝndevānmanuṣyāṃstarpayennaraḥ // GarP_1,213.128 //
nābhimātre jale sthitvā cintayedūrjamānasaḥ /
āgacchantu me pitara imaṃ gṛhṇantvapoñjalim // GarP_1,213.129 //
trīṃstrīnevāñjalīndadyādākāśe dakṣiṇe tathā /
vasitvā vasanaṃ śuṣkaṃ sthalasthā starṇabarhiṣi // GarP_1,213.130 //
vidhijñāstarpaṇaṃ kuryurna pātre tu kadācana /
yadapāṃ krūramāṃsāttu yadamedhyaṃ tu kiñcana // GarP_1,213.131 //
aśāntaṃ malinaṃ yacca tatsarvamapagacchatu /
gṛhītvānena mantreṇa toyaṃ savyena pāṇinā // GarP_1,213.132 //
prakṣipoddiśi nairṛtyāṃ rakṣo 'pahataye tu tat /
niṣiddhabhakṣaṇādyattu pāpādyacca pratigrahāt // GarP_1,213.133 //
duṣkṛtaṃ yacca me kiñcidbāṅmanaḥ kāyakarmabhiḥ /
punātu me tadindrastu varuṇaḥ sabṛhaspatiḥ // GarP_1,213.134 //
savitā ca bhagaścaiva munayaḥ sanakādayaḥ /
ābrahmastambaparyantaṃ jagattṛpyatviti bruvan // GarP_1,213.135 //
kṣipedabañjalīṃstrīstu kurvansaṃkṣepatarpaṇam /
surāṇāmarcanaṃ kuryādbrahmā dīnāmamatsarī // GarP_1,213.136 //
brāhmavaiṣṇavaraudraiśca sāvitrairmaitravāruṇaiḥ /
talliṅgairarcayenmantraiḥ sarvadevānnamasya ca // GarP_1,213.137 //
namaskāreṇa puṣpāṇi vinyasettu pṛthakpṛthak /
sarvadevamayaṃ viṣṇuṃ bhāskaraṃ cāpyathārcayet // GarP_1,213.138 //
dadyātpuruṣasūktena yaḥ puṣpāṇyapa eva vā /
arcitaṃ syājjagādidaṃ tena sarvaṃ carācaram // GarP_1,213.139 //
anyaiśca tāntrikairmantraiḥ pūjayecca janārdanam /
ādāvarghyaṃ pradātavyaṃ tataḥ paścādvilepanam // GarP_1,213.140 //
tataḥ puṣpāñjaliṃ dhūpamu pahāraphalāni ca /
snānamantarjale caiva mārjanācamanaṃ tathā // GarP_1,213.141 //
jalābhimantraṇaṃ yacca tīrthasya parikalpayet /
aghamarṣaṇasūktena trivāraṃ tveva nityaśaḥ // GarP_1,213.142 //
snāne caritamityetatsamuddiṣṭaṃ mahātmabhiḥ /
brahmakṣatraviśāṃ caiva mantravatsnānamiṣyate // GarP_1,213.143 //
tūṣṇīmeva tu śūdrasya sanamaskārakaṃ smṛtam /
adhyāpanaṃ brahmayajñaḥ pitṛyajñastu tarpaṇam // GarP_1,213.144 //
homo daivī balirbhauto na yajño 'tithipūjanam /
gavā goṣṭhe daśaguṇaṃ agnyagāre śatādhikam // GarP_1,213.145 //
siddhakṣetreṣu tīrtheṣu devatāyataneṣu ca /
sahasraśatakoṭīnāmanantaṃ viṣṇusannidhau // GarP_1,213.146 //
pañcame ca tathā bhāge saṃvibhāgo yathārthataḥ /
pitṛde vamanuṣyāṇāṃ koṭīnāṃ copadiśyate // GarP_1,213.147 //
brāhmaṇebhyaḥ pradāyāgra yaḥ suhṛdbhiḥ sahāśnute /
sa pretya labhate svargamannadānaṃ samācaran // GarP_1,213.148 //
pūrvaṃ madhuramaśrīyāllavaṇāmlau ca madhyataḥ /
kaṭutiktakaṣāyāṃśca payaścaiva tathāntataḥ // GarP_1,213.149 //
śākaṃ ca rātrau bhūmiṣṭhamatyantaṃ ca vivarjayet /
nacaikarasasevāyāṃ prasajjeta kadācana // GarP_1,213.150 //
samṛtaṃ brāhmaṇasyānnaṃ kṣatriyānnaṃ payaḥ smṛtam /
vaiśyasya cānnamevānnaṃ śūdrānnaṃ rudhiraṃ smṛtam // GarP_1,213.151 //
amāvāsī vasedatra ekahāyanameva vā // GarP_1,213.152 //
tatra śrīścaiva lakṣmīśca vasate nātra saṃśayaḥ /
udare gārhapatyāgniḥ pṛṣṭhadeśe tu dakṣiṇaḥ // GarP_1,213.153 //
āsye cāhavanīyo 'gniḥ satyaḥ parva ca mūrdhani /
yaḥ pañcāgnīnimānveda āhitāgniḥ sa ucyate // GarP_1,213.154 //
śariramāpaḥ somaṃ ca vividhaṃ cānnamucyate /
prāṇo hyagnistathādityastribhoktā eka eva tu // GarP_1,213.155 //
annaṃ balāya me bhūmerapāmagnyanilasya ca /
bhavatyetatpariṇatau mamāpyavyāhataṃ sukham // GarP_1,213.156 //
hastena parimārjyātha kuryāttāmbūlabhakṣaṇam /
śravaṇaṃ cetihāsasya tatkuryātsusamāhitaḥ // GarP_1,213.157 //
itihāsapurāṇādyaiḥ ṣaṣṭhasaptamakenayet /
tataḥ sandhyāmupāsīta snātvā vai paścimāṃ naraḥ // GarP_1,213.158 //
etadvā divase proktamanuṣṭhānaṃ mayā dvija /
ācāraṃ yaḥ paṭhedvidvāñchṛṇuyātsa divaṃvrajet /
ācārādirdharmakartā keśavo hi smṛto dvija // GarP_1,213.159 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe pañcottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 214
brahmovāca /
atha snānavidhiṃ vakṣye snānamūlā kriyā yataḥ /
mṛdgomayatilāndarbhānpuṣpāṇi surabhīṇi ca // GarP_1,214.1 //
āharetsnānakāle ca snānārtho prayataḥ śuciḥ /
gandhodakāntaṃ vivikte (dhaṃ) sthāpayettānyatha kṣitau // GarP_1,214.2 //
tridhā kṛtvā mṛdaṃ tāṃ tu gomayaṃ ca vicakṣaṇaḥ /
adbhirmṛdbhiśca caraṇau prakṣālyātha karau tathā // GarP_1,214.3 //
upavītī baddhaśikhaḥ samyagācamya vāgyataḥ /
uruṃ rājetyṛcā toyamupasthāya pradakṣiṇam // GarP_1,214.4 //
āvartayettadudakaṃ ye te śatamititryṛcā // GarP_1,214.5 //
oṃ uruṃ hi rājā varuṇaścakāra sūryāya panthānamanveta vā /
pratidhātā ca vaktārastāhṛdayāvipaścit /
namo 'gnyaruṇāyā bhiṣṭutovaruṇasya pāśaḥ /
varuṇāya namaḥ // GarP_1,214.6 //
oṃ ye te śataṃ varuṇaye sahasraṃ yajñiyāḥ pāśā vitatā mahāntaḥ /
tebhirno adya savitota viṣṇurviśve muñcantu marutaḥ svarkāḥ svāhā /
sumitriyāna ityabañjalimākṛtyottareṇa toyaṃ paścādvirājya caiva viniḥ kṣipet /
oṃ sumitriyā na āpa oṣadhayaḥ santu /
durmitriyāstasmai santu yo 'smāndveṣṭi yañca vayaṃ dviṣmaḥ // GarP_1,214.7 //
pādau kaṭiṃ caiva pūrvaṃ mṛdbhistribhistribhiḥ /
prakṣālya hastā vācamya namaskṛtya jalaṃ tataḥ // GarP_1,214.8 //
oṃ idaṃ viṣṇurvicakrame tredhā nidhe padam samūḍhamasya pāṃsure /
mahāvyāhṛtibhiḥ paścādācāmetprayato 'pi san // GarP_1,214.9 //
mārjayedvai mṛdāṅgāni idaṃ viṣṇuriti tvṛcā /
bhāskarābhimukho majjedāpo asmānitityṛcā // GarP_1,214.10 //
oṃ āpo asmānmātaraḥ śundhayantu ghṛtena no ghṛtaṣvaḥ punantu /
viśvaṃ hi ripraṃ pravahanti devīrudidābhyaḥ śucirāpūta emi // GarP_1,214.11 //
tato 'vṛghṛṣya pātrāṇi nimajyonmajya vai śanaiḥ /
gomayena vilipyātha mānastoka ityṛcā // GarP_1,214.12 //
oṃ mānastoke tanaye mā na āyuṣi mā no goṣu mā no aśveṣu rīriṣaḥ /
mā no vīrānrudrabhāmino 'badhīrhaviṣmantaḥ sadamitvā havāmahe // GarP_1,214.13 //
tato 'bhiṣiñcenmantraistu varuṇaistu yathākramam /
imaṃme varuṇe dvābhyāṃ tvannaḥ satvanna ityapi // GarP_1,214.14 //
āpo tvantumasīti ca muñcantvavabhṛteti ca /
oṃ imaṃme varuṇa śrudhīhavamadyā ca mṛḍayatvā mavasyurācake // GarP_1,214.15 //
oṃ tattvayāmi brahmaṇā vandamānastadāśāste yajamāno havirbhiḥ /
aheḍamāno varuṇeha bodhyuruśaṃ samāna āyuḥ pramoṣīḥ /
oṃ tvanno agne varuṇasya vidvāndevasya heḍo avayāsisīṣṭhāḥ /
yajiṣṭho vahnitamaḥ śośucāno viśvā dveṣāṃsipramumugdhyasmatsvāhā /
oṃ sa tvanno agnevamo bhavatī nediṣṭho asyā uṣasovyuṣṭau /
avayakṣvano varuṇaṃ rarāṇo vīhimṛḍīkaṃ suhavo na edhi /
oṃ āpo nauṣadhi hiṃsārdhamno rājastato varuṇo nomuñcā yadāharaghnyā iti varuṇeti śapārmahe tato varuṇa no muñca /
oṃ uduttamaṃ varuṇa pāśamasmadavādhamaṃ vimadhyamaṃśrathāya /
athāvayamādityavrate tavānāgaso aditaye syāma /
muñcantumāmapyathādvaruṇasya tvat /
aho yamasya patnīmānaḥ sarvasmādeva kilbiṣāt /
avabhṛthanicaṃ punarvicerusi nityaṃ prannaḥ /
avadevairdevakṛtā manoyāsi samavatyai kṛtaṃ puṣpācchā devadhīmalpāhī // GarP_1,214.16 //
abhiṣicya tathātmānaṃ nimajyācamya vai punaḥ /
darbheṇa pāyayenmantrairaliṅgaiḥ pāvanairimaiḥ // GarP_1,214.17 //
āpohiṣṭheti tisṛbhiridamāpo haviṣmatīḥ /
devīrāpa iti dvābhyāṃ āpodevā iti tryṛcā // GarP_1,214.18 //
drupadādiva iti ca śanno devīrapāṃ rasaḥ /
āpo devo pāvamānyaḥ punantvādyā ṛco nava // GarP_1,214.19 //
citpatirmeti ca śanaiḥ plāvyātmanaṃ samāhitaḥ /
hiraṇyavarṇā iti ca pāvamānyastathā parāḥ // GarP_1,214.20 //
taratsāmā śuddhavatyaḥ pavitrāṇi ca śaktitaḥ /
vāruṇyā bahavaḥ puṇyāḥ śaktitaḥ saṃprayojayet // GarP_1,214.21 //
oṃ kāreṇa vyāhṛtibhirgāyatryā ca samanvitaḥ /
ādāvante ca kurvīta abhiṣekaṃ yathākramam // GarP_1,214.22 //
jalamadhyasthitasyaiva mārjanaṃ tu vidhīyate /
antarjale japenmantraṃ triḥ kṛtvā cāghamarṣaṇam // GarP_1,214.23 //
drupadādyāstrirāvartedayaṃ gauriti ca tryṛcam /
anyāṃścaiva tu mantrānvā smṛtidṛṣṭānsamāhitaḥ // GarP_1,214.24 //
savyāhṛtiṃ sapraṇavāṃ gāyatrīṃ vā japedbudhaḥ āvartayedvā praṇavaṃ smaredvā viṣṇamavyayam // GarP_1,214.25 //
viṣṇorāyatanaṃ tvāpaḥ sa evāppatirucyate /
tasyaivaṃ tanavastvetāstasmāttaṃ hyapsu saṃsmaret // GarP_1,214.26 //
tadviṣṇoriti mantreṇa nimajyāpsu punaḥ punaḥ /
gāyattrī vaiṣṇavī hyeṣā viṣṇoḥ saṃsmaraṇāya vai // GarP_1,214.27 //
oṃ idamāpapravahatā svaṃ malaṃ kṣālalohitam /
yathātvahotrāmṛtaṃ yacca śophe abhīṣaṇam // GarP_1,214.28 //
āpo mā tasmādenasaḥ pāvamānaśca muñcatu iviṣmato vimā āpohaviṣmān āvirāsati /
haviṣmān deva asuro haviṣmān astu sūryaḥ /
devīrāpo apā patnyā yaśca ūrmirhaviṣyaḥ indriyavānmādityantanaḥ taṃ devebhyo devatā dābhuśukralebhyasteṣāṃ bhāgakarṣivasisamudrasya dakṣiṇyāgrayāsimenāpograrbhiraśmatamodhoḥ /
āpo devī madhumatīragṛhṇantu hyannatī rājasvatilāḥ /
yābhirmitrāvaruṇasya siñcayābhirindramanayatyanna vātī vadrupadāṃ śanno devī apāmasṛgdvayasaṃsūrye santaṃ samāhitaṃ apāṃrasasya yo rasya yo gṛhṇāsyuttamam /
āpo devīrupasūrya madhumatīvayasyāya prajābhyaḥ tāsā māsthānātvarjihatāmoṣadhayaḥ sapippalāḥ /
punantu mā pitaraḥ saumyāsaḥ punantvanāpi pitā sahasāḥ pavitreṇa gatāyuṣā /
punantu mā pitāmahāḥ punantu prapitāmahāḥ /
pavitreṇa gatāyuṣā viśvamāyurvyaśravaiḥ /
agna āyūṃṣi parasatmācarorjamiṣañca tvace vāvasvatvacchūnām /
punantu mā devajanāḥ punantu manasā dhiyaḥ /
punantu viśvā bhūtāni jātavedaḥ ! punīhi mā /
pavitreṇa punīhi mā śukreṇa deva dīdyat /
agne kratvā kratūṃranu /
yatte pavitramarciṣyagne vitatamantarā brahmā tena punātu mā /
pavamānaḥ suvarjanaḥ / pavitreṇa vicarṣaṇiḥ / yaḥ potā sa punātu mā /
ubhābhyāṃ deva savitaḥ / pavitreṇa savena ca / idaṃ brahmapunīmahe /
vaiśvadevīḥ punatī devyā gṛbhnāsyāmisāvakṣyastānnovīta pūjyāḥ /
tayāmadantaḥ sadhamādeṣu vayaṃ syāma patayo rayīṇām /
citpa tirmā punātvacchidreṇa pavitreṇa sūryasya raśmibhiḥ /
tasya te pavitrapūtasya yatkāmaḥ /
praṇitacchakeyaṃ devo vākpatirmā savitā tvacchidreṇa pavitreṇa sūryasya raśmibhiḥ /
tasya te pavitrapate ! pavitrapūtasya catkāmaḥ /
punastacchakeyaṃ dyupatiṃ ayaṃ gauḥ pṛśrirakramīsadaśaśataṃ mātaraṃ punaḥ pitarañca prayasmaḥ /
devo mā savitā punātvacchidreṇa pavitreṇa sūryasya raśmibhiḥ /
tasya te pavitrapate pavitrapūtasya yatkāmaḥ punātacchakeyam? /
oṃ tadviṣṇoḥ paramaṃ padaṃ sadā paśyanti sūrayaḥ /
divīva cakṣurātatam // GarP_1,214.29 //
snātvaivaṃ vāsasī dhaute acchinne paridhāya ca /
prakṣālya ca mṛdādbhiśca hastau prakṣālya vai tadā // GarP_1,214.30 //
ācānte punārācāmenmantreṇa snānabhojane /
drupadāṃ ca trirāvartya tathā caivāghamarṣaṇam // GarP_1,214.31 //
ācamyāplāvya cātmānaṃ trirācamyaśanerasūn /
athopatiṣṭedādityaṃ mūrdhni puṣpānvitāñjaliḥ // GarP_1,214.32 //
prakṣipyodakamaddhūya udutyaṃ citramityapi /
taccakṣurdeva iti ca haṃsaḥ śuciṣadityapi // GarP_1,214.33 //
etāñjapedūrdhvabāhuḥ sūryamīkṣya samāhitaḥ /
gāyattrīṃ ca tathā śaktyā upasthāya divākaram // GarP_1,214.34 //
vibhrāḍityanuvākena sūktena puruṣasya ca /
śivasaṅkalpena ca tathā maṇḍalabrāhmaṇena ca // GarP_1,214.35 //
divākīrtyā tathā cānyaiḥ saurairmantraiśca śaktitaḥ /
japayajñastu kartavyaḥ sarvadevapraṇītakaiḥ // GarP_1,214.36 //
adhyātmavidyāṃ vidhivajjapedvā japasiddhaye /
savyaṃ kṛtvā trirācamya śriyaṃ medhāṃ dhṛtiṃ kṣitim // GarP_1,214.37 //
vācaṃ vāgīśvarīṃ puṣṭiṃ tuṣṭiñca paritarpayet /
umāmarundhatīṃ caiva śacīṃ mātarameva ca // GarP_1,214.38 //
jayāṃ ca vijayāṃ caiva sāvitrīṃ śāntimeva ca /
svāhāṃ svadhāṃ dhṛtiṃ caiva tathaivāditimuttamām // GarP_1,214.39 //
ṛṣipatnīśca kanyāśca tarpayetkāmyadevatāḥ /
sarvamaṅgalakāmastu tarpayetsarvamaṅgalām // GarP_1,214.40 //
ābrahmastambaparyantaṃ jagattṛpyatvidaṃ bruvan /
kṣipedapo 'ñjalīṃstrīṃśca kurvankāṅkṣeta tarpaṇam // GarP_1,214.41 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe snānavidhivivaraṇaṃ nāma caturdaśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 215
brahmovāca /
tarpaṇaṃ sampravakṣyāmi devādipitṛtuṣṭidam // GarP_1,215.1 //
oṃ modāstṛpyantām /
oṃ pramodāstṛpyantām /
oṃ sumukhāstṛpyantām /
oṃ durmukhāstṛpyantām /
oṃ vighnāstṛpyantām /
oṃ vighnakartārastṛpyantām /
oṃ chandāṃsi tṛpyantām /
oṃ vedāstṛpyantām /
oṃ oṣadhayastṛpyantām /
oṃ sanātanastṛpyatām /
oṃ itarācāryāstṛpyantām /
oṃ saṃvatsaraḥsāvayavastṛpyatām /
oṃ devāstṛpyantām /
oṃ apsarasastṛpyantām /
oṃ devāndhakāstṛpyantām /
oṃ sāgarastṛpyantām /
oṃ nāgāstṛpyantām /
oṃ parvatāstṛpyantām /
oṃ sarinmanuṣyā yakṣāstṛpyantām /
oṃ rakṣāṃsi tṛpyantām /
oṃ piśācāstṛpyantām /
oṃ suparṇāstṛpyantām /
oṃ bhūtāni tṛpyantām /
oṃ bhūtagrāmāścaturvidhāstṛpyantām /
oṃ dakṣastṛpyatām /
oṃ pracetāstṛpyatām /
oṃ marīcistṛpyatām /
oṃ ātristṛpyatām /
oṃ aṅgirāstṛpyatām /
oṃ pulastyastṛpyatām /
oṃ pulahastṛpyatām /
oṃ kratustṛpyatām /
oṃ nāradastṛpyatām !
oṃ bhṛgustṛpyatām /
oṃ viśvāmitrastṛpyatām /
oṃ raivatastṛpyatām /
oṃ cākṣuṣastṛpyatām /
oṃ mahātejāstṛpyatām /
oṃ vaivasvatastṛpyatām /
oṃ dhruvastṛpyatām /
oṃ dhavastṛpyatām /
oṃ anilastṛpyatām /
oṃ prabhāsastṛpyatām // GarP_1,215.2 //
nīvītī /
oṃ sanakastṛpyatām /
oṃ sanandanastṛpyatām /
oṃ sanātanastṛpyatām /
oṃ kapilastṛpyatām /
oṃ āsuristṛpyatām /
oṃ voḍhustṛpyatām /
oṃ pañcaśikhastṛpyatām /
oṃ manuṣyāṇāṃ kavyavāhastṛpyatām /
oṃ analastṛpyantām /
oṃ somastṛtām /
oṃ yamastṛpyatām /
oṃ aryamātṛpyatām // GarP_1,215.3 //
prācīnāvītī /
oṃ agniṣvāttāḥ pitarastṛpyantām /
oṃ somapāḥ pitarastṛpyantām /
oṃ barhiṣadaḥ pitarastṛpyantām /
yamāya namaḥ /
dharmarājāya namaḥ /
mṛtyave namaḥ /
antakāya namaḥ /
vaivasvatāya namaḥ /
kālāya namaḥ /
sarvabhūtakṣayāya namaḥ /
audumbarāya namaḥ! dadhnāya namaḥ /
nīlāya namaḥ /
parameṣṭhine namaḥ /
vṛkodarāya namaḥ /
citrāya namaḥ /
citraguptāya namaḥ // GarP_1,215.4 //
brahmādistambaparyantaṃ jagattṛpyatu /
oṃ pitṛbhyaḥ svadhā namaḥ /
oṃ pitāmahebhyaḥ svadhā namaḥ /
oṃ prapitāmahebhyaḥ svadhā namaḥ /
oṃ mātṛbhyaḥ svadhānamaḥ /
oṃ pitāmahībhyaḥ svadhā namaḥ /
oṃ prapitāmahībhyaḥ svadhā namaḥ /
oṃ mātāmahebhyaḥ svadhā namaḥ /
oṃ pramātāmahebhyaḥ svadhā namaḥ /
oṃ vṛddhapramātāmahebhyaḥ svadhānamaḥ tṛpyatāmiti /
udīratāmavara utparāso unmadhyamāḥ pitaraḥ somyāsaḥ /
asuṃya īyuravṛkā ṛtajñāsteno 'vantupitarohaveṣu /
gotroccāraṇena prathamāñjaliḥ pituḥ /
oṃ aṅgiraso naḥ pitarodṛ- /
atharvāṇobhṛgavaḥdṛ - /
teṣāṃ vayaṃ sumatau yajñiyānāṃ api bhadre saumanase syāma /
oṃ āyantu naḥ pitaraḥ saumyāsogniṣvāttāḥ pathibhirdevayānaiḥ /
asminyajñe svadhayā madanto 'dhibruvantu te 'vantvasmān // GarP_1,215.5 //
oṃ ūrjaṃ vahantīramṛtaṃ ghṛtaṃ payaḥ kīlālaṃ parisnutaṃ svadhā stha tarpayata me pitṝn /
oṃ pitṛbhyaḥ svadhā namaḥ /
oṃ pitāmahebhyaḥ svadhā namaḥ /
oṃ prapitāmahebhyaḥ svadhāna namaḥ /
oṃ mātāmahebhyaḥ svadhā namaḥ /
oṃ pramātāmahebhyaḥ svadhā namaḥ /
oṃ vṛddhapramātāmahebhyaḥ svadhā namaḥ /
pitāmahasyadṛ /
oṃ akṣanpitaro amīmadanta pitaro amī tṛpyantaḥ pitaraḥ śuṃ(sva) dhadhvaṃ pibeha pitaro 'pi vānatrayāṃśca viśrayāṃśca bhavanapavitratvā rathapati te jātavedāḥ svadhābhiryajñaṃ sukṛtaṃ jupasva? /
oṃ ṇaduvātā ṛtāyate madhu kṣaranti sindhavaḥ /
mādhvīrnaḥ santvoṣadhīrmadhunaktamutoṣaso madhumatpārthivaṃ rajaḥ /
madhu dyaurastu naḥ pitā madhu mānno vanaspatirmadhubhām astu sūryo mādhvīrgāvo bhavantu naḥ // GarP_1,215.6 //
prapitāmahasyāñjalidānam /
oṃ namo vaḥ pitaro rasāya namo vaḥ pitaraḥ śuṣmāya namo vaḥ pitaro jīvāya namo vaḥ pitaraḥ svadhāyai namo vaḥ pitaro ghorāya namo vaḥ pitaro manyave /
namo vaḥ pitaro gṛhānna pitaro dattaḥ /
namo vaḥ pitaro dadhme tadvaḥ pitaro vāsaḥ /
mātāmahānāṃ trirañjalidṛ /
tato mātrādīnāndṛ // GarP_1,215.7 //
ye cāsmākaṃ kule jātā aputrā gotriṇo mṛtāḥ /
te tṛpyantu mayā dattaṃ vastraniṣpīḍanodakam // GarP_1,215.8 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe devāditarpaṇanirūpaṇaṃ nāma pañjadaśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 216
brahmovāca /
vaiśvadevaṃ pravakṣyāmi homalakṣaṇamuttamam /
prajvālya cāgniṃ paryukṣya-oṃ kraṣyādamagniṃ prahiṇomi dūraṃ yamarājyaṃ gacchatu ripravāhaḥ /
ihaivāyamitaro jātavedā devebhyo havyaṃ vahatu prajānat /
oṃ pāvaka vaiśvānara idamāsanaṃ araṇīgarbhasaṃskṛtatejorūpa mahābrahman muhūrtāstriṣu vaiśvānaraṃ pratibodhayāmi /
oṃ vaiśvānare na ubhayaṃ āprayātu parāvataḥ agnirna svadyutīrūpapṛṣṭho divi pṛṣṭho 'śvi pṛthivyāṃ pṛṣṭhā vivevā oṣadhīcāviveśa vaiśvānaraḥ sahasā pṛṣṭho 'gniḥ namo divya sa ṣaṣṭhāṃ naktam // GarP_1,216.1 //
oṃ prajāpataye svāhā /
oṃ somāya svāhā /
oṃ bṛhaspataye svāhā /
oṃ agniṣomābhyāṃ svāhā /
oṃ indrāgnibhyāṃ svāhā /
oṃ dyāvāpṛthivībhyāṃ svāhā /
oṃ indrāya svāhā /
oṃ viśvebhyo devebhyaḥ svāhā /
oṃ brahmaṇe svāhā /
oṃ adbhyaḥ svāhā /
oṃ oṣadhivanaspatibhyaḥ svāhā /
oṃ grahyāya svāhā /
oṃ devadevatābhyaḥ svāhā /
oṃ indrāya svāhā /
oṃ indrapuruṣebhyaḥ svāhā /
oṃ yamāya svāhā /
oṃ yamapuruṣāya svāhā /
oṃ sarvebhyo bhūtebhyo divācāribhyaḥ svāhā /
oṃ vasudhāpitṛbhyaḥ svāhā /
oṃ ye bhūtā pracaranti dīnāca nimihanto bhuvanasya madhye /
tebhyo baliṃ puṣṭikāmo dadāmi mayi puṣṭiṃ puṣṭipatirdadātu /
oṃ ācāṇḍālapatirdadātu ācāṇḍālapatitavāyasebhyaḥ // GarP_1,216.2 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe vaiśvadevanirūpaṇaṃ nāma ṣoḍaśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________

śrīgaruḍamahāpurāṇam- 217
brahmovāca /
atha sandhyāvidhaṃ vakṣye dvijātīnāṃ samāsataḥ /
apavitraḥ pavitro vā sarvāvasthāṃ gato 'pi vā // GarP_1,217.1 //
yaḥ smaretpuṇḍarīkākṣaṃ sa bāhyābhyantaraḥ śuciḥ // GarP_1,217.2 //
gāyattrīcchando viśvāmitra ṛṣistripāt /
samudrāḥ kukṣiścandrādityau locanau /
agnirmukham /
viṣṇurhṛdayam /
brahmarudrau śiraḥ /
rudraḥ śikhā /
upanaya ne viniyogaḥ /
oṃ bhūḥ pāde /
bhuvaḥ jānuti /
svaḥ hṛdaye /
mahaḥ śirasi /
janaḥ śikhāyām /
tapaḥ kaṇṭhe /
satyaṃ lalāṭe /
oṃ hṛdayāya namaḥ /
oṃ bhūḥ śirase svāhā /
oṃ bhuvaḥ śikhāyai vauṣaṭ /
oṃ svaḥ kavacāya huṃ /
oṃ bhūrbhuvaḥ svaḥ astrāya phaṭ // GarP_1,217.3 //
oṃ bhūḥ oṃ bhuvaḥ oṃ svaḥ oṃ mahaḥ oṃ janaḥ oṃ tapaḥ oṃ satyaṃ tatstripadā /
oṃ āpo jyo 'tī raso 'mṛtaṃ brahma bhūrbhuvaḥ svarom /
oṃ sūryaścetyādi /
oṃ āpaḥ punantvityādi /
oṃ agniścetyādi // GarP_1,217.4 //
oṃ āyātu varade devi ! pūrvāhne brahmadevatā /
gāyattrī nāma yā sandhyā raktāṅgī raktavāsasā /
varahaṃsasamārūḍhā śrīmatpuṣkarasaṃsthitā // GarP_1,217.5 //
kamaṇḍaludharā śāntā akṣamālāvidhāriṇī /
āyātu varadā devī madhyāhne śvetarūpiṇī // GarP_1,217.6 //
māheśvarī ca sāvitrī śuklavastrādimaṇḍitā /
vṛṣaskandhasamārūḍhā triśūlavaradhāriṇī // GarP_1,217.7 //
āyātu varadā devī aparāhne sarasvatī /
atasīkusumaprakhyā vaiṣṇavī garuḍāsanā // GarP_1,217.8 //
pītavastrā śaṅkhacakragadāpadmasamanvitā /
śvetavarṇā samuddiṣṭā ravimaṇḍalasaṃsthitā // GarP_1,217.9 //
śvetapadmasanāsīnā śvetapuṣpopaśobhitā /
oṃ āpo hiṣṭhā mayo bhuvastā na urje dadhāta naḥ // GarP_1,217.10 //
maheraṇāya cakṣuse /
oṃ yo vaḥ śivatamo rasaḥ /
tasya bhājayeteha naḥ /
aśatīriva mātaraḥ /
oṃ tasmā araṅgamāma vo yasya kṣayāya jinvatha /
āpo jana yathā ca naḥ /
oṃ sumitriyā na āpa oṣadhayaḥ santu oṃ durmitriyāstasmai santu yo 'smān dveṣṭi yañca vayaṃ dviṣmaḥ /
oṃ drupadādivamumucānaḥ svinnaḥ snāto malādiva /
pūtaṃ pavitreṇevājyamāpaḥ śundhantu mainasaḥ /
oṃ ṛtaṃ ca satyaṃ cābhīddhāttapaso 'dhyajāyata /
tatorātryajāyata /
tataḥ samudror'ṇavaḥ samudrādarṇavādadhisaṃvatsaro ajāyata /
ahaurātrāṇi vidadhadviśvasya miṣato vaśī /
sūryācandramasau dhātā yathāpūrvamakalpayat /
divaṃ ca pṛthivīṃ cāntarikṣamatho svaḥ // GarP_1,217.11 //
gāyattryā viśvāmitra ṛṣirgāyattrīchandaḥ /
savitā devatā jape viniyogaḥ /
oṃ udutyaṃ jātavedasaṃ devaṃ vahanti ketavaḥ /
dṛśe viśvāya sūryam /
oṃ citraṃ devānāmudagādanīkaṃ cakṣurmitrasya varuṇasyāgneḥ /
āprā dyāvāpṛthivī antarikṣaṃ sūrya ātmā jagatastasthuṣaśca /
oṃ taccakṣardevahitaṃ purastācchukramuccarat /
paśyema śaradaḥ śataṃ jīvema śaradaḥ śatam /
śṛṇuyāma śaradaḥ śatam /
oṃ viśvataścakṣuruta viśvatomukhoviśvato bāhuruta viśvataspāt /
saṃbāhubhyāṃ dhamati saṃpatraidyārvābhūmī janayandeva ekaḥ /
devā gātuvido nāṅgavidvānādbhamitamanasaspata imaṃ devayajñaṃ svāhā vātedhāḥ japet // GarP_1,217.12 //
uttare śikhare jāte bhūmyāṃ parvatavāsinī /
brahmaṇā samanujñātā gaccha devi ! yathāsukham // GarP_1,217.13 //

iti śrīgāruḍe mahāpurāṇe pūrvakhaṇḍe prathamāṃśākhye ācārakāṇḍe sandhyāvidhinirūpaṇaṃ nāma saptadaśottaradviśatatamo 'dhyāyaḥ


_____________________________________________________________


śrīgaruḍamahāpurāṇam- 218
brahmovāca /
vyāsa ! śrāddhamahaṃ vakṣye bhuktimuktipradaṃ nṛṇām /
pūrvaṃ nimantrayedviprānviśeṣādbrahmacāriṇaḥ // GarP_1,218.1 //
pradakṣiṇopavītena devānvāmopavītinā /
pitṝnnimantrayetpādau kṣālayedvākyamantrataḥ // GarP_1,218.2 //
oṃ svāgataṃ bhavadbhiriti praśraḥ /
oṃ susvāgatāmiti tairukte oṃ viśvebhyo devebhya etatpādodakamarghyaṃ svāheti devabrāhmaṇapādayordevatīrthenābhugnakuśasahitajaladānam // GarP_1,218.3 //
tato dakṣiṇā bhimukhena vāmopavītenāmukagotrebhyo asmatpitṛpitāmahaprapitāmahebhyo yathānāmaśarmabhya etatpādodakamarghyaṃ svadheti pitrādibrāhmaṇapādayoḥ pitṛtīrthena ābhugnakuśakusumasahitajaladānam // GarP_1,218.4 //
evaṃ mātāmahādibhyaḥ /
etadācamanīyaṃ svāhā svadheti brāhmaṇahaste eṣavor'ghya iti brāhmaṇahaste puṣpadānam // GarP_1,218.5 //
oṃ siddhamidamāsanam ih